BYKdb

Annotate

A tool to identify and/or annotate sequence(s) as Bacterial tyrosine kinase(s).

Paste a sequence (protein) below (hide help):

OR upload a file in Pearson/FASTA format (limit 20MB):

Warning: most of the errors with the Annotate tools come from not correctly formatted/supported (e.g. ref|accession) FASTA sequence header in the file. If you have doubt just use >accession as sequence header and use a different accession for each sequence.

>sp|P76387|WZC_ECOLI Tyrosine-protein kinase
MTEKVKQHAAPVTGSDEIDIGRLVGTVIEARWWVIGITTVFALCAVVYTFFATPIYSADALVQIEQNSGN
SLVQDIGSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVSKNTFPIFGAGWDRLMGRQNETVKVTT
FNRPKEMADQVFTLNVLDNKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHASPGSEFTVTKYSTLGM
INQLQNSLTVTENGKDAGVLSLTYTGEDREQIRDILNSIARNYQEQNIERKSAEASKSLAFLAQQLPEVR
SRLDVAENKLNAFRQDKDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKLYTKVHPAYRTLLEKRQA
LEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKEQELKITEASTVGDVRIVDPAITQPGVL
KPKKGLIILGAIILGLMLSIVGVLLRSLFNRGIESPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKR
YKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMMTGVSPSIGKTFVCANLAAVISQTNKRVLL
IDCDMRKGYTHELLGTNNVNGLSEILIGQGDITTAAKPTSIAKFDLIPRGQVPPNPSELLMSERFAELVN
WASKNYDLVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSRFEQNGIPVKGVILNSIFR
RASAYQDYGYYEYEYKSDAK

© 1998-2019