BYKdb

Dataset for cluster tadcd of phylum abditibacteriota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2S8SNV1      ------------------------------MNQQPDIPANGAPPL--SPGSSRAISAFPE
A0A2S8SSE1      MKGFYATTPNPQHWLITEFTLNKSSLPDPQNNQIHNGSSNGSTPHGSAPETSLSIVDGRK
                                               **  : .:**:.*   :* :* :*    :

A0A2S8SNV1      ERVSASLPD-------NSAVYAHDADEESFDWQRLLGIVRRRRKIIGFTLAGVLSLAGIY
A0A2S8SSE1      ELEAASFSNSGSQAYSNSPLYT-SPEAEGFDFHRLMAVMLRRWPAMLGVFLSAMLIGLAT
                *  :**:.:       **.:*: ..: *.**::**:.:: **.  :  .: ..: :.   

A0A2S8SNV1      LVLSPKIYKASADLLINTEQKSSSQGLGSLPAITDLLGATGTRSQDTEVEILRSAVVQDA
A0A2S8SSE1      AFFSKPIYEAQATVELTAIQRNGA--MADIPGLEVFQNAGQSGSIDTQIETLRGAPLHNR
                 .:*  **:*.* : :.: *...:  :..:*.:  : .*  : * **::* **.* ::: 

A0A2S8SNV1      ATALVPNAMRPAVKKNIRVDIQPKRSTDIITVNVQSRDPKLAITYSNAICEAYRLQNQQN
A0A2S8SSE1      AMQTLKADTQQPLRSFAPVTVTQVGTTNLISVAVQSYNPDAATKLSNAICKQYIVASLEK
                *   :    . .:..   * :    :*::*:* *** :*. * . *****: * : . ::

A0A2S8SNV1      NSAQYRETADYVGGQLAMVRKKLDQKRDELRKFKEGSGIVDLPTESQARVARLNELQTAF
A0A2S8SSE1      NRSNSSGAVKYVQNQLDLVHKRSVEAQTKLKKFKQENRIFSISDEASALGSKLAGLQQAV
                * ::   :..** .** :*.*.  : . :*.***: . *..:. *:.*  :.*  ** *.

A0A2S8SNV1      QGAEADRTAGEAQLKTLRAQAAQMAPAEIAPSTIVVRPVVQQLKQQLTTLETQRAATSQE
A0A2S8SSE1      AAADSERAATQAKLKGLQTLLSRLPANRVVPSGIQRNPVVAGLQAQLTQLELERSTALRE
                 .*:::*:* :*:** *.:  :.:..  :.** *  .***  *: *** ** :*::: .*

A0A2S8SNV1      FMPGAIEVKTLDDQITALRRRLQTEASTEVGTYTRNINPVRQAVMQSISSTLAGVWSAQA
A0A2S8SSE1      YTPKSYKVVSIDSQIKALKDQLASEAKTMVSGWQP--DPSRAPLASDAASTQTQMWSMDA
                : * : :* ::*.**.**. .* :**.* *. :    :* * .: .. :** : :** :*

A0A2S8SNV1      RAEALRANIVRAQQTVQQLPQREYRLSQLQGDLATYQQTFQSLSDKYQTLLISQKTPIAN
A0A2S8SSE1      RNVALKQQVQQAREAMDQLPEQEFRYTQLATDTQVLQDAYQTLSQRLQSLKIGEQAKVAD
                *  **. :: .*.::::***:.*:* :**  *  . *:::*:**:. *:* *.::: :*:

A0A2S8SNV1      ARVITPAD-EALKVSPRVASTLVLAVVGGLLLAMVIAVAVDGLDNKIYTEEDAVQATGLP
A0A2S8SSE1      ARLVFAADVPTAPIAPNKKKLILYATVLGLLGAVAMALVLDMLDNRIYSDEEAQRITGLP
                **:: .**  :  ::*.  . :: *.* *** *:.:*:.:* ***.**::*:* . ****

A0A2S8SNV1      VLTHVPMLGAQSGQQLL----IDKADSSILLESFRMLRTQLSFISSYGHLKTLVLTSSQP
A0A2S8SSE1      VLSHVPFARHQEEISLMPAPGKQASKTSPLLESFRMLRANIAFSAVDKPIRALVVTSSVP
                **:***:   *.  .*:     : :.:* *********::::* :    :.:**:*** *

A0A2S8SNV1      GEGKSTVSANLAIALALNGKRVVLVDADLRRPRVHTLFGIEKTKGFTSVVANVCSLEEAL
A0A2S8SSE1      HEGKSNSAFNLAAAAAIDGERVILVDLDLRRPTAHSICGLPNKLGFSSVATNRCTLEEAL
                 ****. : *** * *::*:**:*** ***** .*:: *: :. **:**.:* *:*****

A0A2S8SNV1      HQTETEGLQVLPSGPTPPNPSELLDSRAAREIIEQLKATADYVIIDAPPALMLADAQIIS
A0A2S8SSE1      QDTSIPGLRVLTAGPVPPNSFKLLNTQNARTIVNQLAEQADFVVIDTPPMLGMADARLIA
                ::*.  **.**.:**.***. :**::. ** *::**   **:*:**:** * :***.:*:

A0A2S8SNV1      SVADGVLLVVSCQEAKRGAVERTCELMGQTGVKIVGMVLNKFTDEQGGYYG--YYGYK-Y
A0A2S8SSE1      SWVDGTLLVVSCRDVARREVARAADLLMQGGTEVFGLVLTKITTGNNGSYGYNYYGYRQY
                * .**.******.:. *  * *:.:*: * *.::.*:**.*:*  :.* **  ****. *

A0A2S8SNV1      GGYSAYLEDKALSKHDNLPS
A0A2S8SSE1      GEYLDIAETPNELEEKTLKS
                * *    *     : ..* *

© 1998-2019