BYKdb

Dataset for cluster orphancd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

236 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      -MSQELQSLARHSYPTSTQPLSTIDLPPTAVSIEPPGPGLKRDYSGPVEYWQIVRRHKGA
A0A359M0J2      MHPEDPNSGTSHRPQALTPIVLPRNAQPALYTPFPSEPAPEAPATNWVQFHLAILKRRFW
A0A2V8JLJ1      ------------------------------------------------------------
A0A2V9GAQ1      ---------------------------------------MTEENKLVPRENGSLGGSDLL
G8NS05          ------------------------------MIPSRPENFSAEPDSRAASAGPAATDATLS
A0A2V8KZ20      -----------------------------------------------------MKNFENL
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ------------------------------------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      -----------------------------------------------------PTIKELY
A0A2V9BCK9      ------------------------------------------------------------
A0A2V9TMX2      ------------------------------------------MYQATSKVAIFPEVPNVL
A0A2V8N2J7      ---------------------------------------------------MASTAGNSL
A0A3N6BI26      ------------------------------------------------------------
A0A2V9JMM3      --------------------------------------------------MQLTEVAKGA
A0A2V9M815      --------------------------------------------------MQLTEVAKGA
A0A2V9A795      ------------------------------------------------------------
A0A355ESH9      ------------------------------------------------------------
A0A3D0NW85      ------------------------------------------------------------
A0A353CAT5      ------------------------------------------------------------
A0A2V9HB55      ------------------------------------------------------------
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      ------------------------------------------------------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ------------------------------------------------------------
A0A2V8BV42      ------------------------------------------------------------
A0A2V8F916      ------------------------------------------------------------
A0A1Q7K833      ------------------------------------------------------------
A0A1Q8AMY4      ------------------------------------------------------------
A0A2V8BM40      ------------------------------------------------------------
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      ------------------------------------------------------------
A0A1F2R0X5      ------------------------------------------------------------
A0A2V8B278      ------------------------------------------------------------
A0A2V8CEF9      ------------------------------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      VLLATVAGALLGFAMTLSEPRIYQAKTTLEYQGINEEFLDMKKVNPVVDTSYLDSDISTQ
A0A359M0J2      WVLALGFLGTGVGFLVFLPQDPQYMAATTIELQPINENFLGAFDPLSGSFSSQNLNAQTQ
A0A2V8JLJ1      ------------------------------------------------------------
A0A2V9GAQ1      PVPIRLPVWELSPREPHLYDYLLILRKHQWLILSFLHRENANILPFQGTDSYDIMMDQDN
G8NS05          EALMTIRKRKYVILAAALLGMIYGFYKGSTQPHLFESYGDIEIRSGSSDQYRIAGSTGAG
A0A2V8KZ20      TISDYIDIARRRIWYVVTTTTLVAAGTVLFALRLPAIYKSETTIAISSRFLPENYMPTID
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      --------------------------------------------------ARRLTRAATP
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      ELDAVSDAYLRTQYSILASESLARRAIDQLHLETLREFNSRKWWQLWPETRKPSTTQTFA
A0A2V9BCK9      -----MKATKMYEKFFGLRESPFNVNPDPRYLFLTPSTQEALASLAYGIRGRKGIILLTG
A0A2V9TMX2      GFKDAENIAPDYEYEATLETQVAILRSDALALKVIEGMRLYQDPRFTAVKQSSPESPMGE
A0A2V8N2J7      SVFSILDALRRRKFILMISKILLTAGFAIFAHLQPDRFRATALIAAA----QTTPPEYLR
A0A3N6BI26      -----------------------------MTSQLSWLKRTVSNLRPG----RSDAPKTGA
A0A2V9JMM3      SILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVE----RPPASDLLK
A0A2V9M815      SILAILDAARRRKFYVIVPALVLTVCVGAFASRLPNSYRAQALLAVE----RPPASDLLR
A0A2V9A795      ------------------------------------------------------------
A0A355ESH9      ------------------------VRSLDLMADPSFNPGAAAAKE-----------RTGA
A0A3D0NW85      ----------------------RGFLRAIGLASSPDAQSDASLSEFA----ASPNSGLMS
A0A353CAT5      -----------------------MLRAIGLASDTTKDTTSTADSVNS----LNS--GLVS
A0A2V9HB55      ----------------------KILTSETLALQTIRNNGLSARPEFS----SPS--GPSE
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      ----------------------MDLPRMSGRSDATSSWRSAATSIWG----RKP--RPRH
A0A2V8F8T3      ----------------------MDLPRMSGRSDATSSWRSAATSIWG----RKP--RPRH
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      ----------------------------------------MGRAGQARGPLS------TH
A0A2V8BV42      ----------------------------------MADLPPNARADSSPGVFAPPPAGAPY
A0A2V8F916      ----------------------------------MADLPPNARADSAPGVFAPPPAGAPY
A0A1Q7K833      ----------------------------------------------------------MY
A0A1Q8AMY4      ----------------------------------------------------------MY
A0A2V8BM40      ------------------------------------MPDHRQRTSSGTGSNPPAPAPLAY
A0A2V8CRT6      ------------------------------------------------------------
A0A1F2VH76      --------------------------MNGPNTPANLQAGTH---ALTPLSQE--------
A0A1F2R0X5      --------------------------MSESASGGAHRPSTTSASASHPTGTAGHSPASSY
A0A2V8B278      --------------------------MAEPKAPHPLRPATT---ADHPAAAA---PTSTY
A0A2V8CEF9      --------------------------MAELKAPHSLRPATT---ADHPAAAA---PTSTY
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ------------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      ------------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      VKILESRALISRVREKMATRPQPERLQPPDRLGMWRTALRLNAPTADGLWKQALGSAADG
A0A359M0J2      ISILRSYSLLSAALERMERESTLTAAAPAGRFAALRRRLGFVPLEPLEATREATFIAARS
A0A2V8JLJ1      ------------------------------------------------------------
A0A2V9GAQ1      YIETQSKILTSETLALQTIRNNGLSARPEFSSPNGPSEAVALGSLANQKRPPELGQFLGS
G8NS05          GNRLPTEVAILKSDTLLLTVAEDLDLANNQDFLGMTQRPPHVNIEDPNVRQATIGRMQAI
A0A2V8KZ20      RQTITDRMDFARQQLQSRTFLEGIVEEFH------------LAGPDGVEKAAEVIRNKIE
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      SGATAGQPSA---TDLANAFLGAVHVEQV-------------------------------
A0A2V8MUA1      ------------------------------------------------------------
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      ------------------------------------------------------------
A0A2V9G1P7      VGPVPQVRDRELSERVLERFLDRLTIDPV-------------------------------
A0A2V9BCK9      EVGTGKTTLL---NRLLDWLRHEQAVTAF-------------------------------
A0A2V9TMX2      PSMQPDPVQA---AGLLGAFRGGLSVQPV-------------------------------
A0A2V8N2J7      -HVAPPPLNI---EDHLWTVREVLYSEPVLKAAARESKRYRSNKGDLSPQQLDEFKQAIG
A0A3N6BI26      DESGAGRDKN---RDVLDTFRDRLEVAQV-------------------------------
A0A2V9JMM3      MGGTPGPPGI---QEQLRVIRETLFARPLLQEVLKEFTLYGPATD--PDWATEDMKKRIR
A0A2V9M815      MGGTPGPPSI---QEQLRVIRETLFARPLLQEVLKEFKLYGPATD--PDWATEDMKKRIR
A0A2V9A795      --------MY---QRVLERFQDRLTIEPV---------------------------S---
A0A355ESH9      TTAEEDEATL---GKLAQQLKGGLTVDPV---------------------------R---
A0A3D0NW85      ADEIAEAIRL---APFVDVIKRNLSIEPV---------------------------RESR
A0A353CAT5      ADEIAEAIRL---APYVEIIRNNLTVEPV---------------------------REPR
A0A2V9HB55      AIAVGSLANQ---KRPPGLGEFLGSLSVK---------------------------RVP-
A0A2V8CU57      ------------------------------------------------------------
A0A2V8BDI4      RRCA---RRR---PRPSWRSPRERQWRST---------------------------RRP-
A0A2V8F8T3      RRCA---RRR---PRPSWRSPRERQWRST---------------------------RRP-
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      AVHKDVHILDLLAVIYRYRRMAFSVFILTTIALMIQGYSGVRLYQAKAQLLIEDERSTAM
A0A2V8BV42      APDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIEDERSTAV
A0A2V8F916      APDGDIHLLDRFAILYRYRRIAVSVFILTTAVLMIQGYTNVKVFQARAQLLIEDERSTAV
A0A1Q7K833      SPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAV
A0A1Q8AMY4      SPDTDVHILDRLAVLYRYRRIAIAVFVLTTAAMMIQGYTTEKIFRAQARLLIEDERSTAV
A0A2V8BM40      AADNDVHILDRLAVIYRYRYIATAVFVLATSAIMIQSYTSLELFRAQARLLIEDERSTAV
A0A2V8CRT6      ----------------------------------------LELFRAQARLLIEDERSTAV
A0A1F2VH76      -----THLLDRLSVLFKYRRAAMAVFVLVVAWNMVDSYTTIPQYQAQSRVLIDEDTAGLG
A0A1F2R0X5      APQSEVHLLDRLVVLYRYRWLCLTVFVLVSGAMIIQGYTTVRMYRAQARLQIDDERSTAI
A0A2V8B278      TPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSTQMYRAQARLLIEDERATAV
A0A2V8CEF9      TPDTDVHILDRLAVLYRYRRVAIAVFILTTVAMMIQGYSSIQMYRAQARLLIEDERATAV
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      --------------------------------------MSEFLTRRVQEDQLRRDQDALA
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      ---------------------------------------------------------MLA
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      -------------------------------------MKSEKDLRASSTLPAAP------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ----------------------------------------------------------MN
A0A2V9JMZ4      -MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVF--CRQGLIEAVSSNLEQYH----LG
A0A2V9MDJ6      -MTVQLLLDHIRPILEGSKDGTLLLGNQSEIIKVF--CRQGLIEAVSSNLEQYH----LG
A0A2V8QJT6      ------------------------------------------MLEAENDRKMAE------
A0A2V8FSM8      VRVRSSGTNRIIDMSCDSTNGQIAADFCNTLAQEY--IDQSLEARWKTTEYTGQ---WLT
A0A359M0J2      VMPRIVPGTRIIQITASSTIPEVAANLVNAVAAEY--VYQNQQFRSNSVQRTTQ---WIA
A0A2V8JLJ1      ----------------------------------MEGLVRQFKAAAEAAKAAAA------
A0A2V9GAQ1      LTVKRVPNSHLMDVSFESTDPQLAARIVNAHISSY--IEQNFRSKYEATTRAST---WLT
G8NS05          VSVANIPKTDIIRISCSTFNAKLSADIINKLIDAY--IKRSFTSRVSSTQRASG---WLT
A0A2V8KZ20      ITVLT---ANTFKLGFPAADPFSAQAVTKRLTERI--IQLNDSFRKEKVQVADQ---FLE
A0A3D0NWU2      -----------------------------------------SASQRGEGMNIPD---LYE
A0A2V8EPD9      ------------------------------------------------------------
A0A3N5NSX5      ---RG---SRLFNVSITSSDPQFAARAADALAAEY--VQFNLEYRTDATRKSLD---FLA
A0A2V8MUA1      -------------MQATNEVAQSDNKIREFYQKHFPGLPEDQAAILQTLNDLGRERVTVE
A0A2V8MBH9      ------------------------------------------------------------
A0A3N5ZPQ7      ------------------MDPAQASRLCSYPCAAFPTPKATEVNRFESSMDNRK---AIL
A0A3N5P5F2      -------------------------------------IERNLQFKFDASKDAAD---WLT
A0A2V9G1P7      ---NR---SRLVAVRFDSHDPELAARVVNTLAADY--VDQSLEARWQATQKAAE---WLS
A0A2V9BCK9      --IFN---TRLSVTEFFDCLTADFGISCQSPSKSH--VLLGLNRWLLDRYRAGETAVLIV
A0A2V9TMX2      ---PS---TRLIQVSYTHSDPRFATEITNALVKTF--IEENFRTKYNSASQTSE---WLG
A0A2V8N2J7      IKVDS---EHSFQLTYEAGDRYDAMNVTNKLAELF--VQNASAKREQKTSEAAN---VIN
A0A3N6BI26      ---PN---SRLVEIRWVSPDPTLAAAVSDTLAEEF--IEQNLQTKFEANTRATE---FLK
A0A2V9JMM3      IQVEG---TDAFYIGFEDGDRQAVAEVANRLAELF--VKSTSASQEQNVEEAAG---LLD
A0A2V9M815      IQVEG---TDAFYIGFEDGDRQAVAEVANRLAELF--VKSTSASQEQNVEEAAG---LLD
A0A2V9A795      ----R---SRLVTVQFDSNNADLSARVVNTLAEDY--IDQSLEARWAATQKAAD---WLS
A0A355ESH9      ----N---TQLVRLSFRSSSREFSAKAANAFAESF--IDMGVEDRYASAGKAST---FLG
A0A3D0NW85      VTVKD---TRLIEVAFRNTDPQLAAFVVNGIGETF--AASNQEQRSGTSRKTSD---FLQ
A0A353CAT5      ATFKD---TRLIEISFRHTNPELAAFVVNGLGETF--ASTNQEQRSGTSRKTSD---FLQ
A0A2V9HB55      ----N---SRLMDVSFESTDPQLAARVVNAHIASY--IEQNFSSKYEATTRASA---WLA
A0A2V8CU57      ------------------------------------------MSRLEDALRRAE----LA
A0A2V8BDI4      ----D---RAIVARSRGRCSAASTAR----DGSCF--SEDTSMSRLEDALRRAE----LA
A0A2V8F8T3      ----D---RAIVARSRGRCSAASTAR----DGSCF--SEDTSMSRLEDALRRAE----LA
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      PGI--ATGQYYEDPVPYYNTQHRILRSRELARRVVRRLQLGTHPEFNGTATPPVTLVTAV
A0A2V8BV42      PGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMI
A0A2V8F916      PGLNSSENTYYEDPEPYYNTQFRILKGRDLVRRVVRRLKLGTIPEFNGTAVPPPTPVSMI
A0A1Q7K833      PGM-SPEN-FYQDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTML
A0A1Q8AMY4      PGM-SPEN-FYQDPDLYYKTQYRILKGRDLTRRVVRRLNLGSVPEFNGTAEPPSTPSTML
A0A2V8BM40      PGV-SADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNMAAIPEFNGTAEPPVTPLTIA
A0A2V8CRT6      PGV-SADNSYYEDPDLYYKTQYRILKGRDLTRRVVRKLNVAAIPEFNGTAEPPVTPLTIA
A0A1F2VH76      TPADISQNFTLQDPEVYLQTQLRIIRGRELARRTAKKLELHTVPEFNGQGAKPTALAEAI
A0A1F2R0X5      PGLQSDQNTFYEDPEPYYQTQYRILRGRDLTRRVVQRLRLDTVPEFNGTAERAPTPISML
A0A2V8B278      PGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAEKPSTPATLL
A0A2V8CEF9      PGITTAENTYYEDPDLYYKTQYRILKGRDLARRVVKRVNLGAVPEFNGTAQKPSTPATLL
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      QLLAQGPDSLGFSERLAAIGAVQGS-----------------------------------
A0A1Q7LC46      ------------------------------------------------------------
A0A1Q8BDC5      NPVLSEIRELHQKKQSGILVLTGGAGERVEVFFREGMIDAASSNMDARRLGDYLAKQEYL
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      MEASAVQPLLAESRRQ--GVPIGEAA-------------LRSKLLEPAELADVIRR----
A0A2V8PQZ9      ---------------------------------------------NFGQRGTAIPATAMA
A0A2V8D8B1      ------------MPCP--LKSARTSSCRSWPISTGPGQSDRTALDTVPAILAN-------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      LVLDEIRQLGENRENG--FLTLSRNGHRVVMFYREGMIQAVSSNLTSHRLGDYLVKAGY-
A0A2V9JMZ4      QHLVTEGFMEASAVQP--LLAESRRQ-GVPIGEAA----LRSKLLEPAELADVIRR----
A0A2V9MDJ6      QHLVTEGFMEASAVQP--LLAESRRQ-GVPIGEAA----LRSKLLEPAELADVIRR----
A0A2V8QJT6      ---------------------------------------AEYNAAKAPGAAGALAEAGA-
A0A2V8FSM8      KQLDDLKIKLEKQEEG--LQAYANAT-GLIMTSEK----NNVQEAQLGDLEKELSVARAD
A0A359M0J2      GQLEETKFKLEQAEQK--LQDFVRKS-GNVFVNSE----DTLANSKLRQLQAELTAAQTD
A0A2V8JLJ1      ------------------------------------------------------------
A0A2V9GAQ1      DQLTELKIRVQKAEDA--RIAYERRN-QIWTLDDK----QNITSQRLGDINRQLTDAQSE
G8NS05          SQLDELKHQVETSQNQ--VIDLQKRI-GVLSIDPT----HNQISSSLEELTTAAGTAQIA
A0A2V8KZ20      EQLEQAGNELSEAERK--LLQLRNGAFPGVTTDVVTPDVVRDLQAQLAKLDAQVESANDQ
A0A3D0NWU2      NKIFQDTMRLNNERKA--KLQ---------------------------------------
A0A2V8EPD9      ----------------------------------------------MTRLADALLRANRQ
A0A3N5NSX5      GEIAKQQTKVEDSERA--MAEYRESN-NALSLEDR----QNTVVSSLNQVNDEYTRIRTV
A0A2V8MUA1      NSIESITTETKLLEQR--RQEQQKFK-IAMSSRAPAGPSRAEGQARQPSRAEQLIAAKRD
A0A2V8MBH9      -------------EEK--LVSYAKNN-QILSLDAS----QNTVVERLAGLNKQLLEAEND
A0A3N5ZPQ7      EYMKQIEVQEKTGSLY--LVH------------------GAADHTELTEMKEVIRV----
A0A3N5P5F2      NQLDAQRKNVEETELA--LQRYREQN-NATSTN------DPEVIQRLSGLNAAVMEARTA
A0A2V9G1P7      QQLVGVKAKLEKSEDA--LQGYARHN-GLVFLETDKGASQNVANERLQQLQEQLTKAQSE
A0A2V9BCK9      DEAQNLSQQLLEEIRL--LSNLETST-EKL---------LQIVLSGQPELEEKLKHAQLR
A0A2V9TMX2      KELADLQLKVQTSEEK--LVRYQKDH-GILGVDEK----QNIVTEKLGELNKELTEAETD
A0A2V8N2J7      EQVDDLKNRLQRQNDQ--IQNY-KTK-AVHALPDH----IDNTIKAIDSLKEQIQDRETK
A0A3N6BI26      KQLQDMKGKVEKSEQE--LVKYAREN-NIVNIGPDR---GSMVLQTLEDLNRQMTTVEGE
A0A2V9JMM3      QELARLRDKLADEDEE--IKEYK----------------QKVGEELPEHLGTNLKLVEAL
A0A2V9M815      QELARLRDKLADEDEE--IKEYK----------------QKVGEELPEHLGTNLKLVEAL
A0A2V9A795      QQLVGVKSKLEKSEEQ--LQDYARHN-GLVFLETDKGASQNVANERLQQLQEELTKAEAE
A0A355ESH9      SQIETLKQEVAEKEAQ--LQAFSRSS-DIVTLDPQ----SNVTLRRLETLNTALMDAKKE
A0A3D0NW85      QRIADLQSDIRRDELK--LVELERTE-GILKTPGD----QTIVLERLAGLNKDLLTAENE
A0A353CAT5      KRISDLQADIRNDEVR--LVELERSE-GILKTPGD----QTIVLERLGGLNKDLLTAEND
A0A2V9HB55      DQLTELKIKVQRAEDA--RIAYERQN-QIWTLDDK----QNITSQRLSDINKQLTDAQSE
A0A2V8CU57      NRQAKMKTEAEAA---------VKTP-AVAAWSEP----EAVTAPFAAAGSEPESAAAPP
A0A2V8BDI4      NRQAKMKTEAEAA---------VKTP-AVAA-----------------------------
A0A2V8F8T3      NRQAKMKTEAEAA---------VKTP-AVAAWSEP----EAVTAPFAAAWSEPESAAPLP
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      RAAAA------RALRGLTLLSAAVEEEAPTPDETPAEAALVGNFLSRVVVTPVPDSKLVD
A0A2V8BV42      NDFQT------RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVD
A0A2V8F916      NDFQT------RLMGLLRKPAAPAPQEAPKVDETPDESALVSSFIGRVTVEPIRTSRLVD
A0A1Q7K833      RDFQQ------RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNVEPVTGSKLVD
A0A1Q8AMY4      RDFQQ------RVVHLIKPSALAETQEVPKVDETPDESSMVNAFIGRVNVEPVTGSKLVD
A0A2V8BM40      HDLEK------RIVAFVRPAA-SEATDTRKIDEAPSESGLVNAFIGQVTVEPVPGSKLVD
A0A2V8CRT6      HDLEK------RIVAFVRPAA-SEATDTRKIDEAPSESGLVDAFIGQVTVEPVPGSKLVD
A0A1F2VH76      STVKTYAYWPVRIVLGSTPAPSPVATA-----ESGDPEAYADALIGHLGVNQIRGSRLVD
A0A1F2R0X5      RDFER------RLVSLVRRAPAQPQEEPPKLDETTDESALVGAFIGRVGVEPVRGSRLVD
A0A2V8B278      HDLKQ------KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVD
A0A2V8CEF9      HDLKQ------KIVGLVRPAPAPENTESPKVDETADESALVSAFLSRVDVAPVSGSKLVD
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      -------------------------------------MNSQMKEVDAQIQVEMKKIVSRV
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ------------------------------------------------------------
A0A1Q7LC46      --------------------------------------------------MKKESLYEFA
A0A1Q8BDC5      HA----------------------------------------------------------
A0A2V9Q1Y8      ------------------------------------------------------------
A0A2V8JXG1      ------------------------------------------------------------
A0A350D2W9      ------------------------------------------------------------
A0A2V9I4J1      ------------------------------------------------------------
A0A2V8PQZ9      AT----------------------------------------------------------
A0A2V8D8B1      ------------------------------------------------------------
A0A3B9LSB4      ------------------------------------------------------------
A0A2V9H7U2      ------------------------------------------------------------
A0A2V8NJB5      ------------------------------------------------------------
A0A2V9JMZ4      ------------------------------------------------------------
A0A2V9MDJ6      ------------------------------------------------------------
A0A2V8QJT6      ------------------------------------------------------------
A0A2V8FSM8      RI-------------------------------------------------AKQSKYEMS
A0A359M0J2      RI-------------------------------------------------NKENRLNVA
A0A2V8JLJ1      ------------------------------------------------------------
A0A2V9GAQ1      RM-------------------------------------------------KKESLYQFA
G8NS05          RILAESRYRVLSG-----------------------------------------------
A0A2V8KZ20      RKVLQRRLEEHRQ--------------------------------------LKIALNASS
A0A3D0NWU2      ------------------------------------------------------------
A0A2V8EPD9      NQ----------------------------------------------------------
A0A3N5NSX5      RI-------------------------------------------------QKEALYNQI
A0A2V8MUA1      QLAAERLKHTDDW-----------------------------------------------
A0A2V8MBH9      RKMAEAEYNAAKAPGAATALAEGA------------------------------------
A0A3N5ZPQ7      ------------------------------------------------------------
A0A3N5P5F2      RL-------------------------------------------------EKEAALTQL
A0A2V9G1P7      RY-------------------------------------------------EKEALYRLV
A0A2V9BCK9      QF--------------------------------------------------RQRITVRA
A0A2V9TMX2      RI-------------------------------------------------QKEADYKLA
A0A2V8N2J7      IAEEQAKRASIER--------------------------------------ELQDLESKG
A0A3N6BI26      LI-------------------------------------------------GKTADYQAV
A0A2V9JMM3      EMRLQAKRDSIGENQARR-------------------------AQVLEEMKGLQKEPAQE
A0A2V9M815      EMRLQAKRDSIGENQARR-------------------------AQVLEEMKGLQKEPAQE
A0A2V9A795      RY-------------------------------------------------EKEALYRLV
A0A355ESH9      RI-------------------------------------------------EKEAHYHEV
A0A3D0NW85      RKTAEAQFLSVRNN-----------------------------PERVSALAEAESARYIT
A0A353CAT5      RKTAEAEYNSVKGS-----------------------------PERLKSLAEAESARYIT
A0A2V9HB55      RM-------------------------------------------------KKESLYQFA
A0A2V8CU57      VVAAWSEPETVTAPLAA-------------------------------------------
A0A2V8BDI4      ------------------------------------------------------------
A0A2V8F8T3      AVAAWSEPETVTAPLAAAAWSEPESAAVLPAVAAWSEPETVTAPLAAAAWSEPESTAVLP
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      VFFTAADPAVTALAATTLAEEYVAQNLELKQQSTQNMLEWLENEVAAQQTKVEQSERDLA
A0A2V8BV42      VTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQKVRESEQALA
A0A2V8F916      VTFMSADPNFAALAVNTLVDEYTEQNLAIKLESSQNMLNWLAKELDKQQQKVRESEQALA
A0A1Q7K833      VTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALA
A0A1Q8AMY4      VTFDSMDPKFAQLAANTLVDEYVEQNLALKQQSTQNMIDWLDKELERQQQKTEESERALA
A0A2V8BM40      VLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQKVGESERGLA
A0A2V8CRT6      VLFDSRDPKFAQAAANALVDEYVEQNLQVKLQSTQNMIEWLDKELEKQQQKVGESERGLA
A0A1F2VH76      LLFTAADPAFAAKAANAYAEEYVAQNLELKAANLDKSLEWLTGEVGRQEGLVKASERALA
A0A1F2R0X5      VTFLSVEPKFAAEAANALAEEYVEQNLQVKLQTAQNMLDWLGKELATQQQKVEESERSLA
A0A2V8B278      VTFDSMDRRFAATAANTLVDEFVDQNLQVKLQSTENMIDWLDKELDKQQQKVQDSERGLA
A0A2V8CEF9      VTFDSMDPRFAATAANTLVDEFVEQNLQVKLQSTENMIDWLDKELDKQQHKVQDSERALA
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------MSRIHEALKQAA
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------QYNILKREVDTN
A0A2V9EVA0      ------------------------------------------------MSRIFEALQKIQ
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------MSRLHEALKKAE
A0A3N5YN96      ------------------------------------------------MSRIQRVLDKAE
A0A1Q7Y646      ------------------------------------------------MGRVYDALKRAS
A0A2V8QZU0      ------------------------------------------------MGRVYEALKRAA
A0A2V8RSQ9      ------------------------------------------------MGRVYEALKRAA
A0A2V9LS17      ------------------------------------------------MSRIHEALKRAE
A0A2V9AGR3      ------------------------------------------------MSRIHEALRKAE
A0A2V9G0N7      ------------------------------------------------MSRIHDALKKAT
A0A2V9GQ44      ------------------------------------------------MSRIHDALKKAA
A0A2V9HRN3      ------------------------------------------------MSRIHDALKKAA
A0A2V8WG13      ------------------------------------------------MSRIHEALKKAA
A0A2V8X987      ------------------------------------------------MSRIHEALKKAA
A0A1Q7KX94      ------------------------------------------------MSRIHEALKKAA
A0A2V8XHT0      ------------------------------------------------MSRIHEALKKAA
A0A2V9L2P7      --------------------------------------MNQLLIEHNLLKRDFDSNQALY
A0A2V7UMX0      ------------------------------------------------MLRSTVGEWRCG
A0A136K497      -------------------------------------------------MSVLQALQRKN
A0A399W9E4      -------------------------------------------------MSVLQALQRKN
A0A2V7X0V9      ------------------------------------------------MSRIHEALKKAE
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------MSRIHEALKRAE
A0A2V9S1P8      ------------------------------------------------MSRIHEALKKAE
A0A2V9RTW2      ------------------------------------------------MSRIHEALKRAE
A0A2V9TGF1      ------------------------------------------------MSRIHEALKRAE
A0A2V9XEV6      ------------------------------------------------MSRIHEALKRAE
A0A2V9Y3Q6      ------------------------------------------------MSRIHEALKRAE
A0A2V9R269      ------------------------------------------------MSRIHEALKKAE
A0A2V9PTS3      ------------------------------------------------MSRIHEALKKAE
A0A2V9NPF4      ------------------------------------------------MSRIHEALKKAE
A0A2V9PNZ0      ------------------------------------------------MSRIHEALKKAE
A0A321LMC5      ----------------------------------------------MPMGRVYKALVKAG
A0A2V8X713      ------------------------------------------------MSRIHEALKKAE
A0A2V8ZLE9      ------------------------------------------------MSRIHEALKRAE
A0A2V8Y4D3      ------------------------------------------------MSRIHEALKRAE
A0A2V8Z2X8      ------------------------------------------------MSRIHEALKRAE
A0A2V9C3F6      ------------------------------------------------MSRIHEALKKAE
A0A2V9QMU9      ------------------------------------------------MARVPIEPAEPD
A0A2V9QY75      -----------------------------------------------------QKLKEAG
A0A2V9SVU9      RSDYLAALQRETMLRAALDKQKQEANKLNESAIDYSLLKRDVETNRTLYEGLLEKLKEAG
A0A2V8W5N5      ------------------------------------------------MSRIHEALKKAH
A0A2V8XG53      ------------------------------------------------MSRIHEALKKAH
A0A2V9XV04      ------------------------------------------------MSRIHEALKKAE
A0A2V9CBY1      ------------------------------------------------MSRVYEALKNAQ
A0A2V9D656      ------------------------------------------------MSRVYEALKNAQ
A0A352EZH8      ------------------------------------------------MGRVYDALRRSG
A0A0B6X033      ------------------------------------------------MGRVFDALRRAA
A0A2V8R0I3      ------------------MSSCASVATLQRRLKMSGQPSAVPVLGEEPMGRVYDALKRAE
A0A2V8N1U8      ------------------------------------------------MGRVYDALKRAD
A0A2V8QL35      ------------------------------------------------MGRVYDALKRAE
A0A352FU10      ------------------------------------------------MGRVYDALKRAE
A0A2V8LCU0      ------------------------------------------------MGRIYDALKRAE
A0A1Q7NGT0      ------------------------------------------------MGRIYDALKRAE
A0A2V8MLP9      ------------------------------------------------MGRIYDALKRAE
A0A2V8PQZ0      ------------------------------------------------MGRIYDALKRAE
A0A3B9MKY6      ------------------------------------------------MGRVFDAIKRAS
A0A3D5SKZ1      ------------------------------------------------MGRVFDAIKRAS
A0A2V8NRW2      ------------------------------------------------MGRVYDALKRAS
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      -------------------ADLTRALSELTTKRADRRA--LLYRYTDDHPAVRRVTTDID
A0A1Q7LC46      KAGDLDAVPQVQSN-----AALTDLLKKQRDSSAEYTD--ALAQYGPNFPKVQRLKTELK
A0A1Q8BDC5      -------------------RDLDAAHSEAQRHQILIGEAVVRKRLLGQAEVIVAVRQQAT
A0A2V9Q1Y8      ---------------------------------------------------------MIR
A0A2V8JXG1      ---------------------------------------------------MAAIRDQIA
A0A350D2W9      ---------------------------------------------------MQRLKAELD
A0A2V9I4J1      -------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHFENLLL
A0A2V8PQZ9      -------------------ATFQPTRTLSARASLNLRSSSTSTRAHSLQPPLRNSDR-LS
A0A2V8D8B1      -------------------QFVQQQKSELAELQRQQAQ--LSDKLGDKHPDMVKNRHAIQ
A0A3B9LSB4      -----------------------------------------MVDATEEAPEVKEVDQQIA
A0A2V9H7U2      -------------------------------LKTQNVD--ALEQYGPKHPKVERLRSQVN
A0A2V8NJB5      -------------------LTARDIQSVLKSAQRKHAL----------FGEAAVRERHLE
A0A2V9JMZ4      -------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHFENLLL
A0A2V9MDJ6      -------------------QAFQLLRHALEKQFSVQSF--QVSATGFSVPAQIHFENLLL
A0A2V8QJT6      -------------------KEIEVTDSELAKLRQKRAQ--LLIEATEEAPEVKEIDQQID
A0A2V8FSM8      SSSPPAALPEILDD-----PSQRTSQTTLYDLRAKLAL--LRVTYTTSYAEVRKVMAQIA
A0A359M0J2      KGKPVETLPGEIA------GGLSTQQGALDSLKRQRAD--LLTTLMPGHYKVQRIQAQID
A0A2V8JLJ1      -------------------ATATAEAAKAASIQVQAAK--EPKPEEKPRPFLPEFNLSLD
A0A2V9GAQ1      KSGNLDAIPQVQSN-----LALTELLKKRGEVSSDYTD--ALNQYGPNFPKVQRLQAQLK
G8NS05          MDPNSLDQTVANTTNNVAATQLATLRSQRETDMANYAKLTAPGNLGPNHPQVKAAHAQIE
A0A2V8KZ20      PPPPPAAHTESTTAAAIETPPPSPLETELANRQAQLAA--ASVRYTPRHPEVVRLTQEVR
A0A3D0NWU2      -------------------DDIRNIDKQIQQAETEKSE--LLVRYTPEYPEVKKMEERIA
A0A2V8EPD9      -------------------LAASAAATALATPESEPAQDAAAPSVAPVGPVARAASPAPV
A0A3N5NSX5      KSLPPSSVGDAPAVGAS--PAVQSLRTRLAELQRQKVQ--LNERYGPKNPQVIENDNAIA
A0A2V8MUA1      -------------------PDIRALKRDIKQLEEQVATDRAAETSAEKNAEETTEKRELG
A0A2V8MBH9      -------------------KDINESESKLADLKQKRAQ--LLVDATEEAPEVKEVDQQIA
A0A3N5ZPQ7      -------------------YFHGGLVSAMSSSLPEYRL--GQYCLKEGIIDPPDLHKQIK
A0A3N5P5F2      RAIQHDKAALASAPAVVANASVQRLNQELADLQRQDAQ--LSRQYGERHPEMIKVRTAIQ
A0A2V9G1P7      QTGESGALPGVFEN-----KLIQDLSERLAELKREHAQ--LSTTFNPDYPRVKEIQSQID
A0A2V9BCK9      RTGPLSLQET---------HGYIAERLRIAGANGEPIF--APGAVESVYNYARGIPRVIN
A0A2V9TMX2      VNGDPEMFMKTSPDGRGGSGLLDKLREKEADLETQYAM--ATTQFGSGYPRVTELNNQLK
A0A2V8N2J7      VLEQPMVHEKTPDE-----AKLDELRIQLAELQTRYTA--QHPVVVAKKREISDLERTIA
A0A3N6BI26      RDATPESFPQSLRT-----PSISLLEERLFGLQQNLAS--LSAQFGSEWPAVIQVRQQIQ
A0A2V9JMM3      IQRELPVEEPTAEQ-----KALDEKRLKLKELEAKYTE--QYPEIPRLRKEIADLEQAVA
A0A2V9M815      IQRELPVEEPTAEQ-----KALDEKRLKLKELEAKYTE--QYPEIPRLRKEIADLEQAVA
A0A2V9A795      QSGDYGSLPGVVEN-----KLIQDLSERLAELKRELAQ--LSTKFNAGYPRVKEIQSQID
A0A355ESH9      MTGPLDAVADSLAP-----GVISGLRTQQLQMEQDYET--KLKTFKPEWPEMVSLKSQIE
A0A3D0NW85      ERENFLLNYRNETQ-----KTIAGLTANRAKLLEEFLP--TAPEVKEIDSQIKSLEDSLA
A0A353CAT5      ERENFILNNRTETD-----KAIAGLAATRAKLLEEYKE--SAPEIKEIDSQIASLERSLK
A0A2V9HB55      KSGNLDAVPQIQSN-----LALTELLKKRSEVSSDYTD--ALNQYGPNFPKVQRLQAQLK
A0A2V8CU57      --AAWSEPETVTAP-----FAVAGWSEPESAAAPPVVA--AWSE-----PETVTAPFAVA
A0A2V8BDI4      ------------------------WSEPESAAALPAVA--AWSE-----PETVTAPFAVA
A0A2V8F8T3      AVAAWSEPETVTAP-----FAVAGWSEPESAAAPPVVA--AWSE-----PETVTAPFAVA
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      -------------------------------------------------MKILKALQRRK
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------MPTLDRHLVSLT
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      -------------------DIPVSPRRLLTVMMALFLSACFGIGLAFFLEYLDDTIKTAE
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      -------------------------------------------------DYLDQSIKSDE
A0A2V8YCY6      -----------------------------------------------------MCPSHRC
A0A2V8EGM3      ------------------------------------------------MARSMNHPRPDS
A0A2V8FGH1      ------------------------------------------------MGRIDEALRRST
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      --------------------------------------------MALVMSRIDEALKRVT
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------MSRIDEALRRAR
A0A2V8PJQ0      ------------------------------------------------LDDTVKSLDDVD
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------MSKIFEALQKSE
A0A321LXF5      ------------------------------------------------MSRFFNESRKAS
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------MADGARRGNRCR
A0A2V8GGF6      ------------------------------------------------MGTVRARGHHDR
A0A2V8HKU7      ------------------------------------------------MGTVRARGRHDR
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------MRSPAAALTGAS
A0A2V8I604      ------------------------------------------------MSRIQDILNKAE
A0A2V8J066      ------------------------------------------------MSRIQDILNKAE
A0A1I6MMC5      ------------------------------------------------MSKIYEALLRAE
A0A2V9D5W7      ------------------------------------------------MTRIHEALTKAG
A0A2V9D4I4      ------------------------------------------------MSRIHEAMQKAA
A0A2V9D6L7      ------------------------------------------------MSRIHEAIQKAA
A0A2V8ZJV2      ------------------------------------------------MSRIHEALKRAA
A0A2V9AWB5      ------------------------------------------------MSRIHEALKKAA
A0A2V8Z1Y8      ------------------------------------------------MSRIHEALKKAA
A0A1Q8AX10      ------------------------------------------------MSRIHEALKRAE
A0A2V9A773      ------------------------------------------------MSRIHEALKKAE
A0A2V9AND3      ------------------------------------------------MSRIHEALKRAE
A0A2V9BTJ7      ------------------------------------------------MSRIHEALKKAA
A0A2V8W2M7      ------------------------------------------------MSRIHEALKKAV
A0A2V8XNW2      ------------------------------------------------MSRIHEALKKAV
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------MSRIHDALKRAE
A0A1Q7V300      ------------------------------------------------MSRIHEALKKAE
A0A2V9ZCI3      ------------------------------------------------MSRIHEALKKAE
A0A2V9WCB3      ------------------------------------------------MSRIHEALKKAE
A0A2V9VQW5      ------------------------------------------------MSRIHEALKRAE
A0A2V9WTP3      ------------------------------------------------MSRIHEALKKAE
A0A2V9NLA9      ------------------------------------------------MSRIHEALKKAE
A0A2V9RKJ9      ------------------------------------------------MSRIHEALKKAE
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------MSRIHEALKKAE
A0A2V9U6D9      ------------------------------------------------MSRIHEALKKAE
A0A2G6HQA4      ------------------------------------------------MDKFSKIMEKAG
A0A2V7ZTY7      ------------------------------------------------MSRLEAALWRAE
A0A2V7ZVL9      ------------------------------------------------MSRLEAALWRAE
A0A1Q7QYI4      ------------------------------------------------MSRLEAALRRAQ
A0A2V8G9Y9      ------------------------------------------------MTRLAEALRRAE
A0A143PXU3      ------------------------------------------------MSRIDDALRRAR
A0A2V8D8G9      ------------------------------------------------MSRIDQALRIRE
A0A2V8ESQ4      ------------------------------------------------MSRIDQALRMRE
A0A1E3Y5Q0      ------------------------------------------------MRRAAEARQPIS
A0A2W4TWK5      ------------------------------------------------MGRIDEAMRRAG
A0A3N5NYV3      ------------------------------------------------MSRLAEALKRAS
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      EYREMENAMSL-DDKNNIVVSRLNALNEASIRARTVRIEKESVNNQLKAIRDTRSVDAIP
A0A2V8BV42      EYRDKQNAMSL-DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIP
A0A2V8F916      EYRDKQNAMSL-DDKQNIVTTRLTALNDALIHARTAKVQKEALYNQVKSMSGTTAPDAIP
A0A1Q7K833      DYRERQNALSL-DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIP
A0A1Q8AMY4      DYRERQNALSL-DERQNIVLVRLNKLNDDVMLARSRKAQKQAVYDQLRSLTASQHLDTIP
A0A2V8BM40      DYRERQNAMSL-DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEPVDTIQ
A0A2V8CRT6      DYRERQNAMSL-DEKQNLVVVRLNKLNDDLMLARSRRAQKQAVYDQLRSIGAGEPVDTIQ
A0A1F2VH76      DYRERQDAGGLAEGSGNIVVARLTQLNDEVTRARTNRLTKENVWNQVRSA--GQDTETIT
A0A1F2R0X5      EYREKENALSL-DDKQNIVLARLNQLNDLVTKAKTQRIQREALYNQVKSIAGGAAPDSIP
A0A2V8B278      EYRERQNALSL-DDKQNIVLARLNKLNDDVMMARSRRIQKETLFNQIKSVS-TQAPDTIP
A0A2V8CEF9      EYRERQNALSL-DDKQNLVLARLNKLNDDVMMARSRRIQKETLFNQIKSAS-TQAPDTIP
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      -------------------------------MRDSNVLVVDRAKPPLLPYRPSFPMNSAI
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      HGR---------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ---------------------------------------MDSAEPPAKPVKPRTLLNLSV
A0A2V8ZIV5      KQLYEGLLQTL------------KQTGVSASLKATNIRIVDSAVPPVKPATPKIPLNLTV
A0A2V9EVA0      SQQTPVVPGAE------------T------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      QQKTENGSPLD------------LERPTVIPGDGKGVAVLPPAELPSGAAELRVL-----
A0A3N5YN96      REGQVRRTTSE------------V-----------PPAADTAAAGRVSSPVSPQPPVASR
A0A1Q7Y646      ATQGGVTKRSN------------E----QKRRNGNSNAARQNGNGN--------------
A0A2V8QZU0      EQNGSKAKKEE------------KLAHDSRDERPPAPAAETNGHGRPHAAPGASAPVVGV
A0A2V8RSQ9      AHGDAKSKRPD------------D-AGPSRVDNTNGNAQHANGNGAAHTRAPVADPLFD-
A0A2V9LS17      QEMEGRS-----------------------------------------------------
A0A2V9AGR3      QERASSA-----------------------------------------------------
A0A2V9G0N7      EEKASQS-----------------------------------------------------
A0A2V9GQ44      EEKASQS-----------------------------------------------------
A0A2V9HRN3      EERASKS-----------------------------------------------------
A0A2V8WG13      QERSSQV-----------------------------------------------------
A0A2V8X987      QERSTQI-----------------------------------------------------
A0A1Q7KX94      EERSAQL-----------------------------------------------------
A0A2V8XHT0      EERSAQL-----------------------------------------------------
A0A2V9L2P7      ESLLQHLKDAN------------V----------SAGLRATNIHFIDSAAVPTVPVRPQK
A0A2V7UMX0      LLSQVK------------------------------------------------------
A0A136K497      IENPTTSKPRV------------V----------AFDANGKRNAPPDILGTELTI-----
A0A399W9E4      SENPTSTKPKV------------V----------AFDAPGRRNLPPDLLGTGLAI-----
A0A2V7X0V9      EERAASQGGAQ------------L----------EPTP----------------------
A0A2V9X518      ---------------------------------------MDVP-----------------
A0A2V9VC62      QERAASQGGR-------------V----------DSAPVMDLPASPEPLP----------
A0A2V9S1P8      EQRVASQGGRP------------V----------EPVQPADAA-----------------
A0A2V9RTW2      EQRAASQGGQ-------------V----------PSSQTPEAV-----------------
A0A2V9TGF1      EQRAASQGGQ-------------V----------PSSQTPEAV-----------------
A0A2V9XEV6      QERAASQGGH-------------V----------ESLHPMDVP-----------------
A0A2V9Y3Q6      QERATSQGGH-------------L----------EPLHTTEGP-----------------
A0A2V9R269      QERAMLHPSQR------------V----------EM-PAV--------------------
A0A2V9PTS3      QERAMSQSPGA------------I----------ETSPAV--------------------
A0A2V9NPF4      QERAMSQSPGA------------I----------ETAPAV--------------------
A0A2V9PNZ0      QERAMSQSPGA------------I----------ETAPAV--------------------
A0A321LMC5      RITE----------------------------------------------------QFQQ
A0A2V8X713      EEK---------------------------------------------------------
A0A2V8ZLE9      EQK---------------------------------------------------------
A0A2V8Y4D3      EQR---------------------------------------------------------
A0A2V8Z2X8      EAG---------------------------------------------------------
A0A2V9C3F6      EQK---------------------------------------------------------
A0A2V9QMU9      VPRN---------------------------------------------------LSFAL
A0A2V9QY75      VTAGLRSNNIR------------E----------VDIARTPGAPAEPNI---ARNLVFAF
A0A2V9SVU9      VTAGLRSNNIR------------P----------VDEARVPMYPAEPNV---PRNLSFAL
A0A2V8W5N5      EERHSSQAADT------------V----------T-------------------------
A0A2V8XG53      EERHSSQAADT------------V----------T-------------------------
A0A2V9XV04      QERASTQGERV------------P----------SSYATTPVADVPGY------------
A0A2V9CBY1      EQRTIRGPLEA------------E----------VTAQESSVGGPVHNGKTASRIREILS
A0A2V9D656      DQQTIRGP----------------------------------------------------
A0A352EZH8      TDGSAIVFEPQ------------P----------SSSDYRGEIRTHRLVPSAQQIEEELF
A0A0B6X033      ELDSRKREHRA------------R----------PSDAQARAEEIESLLQRSEIFSSQAR
A0A2V8R0I3      SAQR-HNHKPS------------D----------FSGRHNGDADNVSLF-TPKNEQEHPW
A0A2V8N1U8      AQRQ-FK--PS------------T----------PSVRRHGNSDNVAYF-VPKNGHEHPW
A0A2V8QL35      SPER-RIT-AS------------K----------SAIRQNGNSGNVLYPGWPGNGHDHPW
A0A352FU10      SAER-QVT-SS------------K----------SSVRQNGNSGNVLYPGWPGNGHDHPW
A0A2V8LCU0      SNQR-DFTSTN------------K----------SSVSRNGNPDNVSYF-VQKNGHEHPW
A0A1Q7NGT0      SAPR-----TP------------K----------PSVNRPGNPDNIAYF-VPK--HVHPW
A0A2V8MLP9      SAQR-----TP------------K----------PSVNRNGNPDNVAYF-VPK--HVHPW
A0A2V8PQZ0      SAQR-----TP------------K----------PSVNRNGNPDNVAYF-VPK--HVHPW
A0A3B9MKY6      AADQGGEQKRH------------Q----------PDLERHGESPSVPGLPSARQIEEQLP
A0A3D5SKZ1      AADQGGEQKRH------------Q----------PDLERHGESPSVPGLPSARQIEEQLP
A0A2V8NRW2      TAKDENGAGRK------------K----------EDQKRRNGTAAGRKLSAVLPVVNGDE
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ------------------------------------------------------------
A0A2V8CN98      ELEHQTI-----------------------------------------------------
A0A1Q7LC46      DIEDSIEKE---------------------------------KRKV--------------
A0A1Q8BDC5      EVLEHVFKN------------------------------NFAVDSF--------------
A0A2V9Q1Y8      KSRARPRKS---------------------------------------------------
A0A2V8JXG1      ASRGLLEDK---------------------------------------------------
A0A350D2W9      TARDLLKNE---------------------------------TGGL--------------
A0A2V9I4J1      EVARGDSKP---------------------------------------------------
A0A2V8PQZ9      TLRAWGEET---------------------------------------------------
A0A2V8D8B1      TAEAKIQGE---------------------------------IAKV--------------
A0A3B9LSB4      ELERQVKDV-----------------------------RSRKSVTL--------------
A0A2V9H7U2      EIQSLIDTE---------------------------------RKRM--------------
A0A2V8NJB5      PVE---------------------------------------LAEV--------------
A0A2V9JMZ4      EVARGDSKP---------------------------------------------------
A0A2V9MDJ6      EVARGDSKP---------------------------------------------------
A0A2V8QJT6      VLQKHLADT-----------------------------RARGAATL--------------
A0A2V8FSM8      AIESSLEGT---------------------------------RENV--------------
A0A359M0J2      ELEQSLERE---------------------------------RVNI--------------
A0A2V8JLJ1      TVPAEVQLQ---------------------------------------------------
A0A2V9GAQ1      DYDLSIEKE---------------------------------KKYI--------------
G8NS05          ELDKAIKQE---------------------------------QDRV--------------
A0A2V8KZ20      ELEGLVRQFKA------------AAEAAKAAAAATATAEAAKAASIQVQAAKEPKPEEKP
A0A3D0NWU2      SLKESRTRT--------------EQEVSSIIDRDQKRIEREAVGGA--------------
A0A2V8EPD9      VVAPAAPVV---------------------------------LAPV--------------
A0A3N5NSX5      DTTQQLQTA---------------------------------LTAA--------------
A0A2V8MUA1      ETPGPAPADEV------------AASTLLPQLDFSIDFSDFEIQLR--------------
A0A2V8MBH9      ELQKHLHES-----------------------------RARNTNTL--------------
A0A3N5ZPQ7      GRDHRPLGEAI------------VAAGLAEPVEIQQLLQKQAIDVF--------------
A0A3N5P5F2      QIRQKLDAE---------------------------------LHNA--------------
A0A2V9G1P7      EIAASLREE---------------------------------RQRA--------------
A0A2V9BCK9      VLCEHALIN--------------------------------SFADQ--------------
A0A2V9TMX2      QVRAAIEAE---------------------------------KTKL--------------
A0A2V8N2J7      SQPKKGRSE-----------------------PSPTYLRYSQLKSE--------------
A0A3N6BI26      EVEKQLLRE---------------------------------KKET--------------
A0A2V9JMM3      AGPRRKSRSDA------------TAATSRRYPGPDASMRYLALKGE--------------
A0A2V9M815      AGPRRKSRSDA------------TAATSRRYPGPDASMRYLALKGE--------------
A0A2V9A795      ETEAALKEE---------------------------------RQRA--------------
A0A355ESH9      TGKQHIDSVIR------------E-------------M----VQKA--------------
A0A3D0NW85      NATEKAQAEIQ------------A-------------YRGRTADNL--------------
A0A353CAT5      TATDRANAEIA------------T-------------FRERTAKTL--------------
A0A2V9HB55      DYDQSIEKE---------------------------------KKNI--------------
A0A2V8CU57      GWSEPESAA---------------------------------APPV--------------
A0A2V8BDI4      GWSEPESAA---------------------------------APPV--------------
A0A2V8F8T3      GWSEPESAA---------------------------------APPV--------------
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      QENERIVPF---------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      E-----------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      DVENYLGLP---------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ELTE--------------------------------------------------------
A0A2V8YCY6      RKPSGPCAP---------------------------------------------------
A0A2V8EGM3      TSSGRRCSP---------------------------------------------------
A0A2V8FGH1      AKKDTQVKA---------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      RAPSPSPRR---------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      GEQPEHRAT---------------------------------------------------
A0A2V8PJQ0      RYIHLPTLA---------------------------------------------------
A0A3N5YKY1      --MQVFATP---------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      GEVAQEALP---------------------------------------------------
A0A321LXF5      RHVTVGPRN---------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      R-CRVDRRG---------------------------------------------------
A0A2V8GGF6      HWSDVHRRR---------------------------------------------------
A0A2V8HKU7      HWSDVHRRR---------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      APAAPGLSV---------------------------------------------------
A0A2V8I604      RDGAVRRTR---------------------------------------------------
A0A2V8J066      REGSARRTR---------------------------------------------------
A0A1I6MMC5      IERLTTKD----------------------------------------------------
A0A2V9D5W7      QEYPAAQAI---------------------------------------------------
A0A2V9D4I4      QERAAAPAT---------------------------------------------------
A0A2V9D6L7      QERSAAPAT---------------------------------------------------
A0A2V8ZJV2      EERAAQLAA---------------------------------------------------
A0A2V9AWB5      EERAARLTF---------------------------------------------------
A0A2V8Z1Y8      LERSAQL-V---------------------------------------------------
A0A1Q8AX10      QERAPIQSA---------------------------------------------------
A0A2V9A773      EQRPPAWKP---------------------------------------------------
A0A2V9AND3      EQRPPSWKP---------------------------------------------------
A0A2V9BTJ7      QERSAQLAA---------------------------------------------------
A0A2V8W2M7      EERVSHLSV---------------------------------------------------
A0A2V8XNW2      EERVSHLSV---------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      QERATSMGG---------------------------------------------------
A0A1Q7V300      QERATS------------------------------------------------------
A0A2V9ZCI3      QERAASQGS---------------------------------------------------
A0A2V9WCB3      QERAATQAM---------------------------------------------------
A0A2V9VQW5      QERAASQGT---------------------------------------------------
A0A2V9WTP3      QERAASQGG---------------------------------------------------
A0A2V9NLA9      EQRSAEHEM---------------------------------------------------
A0A2V9RKJ9      EQRSAEHEM---------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      EQRAASQGG---------------------------------------------------
A0A2V9U6D9      EQRAASQGG---------------------------------------------------
A0A2G6HQA4      VDTSYNLHS---------------------------------------------------
A0A2V7ZTY7      TLNDEPAAP---------------------------------------------------
A0A2V7ZVL9      TLNDEPAAP---------------------------------------------------
A0A1Q7QYI4      ALNDQSDAP---------------------------------------------------
A0A2V8G9Y9      D-HSGAEAP---------------------------------------------------
A0A143PXU3      GEQPEQAAT---------------------------------------------------
A0A2V8D8G9      VASGAAAPE---------------------------------------------------
A0A2V8ESQ4      VASGAAAPE---------------------------------------------------
A0A1E3Y5Q0      PDAGDAAGG---------------------------------------------------
A0A2W4TWK5      GASATVEEA---------------------------------------------------
A0A3N5NYV3      AEQESDGAE---------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      VITQNLQIQALRNQLGDLQRQKANLTERYGDKHPEMVKVNAQLADGQRQLDVGTAKALES
A0A2V8BV42      VIAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQS
A0A2V8F916      VIAQNTQVQALKTKLNELQRDKSRLEERYGPKHLAVQANATAILDTQRQVDVETSRALQS
A0A1Q7K833      VIAQNPDVGAAKAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQYDLAVNRAASA
A0A1Q8AMY4      VIAQNPDVGAAKAKVTAAQTDRARTAERYGEKHPNMQKVNADVAEAQRQYDLAVNRAASA
A0A2V8BM40      VIATSPEVSAAKGKVFAIQSEKARIAERYGDKHPTMQKAMADLTEAQRQYDTAVTRAAQA
A0A2V8CRT6      VIATSPEVAAAKGKVFAIQSEKARIAERYGDKHPTMQKAIADLTEAQRQYDTAVTRAAQA
A0A1F2VH76      TILQNPMVLSLRNRVSEVERDRGRISERYGPRHPEYEKVTTQLADVKLQLEAEIKKAIQT
A0A1F2R0X5      IIAQNPNVQALKNKLSSLQQDKVRLLERYGDKHPQVIAVNASLQDTQRQLDQETARAVQS
A0A2V8B278      AIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARAS
A0A2V8CEF9      AIAQNASVAAAKSRVVEMQRARAQVADRYGERHPNMQKANADLSEAQRQYDFEVARARAS
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      GLFSGLFLGFGF---------VILRDRLDRRITAPGDAQAYLDLPELGVIPFDQGGLAGQ
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ---------------------------EPALFPGEAKPNHSVVAEAGHGNRHEWLNRRVP
A0A2V9DKV4      --------------------------------------------MRTVGSRPYFQGRRNQ
A0A2V8W380      ALFLGLALGICA---------ALFQERMDDTLKGDDDVERLLGLPSLALIPVVAPANGNH
A0A2V8ZIV5      ASLLGLGLGISA---------AFLQERLDDTLKGADDVERLFGLPALALIPSVHHLNGDR
A0A2V9EVA0      ---------------------------IPPEPVAFWTEQREEELRPTSSFAPSEPSPRPS
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      RAVPPE---------------PPMQVFATPSAATHPNVPPTVGVGGASAVPPAAAFPGAA
A0A1Q7Y646      ---------HAF---------EDSPLFAPLGAAHNSASTAHT-EEGVGSALSDVIASRAA
A0A2V8QZU0      NRDADDAAEFLF---------RRSKHFQSPESATVSASNEHTVTPG-GSALPAA-ASRAA
A0A2V8RSQ9      ---------------------RPSAFFHAPDAAHSSASTEHTAQAGVGSALPGGVAARVA
A0A2V9LS17      ---------------------------IPSVGTQIAELAEAGTAVPEKLPQSATGIEPAA
A0A2V9AGR3      ---------------------------AVGRKDELPAINTDALSSSPVAPRNGKLF--AP
A0A2V9G0N7      ---------------------------PASPAQTFVDVREGISRFAQARNEVGT----AP
A0A2V9GQ44      ---------------------------PASPAQTFVDVREGISRFAQARNEVGT----AP
A0A2V9HRN3      ---------------------------PASAAQTFVDVTEGISRFAQARNEVGT----AP
A0A2V8WG13      ---------------------------ATGTVPDLADVATGLESPFGNKMQAGEPAVRSA
A0A2V8X987      ---------------------------GAGLDRDVADVAAEIHRPVTVEPVVAVLAE-QP
A0A1Q7KX94      ---------------------------AAGLETGVVEVTGELRRPITQGPGIAQPTA-AP
A0A2V8XHT0      ---------------------------AAGLETGVVEVTGELRRPITQGPGIAQPTA-AP
A0A2V9L2P7      GRNIAFAMAVGL---------ALGMGLAFVREALANSIKGAQEVENLIAAPALA------
A0A2V7UMX0      ---------------------------GFRLPEAKPGAQPGKSARTKAGLPDQEVHGPQA
A0A136K497      ---------------------------GSPRSAFDGQPNSSLGTALPDVETGLTAGAKPN
A0A399W9E4      ---------------------------GSPRSAFDGQPNSSLGTALPDVETGLTAGAKPN
A0A2V7X0V9      ----------------------------VGAESPVMPDMASHRVPDPVAVAA--------
A0A2V9X518      ----------------------------AVEAAGMPPVIERAPLSTAASAAA--------
A0A2V9VC62      ---------------------------GMAEAADATRTAPTAPIPGAPGNGQ--------
A0A2V9S1P8      ----------------------------VAEPLAATP---PAPQGTTASVGA--------
A0A2V9RTW2      ----------------------------LSDTPTEAQVVASPSTGVAP------------
A0A2V9TGF1      ----------------------------LSDTPTEAQVVASPSTGVAP------------
A0A2V9XEV6      ----------------------------AVEAAGMPPVIERAPLSTAASAAA--------
A0A2V9Y3Q6      ----------------------------VMDPIQASTVVEHPPVAPSTGI----------
A0A2V9R269      ----------------------------LETPEMPAGAVAGAVGR---------------
A0A2V9PTS3      ----------------------------LEAPPETTPFLRSEPTE---------------
A0A2V9NPF4      ----------------------------LEAPLETTPFLRSEPTE---------------
A0A2V9PNZ0      ----------------------------LEAPLETTPFLRSEPTE---------------
A0A321LMC5      PEGAVFGDAIGP---------DFFDERDDSFIKESGSTRNSQPASSRREARASAAASNLR
A0A2V8X713      ---------------------------SPTRSAPGAGPLDFAG--DVAEPSPLGTLYPQM
A0A2V8ZLE9      ---------------------------PPAWKPSEPTPLGFGGNVNTAVAREALHSPTPT
A0A2V8Y4D3      ---------------------------PSAWKPAEPTPFGVAGGEGGSASAVSRALYSPK
A0A2V8Z2X8      ---------------------------PSAWRPSEPTPLGIVG--AGGVAGAHRILSSPI
A0A2V9C3F6      ---------------------------PPAWRPTDPTPLNYVG--ESEVAAASGVLHSPR
A0A2V9QMU9      VLGLTTGVSLAF---------LLEGIDNTVRTPEQAQAISGLPSLGIIP-------DGSK
A0A2V9QY75      ALGLSSGIGLAF---------LLEGLDNTVRTPEQAQAISGLPSLGMIP-------LGSK
A0A2V9SVU9      ALGLTTGVGLAF---------LLEGIDNTVRTPEQAQALSALPSLGLIP-------LGLK
A0A2V8W5N5      ---------------------------LSVETPRTQVIAGIGLRAPAAETRA----RTET
A0A2V8XG53      ---------------------------LSVETPRTQVIAGIGLRAPAAETRA----RTET
A0A2V9XV04      ---------------------------DDIEVNRVPPSLGMPELGG--------------
A0A2V9CBY1      ALTAEGAPPQEQ---------RTIRGPLEAEATPQESSVGGPVHNGKTASRIPEILSAVT
A0A2V9D656      ---------------------------LEAEATPQESGVGEPVHNGKAASRIPEILSAVR
A0A352EZH8      SASSILNRTEDT---------VT----SSAFTAHTAYATGGTALPAGQSSGA----VGAT
A0A0B6X033      EPQLFSAS---------------------AEHADVATAIGSALPENGWASRV----AGAT
A0A2V8R0I3      SASPFTAM--PA---------AI----DSAPTAHTAEETGGPALPGGPASRD----AGAT
A0A2V8N1U8      ETAPTIGA--PA---------AI----DSASTAHTAEATGGPALPGGPASRD----AGAT
A0A2V8QL35      ERNAFTGM--PS---------AY----DSASTAHTAEAASGPALPAGTASRD----AGAT
A0A352FU10      ERNAFTGM--AS---------AY----DSASTAHTSEAASGPALPAGTASRD----AGAT
A0A2V8LCU0      EKAPFTGM--PS---------AF----SSASTAHTAEATGGPALPGGPAFRD----AGAT
A0A1Q7NGT0      ERQSFTGM--PQ---------GY----DSASTAHTEEATGGPALPGGPASRD----AGAT
A0A2V8MLP9      ERRPFTGM--PA---------GI----DSASTAHTEEATGGPALPGGPASRD----AGAT
A0A2V8PQZ0      ERRPFTGM--PA---------GI----DSASTAHTEEATGGPALPGGPASRD----AGAT
A0A3B9MKY6      SRSSFLSVSHET---------AQ----NSASSAHTADIPGGLALPGGKASRD----AGAT
A0A3D5SKZ1      SRSSFLSVSHET---------AQ----NSASSAHTADIPGGLALPGGKASRD----AGAT
A0A2V8NRW2      HPWDSSPLFSRA---------AH----ESASTAHTEERAGS-ALSGVTASRA----AGAT
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ------------------------------------------------------------
A0A2V8GAF9      ---------------------MFALDCAGCRGGAGDGSARYVIPRHRGPAGLPPRPD---
A0A2V8CN98      ---------------------PGLIRGLLAELGTQRRGLASQLETGGRELQGIPQRA-IE
A0A1Q7LC46      ---------------------LEVLESDYREARQRETLLSEALDQAKVEANQMSEKL-VE
A0A1Q8BDC5      ---------------------RNSLKSYYAPARIAYPQVLLEVCRSKNEPFECKEGT---
A0A2V9Q1Y8      ------------------------------AAVCVVIIWQPXXXEQKQQENKLNESA-IE
A0A2V8JXG1      ------------------------LKADYERVVRDENALKAALAEAKAGAAQENQRA-IQ
A0A350D2W9      ---------------------VKAAYSEYQAALKKENSLKDLFERQKDEAFRLNSNA-IL
A0A2V9I4J1      ---------------------FQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELRRS-RT
A0A2V8PQZ9      ---------------------MGRIYDALKRAESAPRTPKPSVNRNGNPDN-------IA
A0A2V8D8B1      ---------------------VESMKHDYQTALTQEQSLMHALDQQKADALALNRKG-IG
A0A3B9LSB4      ---------------------LTNLETDYRQTLAREQALRKAFEQQRGETLSQNEAA-IN
A0A2V9H7U2      ---------------------VERLRNDYVAARGREKLLAAAVAKEKVGVGALSQLL-IQ
A0A2V8NJB5      ---------------------VRRQSLELLQHVLTNDFSIDDFTNSVRSFYTPANIT-FA
A0A2V9JMZ4      ---------------------FQVYPWQLVVMNNGKDLTHLPWYPQELSVLSELRRS-RT
A0A2V9MDJ6      ---------------------FQVYPWQLVVMKNGKDLTHLPWYPQELSVLSELRRS-RT
A0A2V8QJT6      ---------------------LKNLETKYRQAADREEALRKSFNQQKGETVTQNEAA-IN
A0A2V8FSM8      ---------------------ATRIRKEYEGALRREKLLETAYAEKVHQLASKAEET-AH
A0A359M0J2      ---------------------VERLKNDYEAALKREQMLTSAYSRQASAVTGQANVA-AE
A0A2V8JLJ1      ---------------------IDQLDRDVSKLKQGREPLQARIAAYQNRLNPPAPVA-EE
A0A2V9GAQ1      ---------------------LDVLESDYREAQQRESLLMQALDQQKTETNQMAEKL-VE
G8NS05          ---------------------IAQAKQTFIAAQANEQQTRAALEDQKSEAYKLRDDL-VQ
A0A2V8KZ20      RPFLSEFNLSLDTVPAEVQLQIDQLDRDVSKLKQGREPLQARIAAYQNRLNPPAPVA-EE
A0A3D0NWU2      ---------------------LTALRAQLDAKRKEEAQAQAAYDREAALANIQGQAQ-TR
A0A2V8EPD9      ---------------------VVPIAPVAPVAAAPAPAAPVALAAAAPVPAAAAAPV---
A0A3N5NSX5      ---------------------VAAIRSEYQTARATELRLADALKQSQGAAMELNRKN-VG
A0A2V8MUA1      ---------------------LEKLARDLKQRQEAEEEIVRKINQYRSRVNAPPEVL-DE
A0A2V8MBH9      ---------------------LTNLETKYRQSLAREESLRKSFNQQKGETVTQNEAA-IN
A0A3N5ZPQ7      ---------------------RRALENGFRIESFEPMSVHLGIPLKAR----------LD
A0A3N5P5F2      ---------------------VQAVEGEYVGAQAREESLTRELEAQKADVLAINRKS-IG
A0A2V9G1P7      ---------------------ADRMVNDYSAAVRRENLVQQALDDQQKQVNLIAEKS-VQ
A0A2V9BCK9      ---------------------QRPVPTHLVDEVAREFELGSLEPTTQPTSTACPENTLAA
A0A2V9TMX2      ---------------------QQKMRDDYLAALQRENLLDSAFNKQKQEANKLNESATIE
A0A2V8N2J7      ---------------------LEGIQQRIAAYQRDQENLSAQMDTYSRRLESTPQHE-KV
A0A3N6BI26      ---------------------INRVQSEYRVAVNRRQMLLGALNRQKAEANQLNQDS-IQ
A0A2V9JMM3      ---------------------LEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHE-RA
A0A2V9M815      ---------------------LEGIDQRLRSYAPEEKALQAEIASLRQRVASAPKHE-RA
A0A2V9A795      ---------------------ADKITNEYFAALRREGLVKEALEGQQKQVNVIAEKA-VQ
A0A355ESH9      ---------------------RSNASSNYQAVLRQEQSLAAELETIKRQAIDQNSSA-VQ
A0A3D0NW85      ---------------------LKVLETQYRRAQEKENKIRSAFNVQFQEAQGQNAGA-VM
A0A353CAT5      ---------------------IDVLETKYRRAKEKEDKIRAAFDVQVNEAQGQNAGA-VM
A0A2V9HB55      ---------------------LAVLESDYREAQQRESLLTQALDEQKAETNHMAEKL-VE
A0A2V8CU57      ---------------------VAAW----------------------SEPETVTAPL-AV
A0A2V8BDI4      ---------------------VAAW----------------------SEPETVTAPL-AV
A0A2V8F8T3      ---------------------VAAW----------------------SEPETVTAPL-AV
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ---------------------ERKYQPESYAPTTFPLGDIKIGAPTSSEPEIASNDS-PI
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ---------------------VLVVIPSMNAAQK--------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ---------------------L--------------------------------------
A0A2V8EGM3      ---------------------A--------------------------------------
A0A2V8FGH1      ---------------------VEVPPDDMFVSPWNFAGPPEPVAQGPVRDGALDEPS-ST
A0A2V8D468      ------------------------------------IPFSPNKTLTLELTFVVGLMF-AV
A0A1F2R977      ---------------------AESAESRATSFGDSSLDHYPAEHHSVPWTGEGREGN-VE
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ---------------------DFEADAPWEFAEGTSARARSGRPDARPETPNALIPE-ES
A0A2V8PJQ0      ---------------------LIP------------------------------------
A0A3N5YKY1      ---------------------SAATHPNVPPTVGVGGASAVPPAAAFPGAAGPTAAP-AS
A0A2V8H566      ------------------------------------MSPEDRSTALEAVVRDGRIAA-VT
A0A2V8UVN4      ---------------------VLTDGGSQLGGVKVVDKILRETTGERRPADASDGAA-ED
A0A321LXF5      ---------------------VDLQEHISRLREGLETHSRPSSSQVRQVLAPLEDAN-NI
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ---------------------QSSPGAWKRTDRSADGARTSMMRAQGRMLTDVESLI-EA
A0A2V8GGF6      ---------------------VALHRERQRAHRPADGAWTGVMASEGRALTDPGEIP-AA
A0A2V8HKU7      ---------------------VALHRERQRAHRPADGAWTGVMTSEGRALTDPGEIP-AA
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ---------------------AHRVEL---------------------------------
A0A2V8I604      ---------------------PLGSETSAAA-----ALAAPAPMARPIVEPPAPPPP-IE
A0A2V8J066      ---------------------SIGTDAPVGTPPSPVAAPPPTPVHRPIVE---PTPI-AE
A0A1I6MMC5      ------------------------------------EVSQATTVPLPVRERDYAELS-AG
A0A2V9D5W7      ---------------------D-SLFQL--------DSTRPIESESKDAPPS---GI-GS
A0A2V9D4I4      ---------------------EIAPFPF--------DAEPAPERELKTVASASANGA-VT
A0A2V9D6L7      ---------------------DFAPLPF--------DVELAPER--KSVAPASVIGC-V-
A0A2V8ZJV2      ---------------------GSEASSA--------D--VRSELEL-LRRGPECTGP-AV
A0A2V9AWB5      ---------------------DVDPREG--------DGEVRSEPESPLTQGIDLLPP-VP
A0A2V8Z1Y8      ---------------------TELESAE--------V--LGEIRRS-VPGPLETEVP-RP
A0A1Q8AX10      ---------------------NEAKPSD--------S--LLAEGAH-RDGGEWSALG-MV
A0A2V9A773      ---------------------ADPTPL-----------------GF-GDDGIAVAAG-AM
A0A2V9AND3      ---------------------AEPTPL-----------------RF-G--GERLAPG-VL
A0A2V9BTJ7      ---------------------GTAPSFL--------E--VA-DVPR-TAVPLRELDE-PT
A0A2V8W2M7      ---------------------GESLNLA--------A--IAGSMQA-PAVPARQVAE-QP
A0A2V8XNW2      ---------------------GESLNLA--------A--IAGSMQA-PAVPARQVAE-QP
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ---------------------QLEPALEQPELQ---PVGMPEHAHMQTAVMP--------
A0A1Q7V300      ---------------------------E-SIPQ---MVADQVVLEAIASSEN------VV
A0A2V9ZCI3      ---------------------QIDSSHV-GEM----PVMDPASVATGVAAAP--------
A0A2V9WCB3      ---------------------AVPPPMA-AMP----MSEQPVFADTPPVPAMP-------
A0A2V9VQW5      ---------------------RTDG--T-PVMD---LPATESVPAMPETAQASKAAA-PG
A0A2V9WTP3      ---------------------PVPSNFS-GAES---PVTEPRVIDADTAARVAAVAP-AV
A0A2V9NLA9      ---------------------HIEPPLA-SAPE---VVPDP--ISMPVAAVPPLADE-RD
A0A2V9RKJ9      ---------------------HIEPPLA-SAPE---VVPDP--VSMPVAAVPPLADE-RD
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ---------------------NIEP--A-SISE---MVNES--AATAVAPAV------EH
A0A2V9U6D9      ---------------------SIEP--A-PIAE---MVNDP--AATAVAPAV------EH
A0A2G6HQA4      ---------------------KKRKNSLPGKKRRSVTSFNPPPVHDREPEKREDSLP-GK
A0A2V7ZTY7      ---------------------PTVSGGQGSRDCA---TGGQRPPDRTSAGQRPPDSA-KA
A0A2V7ZVL9      ---------------------PTVSGGQGSRDCA---TGGKRPPDRTSAGQRPPDSA-KA
A0A1Q7QYI4      ---------------------EADPKAERMSRAL------------AALADTPPPVS-TA
A0A2V8G9Y9      ---------------------TSDSRVLSQPAG-------------EPLTRVPDTLS-VQ
A0A143PXU3      ---------------------D--------ADIDMPWQFADSPAAPPRASHPPEQRP-TS
A0A2V8D8G9      ---------------------TGTNQSRGSSSLN------------QYPNEEPDRHP-LE
A0A2V8ESQ4      ---------------------TGTNQSRGSSSLN------------QYPNEEPDRHP-LE
A0A1E3Y5Q0      ------------------------------PTVGWPAAPAPVEAFSSEGAERPRPRP-VT
A0A2W4TWK5      ---------------------AQPAVPVELPTEAFPAEPGQR----PEPSERPVRHA-RP
A0A3N5NYV3      ---------------------QQEPIKREKPPTSHPKLA--V----AEATAKLESAV-QA
A0A2V2RJF9      ----------------------------------------------------DSDSDNGS
A0A2G6HNT3      --------------MEKFSKIMEKAGVETSYKLHNKEKESFRPKKRVQPKPVASVAREKK
A0A2V7YWD4      ----------------------------------------------------MDVVRTKS
A0A192WXK4      -------------------------------------MSNAVIEPSTESEESMPEDHSEP
A0A2V2R8T6      -----------------------------------------------------------A
A0A1Q7RGF1      ---------MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGAS----G
A0A2V9BLX2      ---------MSKYFDQTFKTRDAGTDPEKLQITGIDKFLETGSSFKNSAPGMGAS----G
A0A2V9ZA03      --------------------------------------MMKDLGLTRNAAASPRMLHDLD
A0A3N5ZNH4      ---------------------------------------------------MPSLGVIPT
A0A2V8GEZ2      --------------------------------------------MHDFASSVEQPFRIAP
A0A3N5ZFD3      -------------------------------------------MAEALSASPAEPRSAAA
G8NXD3          ---------------------MITLNLREYQTIEPHLMIASASNGDAGSPHKHQNAVVDR
A0A2V9VR38      -----------------------------------------------MFGHDPARFQVSP
A0A2V9EY04      ---------MSKFFNETQKANQWAQSKLPEPDRDVREMLESIKQGSILETATANAQLPQC
A0A2V9HAK9      ---------------------------------------ESLKQGPPINAPPAEARLARS
A0A1Q7FS15      ---------MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNEC
A0A1Q7K9P1      ---------MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNEC
A0A1Q7N989      ---------MSKFFNETQKANQWTQQKLANQDMDVKEMLESLKQGPASGTQLADARLNEC
A0A2V9G7Y0      ---------MSKFFNETQKAHQWAQQKLVNQDLDVRQILASLKQGPANDAPPAGARLAHC
A0A2V8T7Z1      ------------------------------------------------MMSRPSIEAERS
A0A2V7U8G5      ----------------------MPMARSR-GPRPVSLD--FELHRLSTPPTSG-------
A0A2V7UNP9      --------------------------MRT-NSRPVSMSQYLELERRSPGDARGEPLIADS
A0A2V7VLD7      --------------------------MRT-NSRPVSMSQYLELERRSPGDARGEPLIADS
A0A2V7XGA3      ----------------------MTTPTTLGDPASLSAVRTSEPSPRAQAETAR-------
A0A2V7YAG6      ---------MAWLPPWRQAGPDMSMPTTL-DPAPMGAARAPEDSRRSNGGTGT-------
A0A2V7VK33      ------------------------MLSISPTRDPEAPPSAPTRGRGSNEPPRTAP-----
A0A3M1VTE1      -------------------------------MTAGGSGRGADRGSPTRYAIGAGV-----
A0A2V7TTM7      ------------------------MYRVGNPLLKSRSLVPASEDDDVTREAPAGR--PRP
A0A2V8VI82      ------------------------MREAETGSGAGTQPDAGQPTRTVRSAPSHGP-----
A0A2V7U4P9      ------------------------MSIKPPEEMLSSAVPAGEKGGPVSETPRRGP-----
A0A2V7TQY5      ----------------------------------MRARRGRGPPGARRRHRRIEAPGRRQ
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ---------------------------------MNATLTPRQPEGSAHAARRAGPRRPEA
A0A2V8VU54      ----------------------------------MSGYIDAKPDGSVDLMGRSRT-----
A0A1Q7RML7      ----------------------------------MSAFSGGDRDHTSDRSERACP-----
A0A1Q7ZIQ5      ----------------------------------MSAFSGGDRDHTSDRSERACP-----
A0A2V8TKD8      ----------------------------------MSAFSGGDRDHTSDRSERACP-----
                                                                            

A0A1F2U8T6      VRNEYERALIEERTLAAHLEEAKRDAQDLSRKSVGYNVLEREAKSHRTVYESLLQRTNEL
A0A2V8BV42      VKNDFETAVLEERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKEL
A0A2V8F916      VKNDFETAVLEERVLAQNLDAAKGDAQDLSRKSVGYNVMERESKSNRLVYESLLQREKEL
A0A1Q7K833      IKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIFQALMTREKEL
A0A1Q8AMY4      IKNEYETAQLEEQAYSRGLDSAKADAQDLSKKSVDYNVMEREAKTNRDIFQALMTREKEL
A0A2V8BM40      IKNDYETAVLEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLTREREL
A0A2V8CRT6      IKNDYETAVLEEQTFSRGLDSAKSAAQDLSRKSVDYNVMERDAKTNREIYSTLLTREREL
A0A1F2VH76      AKSEYEAAVVQERTLTQALNEQKAAATDLSRKGVDYTLILREAESNREIYNSLLTREKEL
A0A1F2R0X5      VRNEFETSVLEERTLSQNLEAAKVEASDLNRKGIGYGVMEREAQSNRQVYEALLQREKEL
A0A2V8B278      IKNDYESALIEEQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTREREL
A0A2V8CEF9      IKNDYESALIEEQTMARGLENAKADMQDLSKKSVDYNVMQRDSQTNRQIYDALLTREREL
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      IAG-RLHSHRPTRTLTS--------------------DTAPDSSANW-------------
A0A2V8YMQ4      ------------------------------------MAMGQAFAGCWIIQ----------
A0A1Q7L5B1      TSEERAAAVSDFLGLND--------------------LWQRCRKPGWTLD----------
A0A2V9DKV4      T----------ILGLND--------------------LWQRCRKPGWTLD----------
A0A2V8W380      LGIHRFLPRDKSLVLAGN-------------------GSGKNSRS-WH------------
A0A2V8ZIV5      SSVRKLLDSASTLRSSQN-------------------GTASTPGAYWH------------
A0A2V9EVA0      LTSFAPGLNA---------------------------LRQRCAKPAWKLH----------
A0A1Q7RB73      --------------------------------------MERCSQSLWNPA----------
A0A2V9K0H7      -------------------------------------LMERCSQSLWNPD----------
A0A3N5YN96      GPTAAPASPATAPASFPGNGGHQPLPIVVPNPVLAGGRRARSVT----------------
A0A1Q7Y646      GATLDAAGSARAIEFVS--------------------RQISTAR----------------
A0A2V8QZU0      GATLGADGSARTPEFVT--------------------LDISAAR----------------
A0A2V8RSQ9      GATVDAVGSTRDATYTS--------------------IEVVTSR----------------
A0A2V9LS17      LS--ELEEPGSDLTLEV--------------------LESQVRRFKWNPN----------
A0A2V9AGR3      TTGIRDVMAPP--SFEV--------------------LASRCVHLNWRLD----------
A0A2V9G0N7      KNGSGNAVKQPCVRFEQ--------------------LLKRCAHPKWTLD----------
A0A2V9GQ44      KNGSGNAVKQPCVRFEQ--------------------LLKRCAHPKWTLD----------
A0A2V9HRN3      KNGTSTAVKQPCVRFEQ--------------------LLKRCAHPKWTLD----------
A0A2V8WG13      RVSEGSSF----LDFDD--------------------LLRRCAHPNWHLD----------
A0A2V8X987      RATIGGGHTGS-MRYEE--------------------IVRRCSRPDWRLD----------
A0A1Q7KX94      RVPTGDNQDVP-FHYEE--------------------LIKRCAQVEWRLD----------
A0A2V8XHT0      RVPTGDNQDVP-FHYEE--------------------LIKRCAQVEWRLD----------
A0A2V9L2P7      ----IVPDVSSSVTRSG--------------------LFAKRSEVKAKKA----------
A0A2V7UMX0      LGSREPAGRERSTDPAV--------------------PQARVAEIPWKK-----------
A0A136K497      ADTLTRSARRPLPDCVS--------------------WTVDAER----------------
A0A399W9E4      ADTLTRSHRRPLPDCVS--------------------WTVDAER----------------
A0A2V7X0V9      ----MMPAFGSPFSVDT--------------------MLARCPQMEWKPD----------
A0A2V9X518      ----AGPAFSNAFTFDT--------------------LLARCAQSEWNPD----------
A0A2V9VC62      ----KVPSFATSFTFDT--------------------LLARSAQADWKPD----------
A0A2V9S1P8      ----SIPSFGSPYTLDT--------------------LLARCPQGRWSPD----------
A0A2V9RTW2      ------PSFAAPFTFDT--------------------LLARASQHDWTPD----------
A0A2V9TGF1      ------PSFAAPFTLDT--------------------LLARASQHDWTPD----------
A0A2V9XEV6      ----AGPAFSNAFTFDT--------------------LLARCAQSEWNPD----------
A0A2V9Y3Q6      ------PPFSNPFTFDT--------------------LLARCAQTNWSPD----------
A0A2V9R269      ------GIPGMATGMEA--------------------LMTRSRETRWSPD----------
A0A2V9PTS3      ------ARFASGGIAES--------------------LLARSRQTAWNPD----------
A0A2V9NPF4      ------ARFASGGIAES--------------------LLARSRQTAWNPD----------
A0A2V9PNZ0      ------ARFASGGIAES--------------------LAARSRQTAWNPD----------
A0A321LMC5      VGEFARNNQGFVEPRQS--------------------FSIHDLR----------------
A0A2V8X713      PG--GAPTPEFCLGLEE--------------------LRGRCAKPGWKMN----------
A0A2V8ZLE9      PK--GIPTVGRGLRLEE--------------------LRQRCIKPGWELN----------
A0A2V8Y4D3      WG--EIPAPGRRLRLEE--------------------LRQRSSKPGWKLN----------
A0A2V8Z2X8      RA--EMPMAGRCLGLEE--------------------LRHRCIKPGWKLN----------
A0A2V9C3F6      RG--EMPATGRCLRLEE--------------------LRQRCIKPGWRLN----------
A0A2V9QMU9      LS--IESSAR-----RR--------------------LSLTSSR----------------
A0A2V9QY75      IG--AEAGAK-----QG--------------------LVVASSK----------------
A0A2V9SVU9      AG--VEMSMK-----QR--------------------LSVASSK----------------
A0A2V8W5N5      IP--APSRSAPELRFDS--------------------LVAHCTRREWQPE----------
A0A2V8XG53      IP--APPRSAPELRFDS--------------------LVAHCTRREWQPE----------
A0A2V9XV04      -----------PSSLEM--------------------LLGRCPQPGWNPD----------
A0A2V9CBY1      AE--VAPPAR-SLQLEE--------------------LQQRCAKPGWKPQ----------
A0A2V9D656      PE--GAPPAR-LLQLEE--------------------LQQRCAKPVWKPQ----------
A0A352EZH8      LD--AARPAR-VSGLVS--------------------YDVDATR----------------
A0A0B6X033      VD--AERSAR-VASFPA--------------------LDVSAAR----------------
A0A2V8R0I3      LG--AVGSAR-AARFRS--------------------RDILAAR----------------
A0A2V8N1U8      LG--AVSSTR-AAEFQS--------------------QDISAAR----------------
A0A2V8QL35      LG--AVGSAR-AIEFSS--------------------REVSAAR----------------
A0A352FU10      LG--AVGSAR-AVEFSS--------------------REISTAR----------------
A0A2V8LCU0      LG--AVGSAR-AAEFSS--------------------REISAAR----------------
A0A1Q7NGT0      LG--AVGSAR-AAEFSS--------------------REVLAAR----------------
A0A2V8MLP9      LG--AVGSAR-AAEFSS--------------------REVLVAR----------------
A0A2V8PQZ0      LG--AVGSAR-AAEFSS--------------------REVLVAR----------------
A0A3B9MKY6      LG--AAGAAR-VDGFAT--------------------YDISPAR----------------
A0A3D5SKZ1      LG--AAGAAR-VDGFAT--------------------YDISPAR----------------
A0A2V8NRW2      LD--AAGTARALPEFMS--------------------LDISAAR----------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      ---MKREVETSRQLYEAMMQKV-------------KEYSIA---SAITANNV-RVVDPAT
A0A2V8GAF9      -DAVQHSAAYDRGAHATSVASN-------------RVDGGVGHDRLGLDCRWRSPCRHRK
A0A2V8CN98      DARLRRDVSIAENLFTSVQQRY-------------SEARLA---EASSIADV-RVLDAAV
A0A1Q7LC46      YNILKREAEANKALYEGLMTKM-------------KETAIS---AGLRSSNI-RIVDPAM
A0A1Q8BDC5      --------------------RIVLSNGTDLSVFPWYPEELSLLSEIKVPSTVQELAKTTG
A0A2V9Q1Y8      FSLLKRDFETNRTLYEGLLQKL-------------KEAGVT---AGLRSNNI-RQVDIAR
A0A2V8JXG1      YSLLKQDVDTAKSLYTEFLQKT-------------NQAYLE---VAQQQSNI-RVISPAR
A0A350D2W9      YNGLKIEIENKKSLLESLLKRQ-------------SETGVSARLRGLRTSNI-RVIDRAD
A0A2V9I4J1      LQDLATATGLEYVRLTKILDVF-------------RKLQVV------------DIVDEET
A0A2V8PQZ9      YFVPKHVHPWERQSFTGMPQGY-------------DSASTA------------HTEEATG
A0A2V8D8B1      YGALQRDAASNRQIFEALMQRT-------------KETGIS---GALKTSNI-RVVDNAE
A0A3B9LSB4      YRIIQQEIDTNKTLLDSLLQRS-------------KENDVI---MASKPNNI-SIVDYAV
A0A2V9H7U2      HNLLKREFDTNQQLYDSLLQRL-------------KDATVS---AGLRATNI-HLVDPAR
A0A2V8NJB5      GLFLELCRNNAKSFEASGTRTVVLRSGQDLSELPWYPEELGVLRELTHPTTVAGLVASTG
A0A2V9JMZ4      LQDLATATGLEYVRLTKILDVF-------------RKLQVV------------DIVDEET
A0A2V9MDJ6      LQDLATATGLEYVRLTKILDVF-------------RKLQVV------------DIVDEET
A0A2V8QJT6      YRILQQEIETNKGLLDNLLQRS-------------KENDVV---LAGRPNNI-SVVDYAI
A0A2V8FSM8      YNLLKRDVDGTRKMYESLTQRL-------------KEASMA---SALRANNV-RVVDPAE
A0A359M0J2      YGTLKREVDILRQSFNALLQQS-------------NQVSIG---SAIPVSSV-RVIDTAK
A0A2V8JLJ1      LARLTRNYDEARQHYNVLAEKR-------------SNSKMAATADSSDNNEMFKVIDAAF
A0A2V9GAQ1      YNILKREAEANKTLYDGLMTKL-------------KETAIS---QGLRSSNI-RVVDPEM
G8NS05          YTLLQRDFESNRTLYEGLLEKL-------------QTARVQ---AGLDSTEI-DIIDQAV
A0A2V8KZ20      LARLTRNYDEARQHYNVLAEKR-------------SNSKMAATADSSDNNEMFKVIDAAF
A0A3D0NWU2      LTTLKRDIETKRNLLDTYTQRL-------------KEQELAIANSTPDNIKM----AAAA
A0A2V8EPD9      -----------------------------------ARVAPAVHVAVPPAAKPTAPAAPAA
A0A3N5NSX5      YTVLEREAQSNRGIYEALLQRQ-------------NELQIV---SNSGGNNV-RLMDRAV
A0A2V8MUA1      LAGLQRQRQVANQRYELLSGKK-------------FSSDLAGRVDTDINNQTFKVIDPAN
A0A2V8MBH9      YRILQQEIETNKGLLDNLLQRS-------------KENDVV---LAGRPNNI-SIVDYAI
A0A3N5ZPQ7      VLLLDLARTAANTFEPGLYEKIGLIAEHTFATLPWQPAELAVLDCLLQPKNLEELMGETG
A0A3N5P5F2      YAALERDAASNRQIFEALLQRA-------------KETGIS---SELKTNNI-RIADPAD
A0A2V9G1P7      YNILKREVDTNKQLYEGLLLQL-------------KEAGVS---ASLKASNI-RLVDSAQ
A0A2V9BCK9      ESPLEDFIGSIGAVPSARLDHC-------------GTQGRE------RMSRIHEALKRAE
A0A2V9TMX2      YTVLKRDAETNRQLYQDLLQRL-------------KEAGVS---AGLRSSNI-RIVDIAR
A0A2V8N2J7      IDDMERELKVGEMQFHALLDKQ-------------LDTKLAKGFEQSEGGIAFAVVEPAG
A0A3N6BI26      YNILQREVDTNRQLYEGLLQRL-------------KETGIS---AGMRASNI-HVVDHAE
A0A2V9JMM3      LAEMTREQALTRSQYQGLLEKQ-------------NEMKMAERLRQKGQSLVFKVVEPAS
A0A2V9M815      LAEMTREQALTRSQYQGLLEKQ-------------NEMKMAERLRQKGQSLVFKVVEPAS
A0A2V9A795      YNILKREVETNKQLYEGLLQRL-------------KEAGVS---ASLKASNI-RIVDSAE
A0A355ESH9      FTNLKVEIQTRRELLDELLRRQ-------------SETEVAVRLQDTRESNV-RIIDHAL
A0A3D0NW85      IKLLQQNIETNKGFLDNLRKQQ-------------SSNDIA---SQGSDNNI-RVAQYAI
A0A353CAT5      LKLLQQSIETNKGFLDNLRKQQ-------------SSNDIA---TQGTDNNI-RVAAFAI
A0A2V9HB55      YNILKREAEANKTLYEGLMTKL-------------KETAIS---QGLRSSNI-RVVDPAM
A0A2V8CU57      AAWSEPESAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GWSEPES
A0A2V8BDI4      AAWSEPESAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GWSEPES
A0A2V8F8T3      AAWSEPESAAAPPVVAGWSEPE-------------TVTA--------PFAVA-GWSEPES
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      TFTQAETLVFPRVEIDPEIVHQ-------------RLISIKA------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      -------------------------------------------------MNT--------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      -SLALRGNEQLGPQLPASPGKH-------------PVGFEDVKRVRWPMDSE--------
A0A3M1SSE1      ---------------------R-------------RLLLVESSDNEPASKNR--------
A0A2V9GQV7      -------------------------------------------------NGN--------
A0A2V7YV88      ---------------------R-------------LGLMTLAHIGFAPAGKG--------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      GLHVIWPSLLARFKNEWRDRLA-------------IGID---------------------
A0A2V8D468      GLALFVEYLDDRIKTPDEIWMH-------------LGLKTLGLVPRVTPELV--------
A0A1F2R977      PPAPVR---------------P-------------EPAGRRVQLGPFDPSIA--------
A0A2U3LF12      -----------------MRPET-------------PKLKDDGITPEERRHFQ--------
A0A3N5G7M6      ---------------------------------------------------S--------
A0A1F2S3Q7      ---------------------------------------------MHSMATR--------
A0A2V8GVG4      ---------------------------------------------MAKKAQL--------
A0A143PNR5      GVPDEVTLPP-----------A-------------SSATGAIPEGGLFVSLD--------
A0A2V8PJQ0      ---------------------A-------------ARSEKRLREGEAPTAGA--------
A0A3N5YKY1      PAAAPASFPGNGGHQPLPIVVP-------------NPVLAGGRRARSVTLHP--------
A0A2V8H566      SPFVRVEPPPGSARFRHAGAGA-------------AGRLREKL-----------------
A0A2V8UVN4      LPAAATAIDVAGLESARRAA-A-------------ETVEAVPGIRTVALHLS--------
A0A321LXF5      ASQV-----------------V-------------AARLENCRSIRLPRDNE--------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      P--------------HGLGLSQ-------------RPALCDVTADRARISEK--------
A0A2V8GGF6      PPMERDAVLFSRAFRHGSG--------------------------REAIDEE--------
A0A2V8HKU7      PPMERDAVLFSRAFRHGSG--------------------------REAIDEE--------
A0A1Q6Y875      -------------------------------------MRQRCAKPAWKLHKD--------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      PPAAPGWSAAAAVAPP-----V-------------VQIDRRLAAAL--------------
A0A2V8J066      RREARARLAEQASPHR-----E-------------VNLDRHLVAAL--------------
A0A1I6MMC5      PGWPDVDVVASSVLNG-----L-------------PSDPAKIAVKRWKPLLH--------
A0A2V9D5W7      PRRVNILAPAATDPLE-----L-------------DDLRKRCSYPEWSFDPA--------
A0A2V9D4I4      ETQISTSAAPSPEPLR-----F-------------EDLQRQCTRSEWRPDPR--------
A0A2V9D6L7      -TPVSTSASTSAEPLE-----F-------------DDLQRRCTRPRWRPEPN--------
A0A2V8ZJV2      SARGTTSGNEN-TLLC-----F-------------EELGKRCVKLEWQIDPH--------
A0A2V9AWB5      STRTEAVDSSTIASFS-----F-------------EELNKRCARKEWRLDPL--------
A0A2V8Z1Y8      QAPPRIAGSREPAPSC-----F-------------GELVKRCAHPEWWPYRG--------
A0A1Q8AX10      SPVGPGIESPNSHHLR-----L-------------DELRRRCATPGWKLNPD--------
A0A2V9A773      QSPRREEMPTAGRCLR-----L-------------EELRQRCIKPGWKLSPD--------
A0A2V9AND3      QPSLQQEMPTARRCLG-----L-------------EELRRRCLKPGWKLNAD--------
A0A2V9BTJ7      S--PERSPAKGGSFLR-----Y-------------EDLIKGCARPIWKTDAR--------
A0A2V8W2M7      ARVTPPPPSEAGAFLR-----F-------------DDLVKRCAHPTWKPDMR--------
A0A2V8XNW2      ARVTPPPPSEAGAFLR-----F-------------DDLVKRCAHPTWKPDMR--------
A0A1Q7CJC1      --------------------------------------------------MR--------
A0A2V9UEM7      --------PIQGSSFS-----Y-------------ESLLARCPVSNWNPDTR--------
A0A1Q7V300      PARSAISASAAVAATT-----S-------------DILVARSRRTEWRPNPK--------
A0A2V9ZCI3      ----GPATPAFSSQFT-----F-------------DTLLARCVSVNWHPDEK--------
A0A2V9WCB3      -ASMGLGMPTFGGGLN-----M-------------DTLLARCPRTEWTPDPG--------
A0A2V9VQW5      TPGNGQGTPSFTTSFT-----F-------------DTLLARCAQGEWKPDEK--------
A0A2V9WTP3      SAHASPGLPPFGSPFS-----L-------------ETMLARCAAVQWSPDPK--------
A0A2V9NLA9      RRTVSAAMPSFGTGLS-----V-------------ESLLSRCVAGHWTPDRK--------
A0A2V9RKJ9      RRTVSAAMPSFGTGLS-----V-------------ESLLSRCVAGHWTPDRK--------
A0A2V9RN95      -------MPSFASPFT-----F-------------DALLARSAQARWSPDSK--------
A0A2V9N406      TPSAVSAVPSFSSPFT-----F-------------DTLLASCAQARWSPDSK--------
A0A2V9U6D9      TPSAVSAMPSFSSPFT-----F-------------DTLLARCAQARWSPDSK--------
A0A2G6HQA4      KRRPEPSFSTRRNSSPVHQRKP-------------EKTIEEDWEERF-------------
A0A2V7ZTY7      KRVEQALAAITAPAPDAAP--A-------------RVTPDGVVAERL-------------
A0A2V7ZVL9      KRVEQALAAIMAPAPDAAP--A-------------RVTPDGVVAERL-------------
A0A1Q7QYI4      SSPTN---------VRTAG--F-------------Y-------AEKL-------------
A0A2V8G9Y9      RADQDWVAELEIQKHRTLG--V-------------FHGFGANAVDKL-------------
A0A143PXU3      APARVPEVARVDVKPLPEQ--V-------------QRSVDDVPTARL-------------
A0A2V8D8G9      EPASPDSFESAQPFRP--A--S-------------TSRRTATRRAKLPNSAD--------
A0A2V8ESQ4      EPASPDSFESAQPFRP--A--S-------------TSRRTATRRAKLPNSAD--------
A0A1E3Y5Q0      TVPEILPSRPPASGAPSSP--V-------------GERIAADLANKI-------------
A0A2W4TWK5      AMDAPVVDDEPEPALP--P--L-------------EGRIAPALERKV-------------
A0A3N5NYV3      EAASVATEAESEATAP--R--V-------------TSSVTSLIAEKL-------------
A0A2V2RJF9      SRQKHLAKQENPPASPT-------------------------------------------
A0A2G6HNT3      RPRPVHHPELKESIEED-------------------------------------------
A0A2V7YWD4      MTATLVTDSEAATDRED-------------------------------------------
A0A192WXK4      LAAGGAPRGELVPRSIK-------------------------------------------
A0A2V2R8T6      GAARAGGFVSFEISPAR-------------------------------------------
A0A1Q7RGF1      DLGESRLGQCRKMKIPA-------------------------------------------
A0A2V9BLX2      DLGESRLGQCRKMKIPA-------------------------------------------
A0A2V9ZA03      SDLAVSNEPPGIEVEVP-------------------------------------------
A0A3N5ZNH4      IAKPGRTQKFLAAKNSE-------------------------------------------
A0A2V8GEZ2      VDRGNG------------------------------------------------------
A0A3N5ZFD3      QPRATGPMAVFHGFDPS-------------------------------------------
G8NXD3          PASDQSDAINWLNMVPK-------------------------------------------
A0A2V9VR38      RGAQSQTVGDRYLQGSR-------------------------------------------
A0A2V9EY04      QQVQVGNGNATHLVLRQ-------------------------------------------
A0A2V9HAK9      RQVTLGNGNATRLVLRQ-------------------------------------------
A0A1Q7FS15      RQVHVGNGNGARLVLHQ-------------------------------------------
A0A1Q7K9P1      RQVHVGNGNGARLVLHQ-------------------------------------------
A0A1Q7N989      RQVHVGNGNGARLVLHQ-------------------------------------------
A0A2V9G7Y0      RHVALGNGNAARLLLRQ-------------------------------------------
A0A2V8T7Z1      VVSHPAARATAPAPPQK-------------------------------------------
A0A2V7U8G5      ----------EVVPALE-------------------------------------------
A0A2V7UNP9      AESRPGRDSREAAPVPE-------------------------------------------
A0A2V7VLD7      AESRPGRDSREAAPVPE-------------------------------------------
A0A2V7XGA3      --------TARAAILTE-------------------------------------------
A0A2V7YAG6      --------TVGGAVSRD-------------------------------------------
A0A2V7VK33      ----------------L-------------------------------------------
A0A3M1VTE1      ---GARPRRPRPRITLA-------------------------------------------
A0A2V7TTM7      SVGPSPENSKIAAAALR-------------------------------------------
A0A2V8VI82      --------------AGP-------------------------------------------
A0A2V7U4P9      --------GGGSAVRST-------------------------------------------
A0A2V7TQY5      LPAGRRAGGRWVVTAPR-------------------------------------------
A0A2V7TU87      -----MSRHR----MAT-------------------------------------------
A0A2V8SEH0      AAPAARPIGS----SGA-------------------------------------------
A0A2V8VU54      ----ATETQG----VRG-------------------------------------------
A0A1Q7RML7      ----APSAGG----LRG-------------------------------------------
A0A1Q7ZIQ5      ----APSAGG----LRG-------------------------------------------
A0A2V8TKD8      ----AQSAGG----LRG-------------------------------------------
                                                                            

A0A1F2U8T6      RVSSNSRANNVRLVERGEVPGSPVTPSGRRTWGLSVVVGLFAAIAVAYGLDYMNDTVKTP
A0A2V8BV42      RVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGLDYMNDTIKTP
A0A2V8F916      RVSSNSRQNNVRIVDKAEVPQSPMTAGGRRTWMMSSLVGLVLAIGVAFGLDYMNDTIKTP
A0A1Q7K833      RVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTP
A0A1Q8AMY4      RVSSNSRQNNVRVVDHAEVPRGPLAPTGRRTWLLSLAVGLVLAVGVAYGLDYMNDTIKTP
A0A2V8BM40      RVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGLDYMNDTIKTP
A0A2V8CRT6      RVSSNSRQNNVRVIDHAEAPGGAMSPSGRRTWLLALGIGLALGIGLAYGLDYMNDTIKTP
A0A1F2VH76      RVVANSRTNNIRLVDRAQVPGSPSSPNHRQDWIYALAFGLVFALGAAFGIDYLDDTVKTP
A0A1F2R0X5      RVASNSRANNVRLVDRAEVPGSPVTPGGRRTWLLSIVVGLVLAVGVAMGLDYMNDTIKTP
A0A2V8B278      RVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGLDYMNDTIKTP
A0A2V8CEF9      RVASNSRANNVRVVDRAEVPKAPLAPTGRRTWLLSLAVGLTLAIAVAYGLDYMNDTIKTP
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      PPGAPYK--PDIYMYTMLGLAT-----------GVFLSILLIVRQARV-----DRTIQSP
A0A2V8GAF9      RANRPVGGWPARVTREDVSTQL-------------------------------DQTATSS
A0A2V8CN98      APETPVK--NTAVRLLIMGLFA-----------GLGFGVVGAVVIDRF-----DPRVRYP
A0A1Q7LC46      VPTSPAR--PAKARNIMLAFLV-----------GLIGGIGLALMREYL-----DNTVKTP
A0A1Q8BDC5      MKETNIR--KVLGVFQTLGIIE-----------------TFADAEAPI-----PGALTRR
A0A2V9Q1Y8      TPAGPAE--PNIPRNLGFALAL-----------GLTSGIGLAFLLEGI-----DNTVRTP
A0A2V8JXG1      MPKGPVS--PNRQRTILIGLLL-----------SLSGGIGLAWLLERF-----DDSIRSV
A0A350D2W9      LPINPSS--PKKLRNLLLALFL-----------GLFGGAGLAFVMEYL-----DNTVKSA
A0A2V9I4J1      G----------------------------------------------------QDDTKGS
A0A2V8PQZ9      GPALPDG--PA----------------------SRDAGATLGAVGSAR-----AAEFSSR
A0A2V8D8B1      TPRVPAS--PNKLANMMLAFIG-----------GSVLAVALVFFFEYA-----DNRIKSP
A0A3B9LSB4      TPDGPIG--PNRSSTVSMALFL-----------SLGLGVGLALLLEYF-----DDTLRSS
A0A2V9H7U2      PPKVPVR--PQKLYNIAVSIAV-----------GLILGVMLAFVKEAL-----DSSIKSI
A0A2V8NJB5      MKETPLR--RILGVFDQLGIIE----------------------LKSE-----NEFLSEH
A0A2V9JMZ4      G----------------------------------------------------QDDTKGS
A0A2V9MDJ6      G----------------------------------------------------QDDTKGS
A0A2V8QJT6      VPDLPVG--PARLRTVMFAFLL-----------ALAFGAALALFLEYL-----DDTVHST
A0A2V8FSM8      EPEAPYK--PDVVRRITFGLIF-----------GAMFGVAFSVLRERA-----DRTLQDP
A0A359M0J2      PNNTQMS--PSLFRELARGLGL-----------GLLLGYGCAFLHERVYRKRQERRFAAP
A0A2V8JLJ1      LPRQAIG--PNRRLIAALGGAA-----------GLVLGLAIAFLREFT-----DSSLHTE
A0A2V9GAQ1      IPSTPAR--PAKARNMVLAFLV-----------GLVGGIGLALMREYL-----DNTVKTP
G8NS05          PPAQPSL--KSKSSIMMLNTII-----------GIVLGAILGFILESL-----DTNLHSV
A0A2V8KZ20      LPRQAIG--PNRRLIAALGGAA-----------GLVLGFGIAFLREFT-----DSSLHTE
A0A3D0NWU2      ETAPRVG--PNRTRNIIVALLL-----------SLAAGIGLAFLLDYL-----DDSVKNS
A0A2V8EPD9      VPKPPIA--PARPVAASASNAP-----------------AASAAPRPA-----GAKRAPA
A0A3N5NSX5      VPGSPFT--PDVRRNYMLGALT-----------GLLLSLGLVLAIDYL-----DDTVKTP
A0A2V8MUA1      LPIRPFG--PNRERMIMIGCLA-----------SFALGLALVFARELL-----DSTLSDE
A0A2V8MBH9      TPDFPVG--PARMRSVMLAFVL-----------ALALGVGLALFLEYL-----DDSIHST
A0A3N5ZPQ7      LPESQLV--ACLQTLRALGMIE----------------------IREE-----ETEEERS
A0A3N5P5F2      VPRVPIS--PNKQRDLLFGVMV-----------GLVAAIGMAFLFEYL-----DNKIKSP
A0A2V9G1P7      PPAKPVK--PKILLNLAVAMFL-----------GLGLGIGTALFQERM-----DNTLKGD
A0A2V9BCK9      QERAPIQ--SANEAKPSDSLLAEGAHRDGGEWSALGMVSPVGPGIESP-----NSHHLRL
A0A2V9TMX2      VPTQPIS--PNVHRSLVLGFLL-----------ALGLGVGLALVRETF-----DSTVRSM
A0A2V8N2J7      LPRAPFS--PQRVRLVALGVVA-----------GLGLGLALIFVLEQN-----DTTFGNV
A0A3N6BI26      VPEAPYS--PQRAADLALGLGV-----------GLFLAIGLAFLMEYL-----DNTLKTP
A0A2V9JMM3      VPSAPSS--PKRERILLLGFVG-----------SLGLGVVLAFLVEQL-----DTSFDSA
A0A2V9M815      VPSAPSS--PKRERILLLGFVG-----------SLGLGVVLAFLVEQL-----DTSFDSA
A0A2V9A795      PPAKPAK--PRIPLNLAVAALL-----------GLGLGISTAFLQERL-----DDTLKGA
A0A355ESH9      VPDGPFR--PSLRKDLTYGLLI-----------GLLFGIGVALFLEFL-----DRTVKSP
A0A3D0NW85      PPKNPVS--PSRTTTVLAALLL-----------STLFGMGLALFLEYL-----DDTIGTT
A0A353CAT5      PPDTPVA--PRRLTTVLAALFL-----------STLFGMGLALFLEYL-----DDTIRTT
A0A2V9HB55      IPSTPAR--PAKTRNLALAFLV-----------GLVGGIGLALLREYL-----DNTVKTP
A0A2V8CU57      ATAPPAV--AAWSEAVTAPFAV------------VASSEPETVTAPFV-----VVAPSGP
A0A2V8BDI4      ATAPPAV--AAWSEAVTAPFAV------------VASSEKETVTAPFV-----VAAPSGP
A0A2V8F8T3      ATAPPAV--AAWSEAVTAPFAV------------VASSEPETVTAPFV-----VAAPSGP
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      EDVTRFLKMTFLGLVPSVRGDK--------------------------------------
A0A2V8BV42      EDVTRRLKLPFLGLVPSVRGDK--------------------------------------
A0A2V8F916      EDVTRRLKLPFLGLVPSVRGDK--------------------------------------
A0A1Q7K833      EDVARRLKLPFLGLVPSVRGDK--------------------------------------
A0A1Q8AMY4      EDVARRLKLPFLGLVPSVRGDK--------------------------------------
A0A2V8BM40      EDIARRLRLPFLGLVPSVRGDA--------------------------------------
A0A2V8CRT6      EDIARRLRLPFLGLVPSVRGDA--------------------------------------
A0A1F2VH76      EDITRRLKLRFLGLVPAVRGDR--------------------------------------
A0A1F2R0X5      EDVTKRLRLPFLGLVPSVRGAK--------------------------------------
A0A2V8B278      EEVTRRLRLPFLGLVPSVRGDK--------------------------------------
A0A2V8CEF9      EEVTRRLRLPFLGLVPSVRGDK--------------------------------------
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------------------------------------------------
A0A2V8YMQ4      ------------------------------------------------------------
A0A1Q7L5B1      ------------------------------------------------------------
A0A2V9DKV4      ------------------------------------------------------------
A0A2V8W380      ------------------------------------------------------------
A0A2V8ZIV5      ------------------------------------------------------------
A0A2V9EVA0      ------------------------------------------------------------
A0A1Q7RB73      ------------------------------------------------------------
A0A2V9K0H7      ------------------------------------------------------------
A0A3N5YN96      ------------------------------------------------------------
A0A1Q7Y646      ------------------------------------------------------------
A0A2V8QZU0      ------------------------------------------------------------
A0A2V8RSQ9      ------------------------------------------------------------
A0A2V9LS17      ------------------------------------------------------------
A0A2V9AGR3      ------------------------------------------------------------
A0A2V9G0N7      ------------------------------------------------------------
A0A2V9GQ44      ------------------------------------------------------------
A0A2V9HRN3      ------------------------------------------------------------
A0A2V8WG13      ------------------------------------------------------------
A0A2V8X987      ------------------------------------------------------------
A0A1Q7KX94      ------------------------------------------------------------
A0A2V8XHT0      ------------------------------------------------------------
A0A2V9L2P7      ------------------------------------------------------------
A0A2V7UMX0      ------------------------------------------------------------
A0A136K497      ------------------------------------------------------------
A0A399W9E4      ------------------------------------------------------------
A0A2V7X0V9      ------------------------------------------------------------
A0A2V9X518      ------------------------------------------------------------
A0A2V9VC62      ------------------------------------------------------------
A0A2V9S1P8      ------------------------------------------------------------
A0A2V9RTW2      ------------------------------------------------------------
A0A2V9TGF1      ------------------------------------------------------------
A0A2V9XEV6      ------------------------------------------------------------
A0A2V9Y3Q6      ------------------------------------------------------------
A0A2V9R269      ------------------------------------------------------------
A0A2V9PTS3      ------------------------------------------------------------
A0A2V9NPF4      ------------------------------------------------------------
A0A2V9PNZ0      ------------------------------------------------------------
A0A321LMC5      ------------------------------------------------------------
A0A2V8X713      ------------------------------------------------------------
A0A2V8ZLE9      ------------------------------------------------------------
A0A2V8Y4D3      ------------------------------------------------------------
A0A2V8Z2X8      ------------------------------------------------------------
A0A2V9C3F6      ------------------------------------------------------------
A0A2V9QMU9      ------------------------------------------------------------
A0A2V9QY75      ------------------------------------------------------------
A0A2V9SVU9      ------------------------------------------------------------
A0A2V8W5N5      ------------------------------------------------------------
A0A2V8XG53      ------------------------------------------------------------
A0A2V9XV04      ------------------------------------------------------------
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      ------------------------------------------------------------
A0A352EZH8      ------------------------------------------------------------
A0A0B6X033      ------------------------------------------------------------
A0A2V8R0I3      ------------------------------------------------------------
A0A2V8N1U8      ------------------------------------------------------------
A0A2V8QL35      ------------------------------------------------------------
A0A352FU10      ------------------------------------------------------------
A0A2V8LCU0      ------------------------------------------------------------
A0A1Q7NGT0      ------------------------------------------------------------
A0A2V8MLP9      ------------------------------------------------------------
A0A2V8PQZ0      ------------------------------------------------------------
A0A3B9MKY6      ------------------------------------------------------------
A0A3D5SKZ1      ------------------------------------------------------------
A0A2V8NRW2      ------------------------------------------------------------
A0A2V8TKR9      ------------------------------------------------------------
A0A2V8LBV1      GEAPTYLKVRELGVILSAEADSTLGRPGRSKHIPSLQSLIQLGKPAGNGSFSKAVRKYAG
A0A2V8GAF9      ESARRADAAARLREFVRANGERFQ------------------------------------
A0A2V8CN98      AQVTTDMGLRILGALPHV------------------------------------------
A0A1Q7LC46      DDIESLARLPSLAVVPQFTGL--------------------NGSKGRGVLPGLSSNGHE-
A0A1Q8BDC5      DALVRTSEFPLEELVPVVSNAT--------------------------------------
A0A2V9Q1Y8      EQAQLISGLPSLGMIPLGSRTAAEANPTGLSVAASK------------------------
A0A2V8JXG1      DDVNRYTQLPALAVIPAIGANNSLLNGRRRKDNAGELLALDSGDKPTAK-----------
A0A350D2W9      EEVGRYTGLPTLGVVPVFGDDSNRAYGYYYSYGQKKGEEKGKGGKEDSGKP---------
A0A2V9I4J1      AAVGGQSRFPFEHLIPEISNAV--------------------------------------
A0A2V8PQZ9      EVLAAR------------------------------------------------------
A0A2V8D8B1      NEIKAHLGLPFLGMIPSLTDQ---------------------------------------
A0A3B9LSB4      EEVERLLQLPALGVIPS------------------------ANASARRRLMGASGALQKR
A0A2V9H7U2      EEAERVVNAPALAVVPLER----------------------EIPHRAARSLTRNNGTSKP
A0A2V8NJB5      VAIVKRSGFPFDGLIPVISNAV--------------------------------------
A0A2V9JMZ4      AAVGGQSRFPFEHLIPEISNAV--------------------------------------
A0A2V9MDJ6      AAVGGQSRFPFEHLIPEISNAV--------------------------------------
A0A2V8QJT6      DDVERFLRLPALAVIPAMS----------------------SASAPRRLLSSATSLQKRN
A0A2V8FSM8      GDVSYYLGVPELGVVPVGEPID-------------------LPRSGVRSPAAALTGASAP
A0A359M0J2      GNSGRLLNVPELGVIPSNAAPERFGKQFFRI----------RVRRRKSKPLSLTGTGTAA
A0A2V8JLJ1      DELAAAIKLPILASIPTVD----------------------EKRTRKRKSASVLRLQEHK
A0A2V9GAQ1      DDVETHSRLPSLAVVPQFTGSN-------------------GSGKHHGPLLGFSSNGHE-
G8NS05          AEIEAVSGLHSLALIPRARRTGIDTSNLSV------------------------------
A0A2V8KZ20      DELAAAIKLPILASIPTVD----------------------EKRTRKRKSASVLRLQEHK
A0A3D0NWU2      EEIGRQLGLPTLALIPHYF----------------------GSEKKRLRLAAENGGS---
A0A2V8EPD9      WSREASIEKPIVHAAPT-------------------------------------GSSLIA
A0A3N5NSX5      EDITRRLKLPFLGLVPAVK-----------------------------------------
A0A2V8MUA1      DTAASELKLPVLACVPNI-----------------------PAGRKKRRERTNSKAGMVA
A0A2V8MBH9      DDVEKFLRLPALAVIPSMS----------------------GGVARRRRLLSSATALQKR
A0A3N5ZPQ7      VALTVRERLPLEQLVPEAADAL--------------------------------------
A0A3N5P5F2      PEIRTYLNLPCLGLVPRIAGKH--------------------------------------
A0A2V9G1P7      DDVERLFGLPSLALIPVVPPSDSDQHGIHRFLPRDKAFEFKGNGAGKNSHS---------
A0A2V9BCK9      DELRRRCATPGWKLNPDY------------------------------------------
A0A2V9TMX2      EEVRAVSTLPALGTIPLQLVT--------------------DERFRKRRLTISPDGERS-
A0A2V8N2J7      DDFESFSTLPVAGIVPNIQNRNKKR-----------------------------------
A0A3N6BI26      EDMEQSLGLPSLGVIPAMA----------------------DLPAGSSRLLASRNESGDS
A0A2V9JMM3      DDFKTFTNLPLLAVIPSVR----------------------SKSRSGRKLPEGGKGDPHL
A0A2V9M815      DDFKTFTNLPLLAVIPSVR----------------------SKSRSGRKLPEGGKGDPHL
A0A2V9A795      DDVERVFGLSALALIPSVHHLNGDRPSV-------------SSLLGRTNLLRSGQNGTAS
A0A355ESH9      EEVERRFSIATLAVIQDIAETGKAYGSPAYGYGYGYGYGYGDPPTGEPSRVRPTKGKAKV
A0A3D0NW85      EEIESYLQLPALAAIPSI------------------------DSMPKRKLLLVGGSDRPD
A0A353CAT5      EEIENYLQLPALAAIPTI------------------------DSMPKRRLLLVGNAERPA
A0A2V9HB55      DDIETLARLPSLAVVPQFTGS--------------------NGHAKKRGLLQGPAAN---
A0A2V8CU57      ENVQ-----PPLPPLPTW-DF--------------------DGSVAAAELVEAPDEPKVV
A0A2V8BDI4      ENVQ-----PPLPPLPTW-DF--------------------DGSVAAAELVEAPDEPKVV
A0A2V8F8T3      ENVQ-----PPLPPLPTW-DF--------------------DGSVAAAELVEAPDEPKVV
A0A2V9J901      ------------------------------------------------------------
A0A2V8MKQ7      ------------------------------------------------------------
A0A3M1SNQ5      ------------------------------------------------------------
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ------------------------------------------------------------
A0A2V8NMG8      ------------------------------------------------------------
A0A2V8TBM7      ------------------------------------------------------------
A0A1Q7HEZ8      ------------------------------------------------------------
A0A1Q7JW36      ------------------------------------------------------------
A0A1Q7MUR4      ------------------------------------------------------------
A0A3N5PFU4      ------------------------------------------------------------
A0A1F2T1R8      ------------------------------------------------------------
A0A2V9BW09      ------------------------------------------------------------
A0A3M1SSE1      ------------------------------------------------------------
A0A2V9GQV7      ------------------------------------------------------------
A0A2V7YV88      ------------------------------------------------------------
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      ------------------------------------------------------------
A0A2V8FGH1      ------------------------------------------------------------
A0A2V8D468      ------------------------------------------------------------
A0A1F2R977      ------------------------------------------------------------
A0A2U3LF12      ------------------------------------------------------------
A0A3N5G7M6      ------------------------------------------------------------
A0A1F2S3Q7      ------------------------------------------------------------
A0A2V8GVG4      ------------------------------------------------------------
A0A143PNR5      ------------------------------------------------------------
A0A2V8PJQ0      ------------------------------------------------------------
A0A3N5YKY1      ------------------------------------------------------------
A0A2V8H566      ------------------------------------------------------------
A0A2V8UVN4      ------------------------------------------------------------
A0A321LXF5      ------------------------------------------------------------
A0A1Q7JFB1      ------------------------------------------------------------
A0A2V8DMJ9      ------------------------------------------------------------
A0A2V8GGF6      ------------------------------------------------------------
A0A2V8HKU7      ------------------------------------------------------------
A0A1Q6Y875      ------------------------------------------------------------
A0A2V8DZN4      ------------------------------------------------------------
A0A2V8I604      ------------------------------------------------------------
A0A2V8J066      ------------------------------------------------------------
A0A1I6MMC5      ------------------------------------------------------------
A0A2V9D5W7      ------------------------------------------------------------
A0A2V9D4I4      ------------------------------------------------------------
A0A2V9D6L7      ------------------------------------------------------------
A0A2V8ZJV2      ------------------------------------------------------------
A0A2V9AWB5      ------------------------------------------------------------
A0A2V8Z1Y8      ------------------------------------------------------------
A0A1Q8AX10      ------------------------------------------------------------
A0A2V9A773      ------------------------------------------------------------
A0A2V9AND3      ------------------------------------------------------------
A0A2V9BTJ7      ------------------------------------------------------------
A0A2V8W2M7      ------------------------------------------------------------
A0A2V8XNW2      ------------------------------------------------------------
A0A1Q7CJC1      ------------------------------------------------------------
A0A2V9UEM7      ------------------------------------------------------------
A0A1Q7V300      ------------------------------------------------------------
A0A2V9ZCI3      ------------------------------------------------------------
A0A2V9WCB3      ------------------------------------------------------------
A0A2V9VQW5      ------------------------------------------------------------
A0A2V9WTP3      ------------------------------------------------------------
A0A2V9NLA9      ------------------------------------------------------------
A0A2V9RKJ9      ------------------------------------------------------------
A0A2V9RN95      ------------------------------------------------------------
A0A2V9N406      ------------------------------------------------------------
A0A2V9U6D9      ------------------------------------------------------------
A0A2G6HQA4      ------------------------------------------------------------
A0A2V7ZTY7      ------------------------------------------------------------
A0A2V7ZVL9      ------------------------------------------------------------
A0A1Q7QYI4      ------------------------------------------------------------
A0A2V8G9Y9      ------------------------------------------------------------
A0A143PXU3      ------------------------------------------------------------
A0A2V8D8G9      ------------------------------------------------------------
A0A2V8ESQ4      ------------------------------------------------------------
A0A1E3Y5Q0      ------------------------------------------------------------
A0A2W4TWK5      ------------------------------------------------------------
A0A3N5NYV3      ------------------------------------------------------------
A0A2V2RJF9      ------------------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      ------------------------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      ------------------------------------------------------------
A0A3N5ZNH4      ------------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      ------------------------------------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ------------------------------------------------------------
A0A2V7U8G5      ------------------------------------------------------------
A0A2V7UNP9      ------------------------------------------------------------
A0A2V7VLD7      ------------------------------------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      ------------------------------------------------------------
A0A2V7VK33      ------------------------------------------------------------
A0A3M1VTE1      ------------------------------------------------------------
A0A2V7TTM7      ------------------------------------------------------------
A0A2V8VI82      ------------------------------------------------------------
A0A2V7U4P9      ------------------------------------------------------------
A0A2V7TQY5      ------------------------------------------------------------
A0A2V7TU87      ------------------------------------------------------------
A0A2V8SEH0      ------------------------------------------------------------
A0A2V8VU54      ------------------------------------------------------------
A0A1Q7RML7      ------------------------------------------------------------
A0A1Q7ZIQ5      ------------------------------------------------------------
A0A2V8TKD8      ------------------------------------------------------------
                                                                            

A0A1F2U8T6      -----------------HPLMASWDTPKHFG--------EAFRNL-RTAIIALY-PGDG-
A0A2V8BV42      -----------------HPLLTSAHVPHDFG--------EAFRAL-RTSLISKY-PATG-
A0A2V8F916      -----------------HPLLTSAHVPHDFG--------EAFRAL-RTSLISKY-PATG-
A0A1Q7K833      -----------------HPVLASSHVPHDFG--------ESFRAL-RTSLMSKY-PGEG-
A0A1Q8AMY4      -----------------HPVLASSHVPHDFG--------ESFRAL-RTSLMSKY-PGEG-
A0A2V8BM40      -----------------HPVLASSNVPHNFG--------ESFRAL-RTSLTSKY-PTDG-
A0A2V8CRT6      -----------------HPVLASSNVPHNFG--------ESFRAL-RTSLTSKY-PTDG-
A0A1F2VH76      -----------------HPLLSGP-VPHDFG--------EAFRTL-RTALVSQL-PGDG-
A0A1F2R0X5      ----------------QQPLLTSSHAPVDFS--------ESFRSL-RTTLLTRY-SGEG-
A0A2V8B278      -----------------HPLLASSHVPHDFG--------ESFRAL-RTALVSKY-PSAG-
A0A2V8CEF9      -----------------HPLLASSHVPHDFG--------ESFRAL-RTALISKY-PSAG-
A0A2V8KZG2      ------------------------------------------------------------
A0A1Q7LG57      ------------------PELATWKRKPSFLA-------ECARTT-LTSILLPS-QNGDC
A0A2V8YMQ4      ----------------SFLGPGRMERRVTLAR-------AGTALI-KEDSVLLSTADHP-
A0A1Q7L5B1      ----------------PTYSAFSNSKSFTSCA-------EQFSKL-RTRLYEFR-DNEP-
A0A2V9DKV4      ----------------PTYSAFSNSKSFTSCA-------EQFSKL-RTRLYEFR-DNEP-
A0A2V8W380      -------------------LIDRDGAQHAALG-------EAFRSL-RTSVLLST-PDRP-
A0A2V8ZIV5      -------------------RIDQRGKPQAALV-------EAFRSL-RASVLLST-ADHP-
A0A2V9EVA0      ----------------KDSLVLFNEQSFDRCA-------EQFRIL-RARLYRLR-EKKP-
A0A1Q7RB73      ----------------RNMMLFFDRRNPVVGV-------EEFRTL-RSHLTLIR-ERQP-
A0A2V9K0H7      ----------------RKMMLFFDRRNPVVGV-------EEFRTL-RSHLSLIR-EQLP-
A0A3N5YN96      ----------------LHPLLAAALEFGSPAA-------EQFRAL-RTRIGQVEFGGRD-
A0A1Q7Y646      ----------------VEPHLVAITQPRSPYC-------EQFRSL-RTRLLQAS-ERRK-
A0A2V8QZU0      ----------------VEPHLIAITQPRSAHA-------ERFRSL-RTRVLHAG-ERKK-
A0A2V8RSQ9      ----------------VEPHLVAITDPRSPHA-------EQYRSL-RTRVLHAG-ERRK-
A0A2V9LS17      ----------------VKTMLFFGEENYALGT-------EEFRTL-RSHLFGLN-ETSA-
A0A2V9AGR3      ----------------PQVSLVDGGESETGGA-------ERFRTL-RSRLFQIA-ATRP-
A0A2V9G0N7      ----------------PARSVFGGPDSKKLGA-------EPFRTL-RSRLSQIA-GTHV-
A0A2V9GQ44      ----------------PARSVFGGPDSKKFGA-------EPFRTL-RSRLSQIA-GTHV-
A0A2V9HRN3      ----------------PARSVFGGTDSKKFGA-------EPFRTL-RSRLSQIA-GTRV-
A0A2V8WG13      ----------------PRLNIFLKTDEGRIGR-------ERFRTL-RSRLYQIA-ATRP-
A0A2V8X987      ----------------PRASAFQDSNSGHSGA-------ERFRTL-RSRLSQIA-GTRT-
A0A1Q7KX94      ----------------PVSSVFLNSKPGEGGP-------ERFRTL-RSRLYKIA-STRK-
A0A2V8XHT0      ----------------PVSSVFLNSKPGEGGP-------ERFRTL-RSRLYKIA-STRK-
A0A2V9L2P7      ----------------EMVELSVLKNPGASIS-------EAFRTL-RTSILLST-AERP-
A0A2V7UMX0      ----------------IDGRLVSLTAPTSPEA-------HQYRVL-GHQLERLR-REGG-
A0A136K497      ----------------VEPRLVAITSPNSSYC-------EEYRSL-RTHVLHKS-QRQH-
A0A399W9E4      ----------------VEPRLVAITSPNSSYC-------EEYRSL-RTNVLHKS-QRQN-
A0A2V7X0V9      ----------------LGTMLFMNGDDSKRGT-------EEFRTL-RSRLYHMR-EKMT-
A0A2V9X518      ----------------PKSMLFFNDDERKYGA-------EEFRTL-RSRLYQMR-EKMP-
A0A2V9VC62      ----------------PTTMLFFSQEDNALGT-------EQFRTL-RSRLYQLR-EKIS-
A0A2V9S1P8      ----------------RKTMLFFNPEEQEYGN-------EEFRTL-RSRLYQIR-EKQS-
A0A2V9RTW2      ----------------TNTMLFFKAEEQGFGT-------EEFRTL-RSRLYQMR-EKQA-
A0A2V9TGF1      ----------------TNTMLFFKAEEQGFGT-------EEFRTL-RSRLYQMR-EKQA-
A0A2V9XEV6      ----------------PKSMLFFNDDERKYGA-------EEFRTL-RSRLYQMR-EKMP-
A0A2V9Y3Q6      ----------------AKSMLFFNSDERKYGV-------EEFRTL-RSRLYQLR-EKMS-
A0A2V9R269      ----------------PKKMLFFGTEEHASGM-------EEFRTL-RSRLYQAR-EKQP-
A0A2V9PTS3      ----------------LKCMLFFSGEEHGSGM-------EEFRTL-RTRLYQIR-EKQPL
A0A2V9NPF4      ----------------LKSMLFFSGEEHGSGM-------EEFRTL-RTRLYQIR-EKQPL
A0A2V9PNZ0      ----------------LKCMLFFSGEEHGSGM-------EEFRTL-RTRLYQIR-EKQPL
A0A321LMC5      ----------------VDQHLAGLIERDDLAR-------ERYNTL-AVRLINLA-AKHN-
A0A2V8X713      ----------------PDYDVFSAKQTSFPCA-------EQFRTL-RARLYRLR-EKNP-
A0A2V8ZLE9      ----------------PDCDVFSTKQSSSLCA-------EQFRTL-RSHLYRLR-EKNP-
A0A2V8Y4D3      ----------------PDYDAFSPQHSSALCA-------EQFRTL-RSRLYRLK-EKSP-
A0A2V8Z2X8      ----------------PDYDVFSTKQSSALCA-------EQFRTL-RSRLDRLR-KKSA-
A0A2V9C3F6      ----------------PDYDVFSTQQSSALCA-------EQFRTL-RSRLYRLR-EKSP-
A0A2V9QMU9      ----------------EAIELVTQSRPQSQMA-------EAYRAL-RTALLLSS-VGAA-
A0A2V9QY75      ----------------EPVELITQARPQSQMA-------ESYRAL-RTSLLLTS-LGAP-
A0A2V9SVU9      ----------------EVVELITQSRPQSQMA-------ESYRAL-RTSLLLTS-LGAP-
A0A2V8W5N5      ----------------PGKNVFSNAAATACGA-------EQFRTL-RSRLYQIR-GNQP-
A0A2V8XG53      ----------------PGKNVFSNAAATACGA-------EQFRTL-RSRLYQIR-GNQP-
A0A2V9XV04      ----------------LQTMLFMNGNDSAKGT-------EEYRTL-RSRLYHIR-EKMP-
A0A2V9CBY1      ----------------LRWNVFSNERSCKRQA-------EQFHTL-RARLYSLR-DTRP-
A0A2V9D656      ----------------LRWNVFPKERPCGRQA-------EQFHSL-RARLYSLR-DTRP-
A0A352EZH8      ----------------VEPHLVAITQPRSAYC-------EQFRSL-RTRVLQAG-EREQ-
A0A0B6X033      ----------------ADQHLIAITQPQSPEC-------EQFRSL-RTHVLHAG-EKRQ-
A0A2V8R0I3      ----------------VEPHLVAITQPRSPEC-------EQFRAL-RTRLLEAG-ERKR-
A0A2V8N1U8      ----------------VEPHLVAITSPRSPEC-------EQFRSL-RTRLLQAS-ERER-
A0A2V8QL35      ----------------VEPHLVALTDPRSVAC-------EQFRAL-RTQLLQAG-EREH-
A0A352FU10      ----------------VEPHLVAITDPRSPEC-------EQFRAL-RTRLLQAG-EREH-
A0A2V8LCU0      ----------------VEPHLVAVTSPHSPEC-------EQFRAL-RTRLLQAG-ERQG-
A0A1Q7NGT0      ----------------VEPHLLAITEPRSAEC-------EQYRSL-RTRLLQAG-ERQR-
A0A2V8MLP9      ----------------VEPHLLAITEPRSPEC-------EQYRSL-RTRLLQAG-ERQR-
A0A2V8PQZ0      ----------------VEPHLLAITEPRSPEC-------EQYRSL-RTRLLQAG-ERQR-
A0A3B9MKY6      ----------------VEPHLVAVSQPRSPYC-------EQFRSL-RTKLLQAG-ERKQ-
A0A3D5SKZ1      ----------------VEPHLVAVSQPRSPYC-------EQFRSL-RTKLLQAG-ERKQ-
A0A2V8NRW2      ----------------VEPHLIAVTQPRSAYC-------EQFRSL-RTRVLQAS-ERKK-
A0A2V8TKR9      --------------------------------------------------MLLSAAGSP-
A0A2V8LBV1      ENRAP-----------KRVELMTWEKRSSLFA-------ECFRTT-AASLLFSEPNGAP-
A0A2V8GAF9      ----------------IAEQLVSLIAPGSFAA-------DQYRAL-RHNLERLRRES-G-
A0A2V8CN98      ----------------KKRAGASDDESGALVI-------ETMRGV-RLSLIHAYGTA-G-
A0A1Q7LC46      ----------------RRIELVAQHLPKSQMS-------EAFRAL-RTSILLSQADH-P-
A0A1Q8BDC5      ----------------LAEKLQIARSEMSFTS-------EQFKNL-KVQLRDAASKA-S-
A0A2V9Q1Y8      ----------------EAVELITISRPQSQMS-------ESYRAL-RTSLLLTSLGA-P-
A0A2V8JXG1      ----------------MQRARLMEFDGRSPAS-------EAYRAL-RTALLLSAAGN-P-
A0A350D2W9      ----------------KNIELIVHFAPESAFA-------ENYRSL-RTALLLSSPQG-S-
A0A2V9I4J1      ----------------LSEKLEVLKNEFSFVS-------EQFKAL-KVRINETQADH-A-
A0A2V8PQZ9      ----------------VEPHLLAITEPRSAEC-------EQYRSL-RTCLLQAGERQ-R-
A0A2V8D8B1      ----------------VEGTPLLDNGVNAGFA-------EAFRMV-RTNLVFSTVDN-G-
A0A3B9LSB4      NGHS------------DSPELLMNVDGHSPLA-------EAYRHL-RTSVLLSTAGR-A-
A0A2V9H7U2      ----------------GDAELALLKQPSSALA-------ESFRTL-LTSVVLSTAPR-P-
A0A2V8NJB5      ----------------VSDKLEVLKNSSSFIS-------EQFRNL-KVRINESDN---P-
A0A2V9JMZ4      ----------------LSEKLEVLKNEFSFVS-------EQFKAL-KVRINETQADH-A-
A0A2V9MDJ6      ----------------LSEKLEVLKNEFSFVS-------EQFKAL-KVRINETQADH-A-
A0A2V8QJT6      SSNG------------ANPELLLNINGRSALA-------EAYRQL-RTSVLLSTAGR-A-
A0A2V8FSM8      AAPGLSVA--------HRVELISFRQKTSLLA-------ESFRTT-LTSILFSQRNGAY-
A0A359M0J2      PAAETPPSNP------RLEFLEIWKGKPSIVA-------ESFRLT-LTSLTRSGPGSLA-
A0A2V8JLJ1      GGSGPSPLRHV-----DNKITDAILNPSCSAR-------EHYRFL-HSQLLAMQRKK-H-
A0A2V9GAQ1      ----------------KRMELVAHHLPKSQMS-------EAFRAL-RTSILLSQADH-P-
G8NS05          ----------------IQRNLATLSSPKSQFT-------EAFRGL-RTSLLLSTAGK-L-
A0A2V8KZ20      GGSGHSPLRHV-----DNKITDAILNPSCSAR-------EHYRFL-HSQLLAMQRKK-H-
A0A3D0NWU2      ----------------PGTSLVALEERHSPMA-------EAYRHL-RTSLLFSSAGK-P-
A0A2V8EPD9      VPASADQLTLWRSDPETAGKLVGTDGFLPSAM-------EQYRKL-AAILHHAQMER-G-
A0A3N5NSX5      ----------------GNNHPLLSQEVPHEFG-------EAFRAL-RTSLVFSSGTE-G-
A0A2V8MUA1      VSVGHDSINKFSLDYADIRIKKVVLDPLTVSG-------EQFRVV-RAQLSALQKKR-N-
A0A2V8MBH9      NGNTS-----------GTPELLLNVNGRSALA-------ESYRQL-RTSVLLSTAGR-A-
A0A3N5ZPQ7      ----------------LSQQLETVTNEHSFAS-------EQFASL-KVRIKESRAGS-P-
A0A3N5P5F2      ----------------GSSPLLLNNGAPDSFA-------EAFRAV-RSNVLFSVS-P-E-
A0A2V9G1P7      ----------------YWHRIDRDETQHASLV-------EAFRNL-RTSVLLSTPDR-P-
A0A2V9BCK9      --------------------AVFCKQSLAVCA-------EQFRTL-RSRLYRLRDKQ-P-
A0A2V9TMX2      ----------------GMLALVTYERPKSEAA-------EAYRAL-RTSILLSSFGA-P-
A0A2V8N2J7      ----------------TQPSVVTVEEPDSIAA-------EQYRIL-AMRVQQQCDAA-Q-
A0A3N6BI26      ----------------KTDLPAAISPARFRVW-------EAYRSL-RTSILLSHSGK-P-
A0A2V9JMM3      PQPNLRHL--------QKNRVVTVTDPGAIAS-------EQYSIL-AMKLRWHLGEA-P-
A0A2V9M815      PQPNLRHL--------QKNRVVTVTDPGAIAS-------EQYSIL-AMKLRWHLGEA-P-
A0A2V9A795      NPAA------------RWHRIDQGQRPQPALI-------EAFRSL-RASVLLSTADH-P-
A0A355ESH9      AGGGWLEKKKGTPGPQAQIELVPHERPRTLIS-------ESYRSL-RTALLLSSA-R-E-
A0A3D0NW85      EE--------TEP---LNSELLINADPRSSLA-------EAYRQL-RTSILLSTAGH-A-
A0A353CAT5      E---------DDP---ANSELLIYADSRSSLA-------EAYRQL-RTSILLSTAGH-P-
A0A2V9HB55      ----------GHE---MRIELAAQHLPKSQMS-------EAFRAL-RTSILLSRADH-P-
A0A2V8CU57      TPSDWKTYRFGAV---ASRKTIVDPDVESSLV-------EQYRRL-AASLHHAQLQR-N-
A0A2V8BDI4      TPSDWKTYRFGAV---ASRKTIVDPDVESSLV-------EQYRRL-AASLHHAQLQR-N-
A0A2V8F8T3      TPSDWKTYRFGAV---ASRKTIVDPDVESSLV-------EQYRRL-AASLHHAQLQR-N-
A0A2V9J901      --------------------MAPAIQTHAEVL-------EAFRSL-RTSILLS--ASPV-
A0A2V8MKQ7      ----------------------MVGDARSPVA-------ESYRHL-RTSLLLSS-AGTP-
A0A3M1SNQ5      --------------------------PNSGYC-------EEYRNL-RTHILHES-QKRH-
A0A2V8QJ59      ------------------------------------------------------------
A0A1Q7HTA7      ------------------------------------------------------------
A0A2W0B5E2      ----------------------MAAQATSEQS-------EAYRAL-RTSVLLSV-ASRA-
A0A2V8NMG8      --------------------------------------------------MLST-AGRP-
A0A2V8TBM7      ----------------------------------------------RTSLLLSS-AGQP-
A0A1Q7HEZ8      ---------------------MSLKAPASFAA-------EQYQGL-RITIEQLK-RLRD-
A0A1Q7JW36      ---------------------MSLKAPASFAA-------EQYQGL-RITIEQLK-RLRD-
A0A1Q7MUR4      ---------------------MSLKAPASFAA-------EQYQGL-RITIEQLK-RLRD-
A0A3N5PFU4      ----------------FATQLVSLTNPASFAA-------EQYQNL-RLKIERLR-QTRD-
A0A1F2T1R8      --------------------------PASFAA-------EQYQGL-RLTIERVA-RARD-
A0A2V9BW09      ----------------KRIVAWAD--PHAIGA-------EKFRVL-RYRLQHLR-MARA-
A0A3M1SSE1      ----------------SELLIYDNS-RSSSLS-------EAYRQL-RTSILLSV-AGHA-
A0A2V9GQV7      ----------------AARLVLREDGSLNAAL-------EAYRGL-RTRLMRAQ-SKSG-
A0A2V7YV88      ----------------KRAELVALD-GQSPAS-------EAYKAL-RTNLLFST-IDHE-
A0A2V8YCY6      ------------------------------------------------------------
A0A2V8EGM3      -------------------------------S-------EQFRRL-AATLLQNQ-RGEN-
A0A2V8FGH1      --------------------------VEPGLA-------EQFRRL-AATLLQNQ-RGEN-
A0A2V8D468      ----------------GTHSLINNG-APPNLA-------EAFRAL-RTSVMFSS-AGGR-
A0A1F2R977      ----------------GKLVTGS---MRPVSQ-------EEYRRL-AAVLHQMQ-AEHK-
A0A2U3LF12      ----------------EHRLTVLSD-PQSIAS-------QQYGIL-TLKIQRWR-EQTG-
A0A3N5G7M6      ----------------ARPLLVDRE-ISTGFG-------EAFRAF-RTNVRLSM-LPGG-
A0A1F2S3Q7      ----------------DTLLVSLTA-PASFAA-------EQYQGL-RLAVERLA-RARD-
A0A2V8GVG4      ----------------DQHLVTLTS-PGSFAA-------EQYQGL-RLTIERLR-RGRT-
A0A143PNR5      ----------------GDERMVGAG-LRQAVV-------EEYRKL-ASSLHQAQ-INHR-
A0A2V8PJQ0      ----------------STALAMVED-VRSHVA-------ESYRHL-RTSLLLSS-AGQA-
A0A3N5YKY1      ----------------LLAAALE---FGSPAA-------EQFRAL-RTRIGQVEFGGRD-
A0A2V8H566      --------------------VVARN-INQGVL-------EQYRKL-AASLHYAQ-SQHG-
A0A2V8UVN4      ----------------VETPVLPFDVRDGRAG-------EQYRTA-RTKL--LH-HPRQ-
A0A321LXF5      ----------------QLLLVPQYNLPMQQAM-------EAYQTL-RTRLVKHE-GRHG-
A0A1Q7JFB1      --------------------MVTER-PEQSTI-------EQYRKL-AATLHHAQ-TERQ-
A0A2V8DMJ9      ----------------LVSLV---A-RDSCAA-------DQYRAL-RQTVERLR-RERG-
A0A2V8GGF6      ----------------IVSLV---D-PASFAA-------DQYRSL-RHSIERLR-TDAS-
A0A2V8HKU7      ----------------IVSLV---D-PASFAA-------DQYRSL-RHSIERLR-TDAS-
A0A1Q6Y875      ----------------SLVLF-NEQ-SFDQCA-------EQFRIL-RARLYRLR-EKKP-
A0A2V8DZN4      --------------------ISFRQ-KTSLLA-------ESFRTTLTSILFSQR-NGAY-
A0A2V8I604      ------------------------A-PQSLAA-------EQYRSV-RTRIRQAE-NGRP-
A0A2V8J066      ------------------------A-PQSLAA-------EQYRSL-RTRISRME-NGRA-
A0A1I6MMC5      ----------------QLPAL---G-ERGASV-------EQFRTL-RSRVQEFR-DLGV-
A0A2V9D5W7      ----------------VDVFS-DQG-RSALGA-------EQFRTL-RSRLCQLR-GNRP-
A0A2V9D4I4      ----------------CTVFS-NPA-LSTLCA-------EQFRTL-RSRLYQLR-ASQR-
A0A2V9D6L7      ----------------STIFS-NPA-LSTIGA-------EQFRTL-RSRLYQLR-SSQP-
A0A2V8ZJV2      ----------------NSVFV-NAR-PGQEGS-------ERFRTL-RSRLDKIA-STRK-
A0A2V9AWB5      ----------------NSVFL-NSK-PGEEGP-------ERFRTL-RLRLYKIA-TTRK-
A0A2V8Z1Y8      ----------------SSVFG-DPA-AGHAGA-------EKFSTL-RSRLYQIA-EART-
A0A1Q8AX10      ----------------YAVFC--KQ-SLAVCA-------EQFRTL-RSRLYRLR-DKQP-
A0A2V9A773      ----------------YDVFS-TKQ-SSALCA-------EQFRTL-RSRLYRLR-EKSP-
A0A2V9AND3      ----------------YDVFS-TKQ-SSALCA-------EEFRTL-RSRLYRLR-EKSP-
A0A2V9BTJ7      ----------------MSVFE-GGD-DGHVGA-------ERFRTL-RSRLYQIG-GTRQ-
A0A2V8W2M7      ----------------FSLFHRTDD-DAKIGT-------ERFRTL-RSRLYQIA-AAKQ-
A0A2V8XNW2      ----------------FSLFHRTDD-DAKIGT-------ERFRTL-RSRLYQIA-AAKQ-
A0A1Q7CJC1      ----------------FSLFHRTDD-DAKIGT-------ERFRTL-RSRLYQIA-AAKQ-
A0A2V9UEM7      ----------------TMLFFQE-D-ENRKGA-------EEFRTL-RSRLYQIR-EKLP-
A0A1Q7V300      ----------------TMLFFSG-E-EHLYGM-------EEFRTL-RSRLYQAR-EKHP-
A0A2V9ZCI3      ----------------TMLFFTK-E-DHAPGM-------EEFRTL-RSRLYQLR-EKMP-
A0A2V9WCB3      ----------------SMLFMNG-D-DHARGT-------EEFRTL-RSRLYHLR-EKMT-
A0A2V9VQW5      ----------------TMLFFNP-E-ENALGT-------EQFRTL-RSRLYQMR-EKAS-
A0A2V9WTP3      ----------------TMLFLNG-D-DNARGS-------EEFRTL-RSRLYQIR-EKMT-
A0A2V9NLA9      ----------------TMLFFNG-D-EQGYGT-------EEFRTL-RSRLYQLR-DRLP-
A0A2V9RKJ9      ----------------TMLFFNG-D-EQGYGT-------EEFRTL-RSRLYQLR-DRLP-
A0A2V9RN95      ----------------TMLFFNS-D-EQGYGM-------EEFRTL-RSRLYQMR-EKQS-
A0A2V9N406      ----------------TMLFFNSDD-EQGYGM-------EEFRTL-RSRLYQMR-EKQS-
A0A2V9U6D9      ----------------TMLFFNSED-EQGYGM-------EEFRTL-RSRLYQMR-EKQS-
A0A2G6HQA4      --------------------YSANH-SVDSLT-------EIFKTLRARILLTKK-RNTS-
A0A2V7ZTY7      --------------------VTTDG-LDFSTV-------EQYRKL-AATLHHAQ-VERD-
A0A2V7ZVL9      --------------------VTTDR-LDFSTV-------EQYRKL-AATLHHAQ-VERD-
A0A1Q7QYI4      --------------------VVTER-PEQSTI-------EQYRKL-AATLHHAQ-TERQ-
A0A2V8G9Y9      --------------------IVTPT-VPHAAV-------EQYRKL-AASLHHAQ-LERQ-
A0A143PXU3      --------------------VSAAD-ANPVLI-------EQFRNL-AAALNRLQ-TERT-
A0A2V8D8G9      ----------------IQARLVTGA-LSTVSL-------EQYRRL-AAVLHEDQ-VQRQ-
A0A2V8ESQ4      ----------------IQARLVTGA-LSTVSL-------EQYRRL-AAVLHEDQ-VQRQ-
A0A1E3Y5Q0      --------------------VVDSG-MDAGSR-------EQYRRM-AATLHALQ-AESG-
A0A2W4TWK5      --------------------VIDRE-LDPVSR-------EQYRRL-AMALHAAQ-GTGG-
A0A3N5NYV3      --------------------VVTPS-ISPVSL-------EQYRRL-AATLHRRQ-TESR-
A0A2V2RJF9      ----------------EAIDLLTHYNPTSVAS-------EAFKTV-RTS-LLLSFPETP-
A0A2G6HNT3      ----------------WEKRLYNANYSVDSLT-------EIFKTL-RARILLSKEKNTS-
A0A2V7YWD4      ----------------LDPRLVSFLKPESFEA-------DQYRML-RYA-MERACPSDG-
A0A192WXK4      ----------------ETPDVVMLTQRSSVAA-------ERFRRL-KTR-LVNESKNDE-
A0A2V2R8T6      ----------------VEPHLVAIRQPQSAYA-------EQFRSL-RTR-ILQAGERLQ-
A0A1Q7RGF1      ----------------VGKLLGQFGSGPALEAAE-----ESYRAL-RTR-LLRARSAQG-
A0A2V9BLX2      ----------------VGKLLGQFGSGPALEAAE-----ESYRAL-RTR-LLRARSAQG-
A0A2V9ZA03      ----------------PNPRLVAMMEREGVGA-------EKFRVL-AAR-LQYFRKQRQ-
A0A3N5ZNH4      ----------------EDENSTALLNANELRFRVW----ESYRSL-RTS-ILLSNSGKP-
A0A2V8GEZ2      ----------------VRATIDRLPGKVVLSPDTPSAVVEQYRRL-AAT-LHHAQRDRQ-
A0A3N5ZFD3      ----------------VRERIVTGHAETNGNLAVMTVATEQYRRL-AAT-LHHAQMEKG-
G8NXD3          ----------------LERLPQKHRTTIAFESGADSRACEQFRLM-QHR-LVTARPAGG-
A0A2V9VR38      ----------------RTRHPSQAAVPNGGVL-------PRSAYF-PAA-VEFRRSAQG-
A0A2V9EY04      ----------------DQSSKVAL---------------EAYRAL-RTR-LMRAQSRAG-
A0A2V9HAK9      ----------------DDSLDAAL---------------EAYRGL-RAK-LMRAQSKSG-
A0A1Q7FS15      ----------------GEASRAAL---------------EAYRGL-RTR-LMRAQAKTG-
A0A1Q7K9P1      ----------------GEASRAAL---------------EAYRGL-RTR-LMRAQAKTG-
A0A1Q7N989      ----------------GEASRAAL---------------EAYRGL-RTR-LMRAQAKTG-
A0A2V9G7Y0      ----------------DDFLIAAL---------------EAYRGL-RTR-LMHAQAKSG-
A0A2V8T7Z1      ----------------VEGHVVALTAPGSFEA-------EQYRTL-NLV-LERMQPGRP-
A0A2V7U8G5      ----------------VEDHLACLLSPQSFEA-------DQYRVL-RQF-LTEARGARP-
A0A2V7UNP9      ----------------VEEHLASLLSPYSFEA-------DQYRLL-RQS-V-EQLAAKE-
A0A2V7VLD7      ----------------VEEHLASLLSPYSFEA-------DQYRLL-RQS-V-EQLAAKE-
A0A2V7XGA3      ----------------VDDHLVAVHSPQSFEA-------DQYRIL-RHF-LDQDSGGAK-
A0A2V7YAG6      ----------------LDEHLVSLLNPQSFEA-------DQYRIL-RHF-VDQAKGAVP-
A0A2V7VK33      ----------------LEERLVSLGQPWSLEA-------DQYRML-RCE-IEYLRRSRS-
A0A3M1VTE1      ----------------PTEELVVAREPNCPAA-------EAYLRL-RSA-LLHESDGTP-
A0A2V7TTM7      ----------------VDERLVSLRSPNSFEA-------DQYRVL-RHF-LEAAGAGNS-
A0A2V8VI82      ----------------IDQRLVSLLAPDSFEA-------EQYRTL-RHV-VEERRGE---
A0A2V7U4P9      ----------------PADHLVSLVAPTSFEA-------EQYRIL-RHA-IERRHTDGV-
A0A2V7TQY5      ----------------IDQHLISLLQPRSFEA-------EQYRVL-RHV-IEEGKDG-G-
A0A2V7TU87      ----------------LDERLVSLVAPHSYEA-------EQYRGL-RHL-VEQAHRTSA-
A0A2V8SEH0      ----------------ADEHLVSLLVPNSIEG-------EQYRAL-RHQ-IEQRHKDDG-
A0A2V8VU54      ----------------LDPHLVSLVAPASFEA-------EQYRAL-RSR-LESRPEGRA-
A0A1Q7RML7      ----------------LDRHLVSLVAPASFEA-------EHYRML-RAR-LESRQEGKA-
A0A1Q7ZIQ5      ----------------LDRHLVSLVAPASFEA-------EHYRML-RAR-LESRQEGKA-
A0A2V8TKD8      ----------------LDRHLVSLVAPASFEA-------EHYRML-RAR-IEARQEGKA-
                                                                            

A0A1F2U8T6      PKTMAVTSAQPLEGKTTTACNIALALAYGGM--RVLLIDADLRRPGLHLSLR-LT--NER
A0A2V8BV42      TKTLLVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRPLR-LT--NDR
A0A2V8F916      TKTLLVTSAQPLEGKTTTAANIAMALAYGGS--RVLLIDGDMRRPGLHRPLR-LT--NDR
A0A1Q7K833      TKILVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NER
A0A1Q8AMY4      TKILVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NER
A0A2V8BM40      TKIIAVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRPLR-LT--NER
A0A2V8CRT6      TKIIAVTSAQPLEGKTTTAANMALALAYGGS--RVLLIDADMRRPGLHRPLR-LT--NER
A0A1F2VH76      PKVMAVTSAQPLEGKTTTAVNIAMALAVGGS--RVLLIDADMRRPSVHKALR-MT--NDR
A0A1F2R0X5      TKLMAVTSAQPLEGKTTAACNIAMALAYGGA--RVLLIDADMRRPGLHRTLR-LA--NER
A0A2V8B278      TKIVVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NER
A0A2V8CEF9      TKIVVVTSAQPLEGKTTTAANIAMALAYGGS--RVLLVDADMRRPGLHRPLR-LT--NER
A0A2V8KZG2      -------------GKTTTASNIAISLAQLGG--SVLLIDCDLRKPSIHTAFG-IS--PMP
A0A1Q7LG57      PGVVVLTSPSSGDGKTTVACNLAIAMAEI-GR-KVLLIDGDLRRPRLHKVFG-AP--NNW
A0A2V8YMQ4      PGSLLITSTQPGEGKTTVATNLAISLAQL-GQ-RVLLVDADLRFPSLQRLFC-IR--ENL
A0A1Q7L5B1      LHTLLVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATCLG-VP--GAP
A0A2V9DKV4      LHTLLVTSSLPAEGKSFVSLNLALAMMRQHNR-YVLLVDGDLRAPKLATCLG-VP--GAP
A0A2V8W380      PSSLLVTSTQPADGKTTVACNLAISLAQL-GH-RVLLVDADLRSPSLHKLFG-ID--RSL
A0A2V8ZIV5      PGSLLVTSTQPGEGKTTVATNLALSLAQL-GQ-RVLLVDADLRFPSLQSLFG-MR--EKL
A0A2V9EVA0      FRTLLVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVSLG-TP--SSP
A0A1Q7RB73      LQSLLVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLSLG-AS--RSP
A0A2V9K0H7      LQSLLVTSPLPSEGKTVVAANLAQVLVQQREQ-RVLLVDSDLRYSRMHLSLG-AS--RSP
A0A3N5YN96      CRSLVVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRMFG-VD--NEP
A0A1Q7Y646      MQAFVVTSAGVGEGKTLTALNLAWLLAQTDGV-RALLIDSDLRQPCATEYLG-ID--EPT
A0A2V8QZU0      MQAFVVTSAGVMEGKTLTAINLSWLLAQTDGV-RALLIDGDLRNPCAGDYLG-LD--APT
A0A2V8RSQ9      VQAIVVTSAGIAEGKTITALNLAWLLAQTDGV-RALLVDGDLRQPCAAAYLA-FD--APV
A0A2V9LS17      TRSLLVTSASPREGKSFISSNTAQILARQPDK-RVLLIDADLRWSRLHLFLG-TP--AVP
A0A2V9AGR3      LRRVLITSSLPAEGKSFIAANLAQSLACRQDS-RVLLIDGDLRAPRLHLALC-AP--KSP
A0A2V9G0N7      LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP--STP
A0A2V9GQ44      LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP--STP
A0A2V9HRN3      LKRIVITSSVPAEGKTFVAANLAQSIIRQPDR-RVLLIDADLRASRLHVALG-AP--STP
A0A2V8WG13      LKRVLVTSSVPSEGKTTVAANLAHSIMCQPDR-RVLLIDADLRCSGMHELLG-AP--GGP
A0A2V8X987      LRRLLITSSVAGEGKTFVASNLGQSIVRQPGR-RVLLLDADIRMSRLHVGLG-AP--SRP
A0A1Q7KX94      LQKVLITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVLFG-AP--SCP
A0A2V8XHT0      LQKVLITSGVAAEGKTFVASNLAQSIVQQPEL-RVLLIDADLRSSRLHVLFG-AP--SCP
A0A2V9L2P7      PQLLLVTSAQPHEGKTATSLNLAFTLAQM-GS-RALVVDADLRKRRIARALQ-MS--NEK
A0A2V7UMX0      LRLVAVTSPFAGDGKTTTSINVAATLAQAPGS-RTLLVDCDLRLPAVAKYLR-VEGVDAP
A0A136K497      LKSIVVASVNPSEGKSVTAVNLAWMLAQTDGV-CALIIDSDLRMPSLADYLG-IE--TEK
A0A399W9E4      LQAIVVASANPSEGKSVTAVNLAWMLAQTDGV-RALIIDSDLRMPSLADYLG-IE--TEK
A0A2V7X0V9      LKKLLVTSALPKEGKSFTSSNLAQVLVRQHGR-RVLLIDADLRGPRLHLMLG-TT--AGP
A0A2V9X518      LKKVLITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQALG-TS--STP
A0A2V9VC62      LKKILITSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHTALG-TT--SSP
A0A2V9S1P8      LKKVLVTSALPKEGKSFVAANLAQVMVRQEGR-RALLIDSDLRGSRLHEALG-TS--SSP
A0A2V9RTW2      LKKVLVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHLLG-TS--ATP
A0A2V9TGF1      LKKVLVTSALPKEGKSFVAANLAQVMVRQHGR-QALLIDADLRGARLHHLLG-TS--ATP
A0A2V9XEV6      LKKVLITSALPKEGKTFVAANLAQVMVRQHGR-RALLIDADLRGARLHQALG-TS--STP
A0A2V9Y3Q6      LKKLLITSALPKEGKTFVAANLAQVLVRQHGR-RALLIDADLRGARLHQALG-TN--FTP
A0A2V9R269      LSKLLITSALPKEGKSFTTANLGQVMVRQHGR-RVLLIDADLRNPQLHNQFG-AE--IGP
A0A2V9PTS3      LSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE--PGP
A0A2V9NPF4      LSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE--PGP
A0A2V9PNZ0      LSKLLVTSPLPKEGKSFTAANLAQVIVRQHGK-RALLIDADLRCPQLHVLVG-AE--PGP
A0A321LMC5      RRSLLVTSALEGEGKTTIATNLAWVMARQSGK-KVLLLDADLRRPSICKMLG-LK--SPH
A0A2V8X713      IRILLVTSTLPGEGKTFVALNLALAITRQHER-GALLIDADLRASRLHVRMG-AP--SAP
A0A2V8ZLE9      IRTLLVTSALPGEGKTFVALNLALAIARQHER-KALLIDADLRASSLHARLG-AP--AAP
A0A2V8Y4D3      LRTLVVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRIHVGLG-AP--SAP
A0A2V8Z2X8      IRTLLVTSTLPGEGKTFVALNLALAIARQHEK-RALLIDADLRASRLHVRLG-AP--SAP
A0A2V9C3F6      IRTLLVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVRLG-AP--SAP
A0A2V9QMU9      PKVVVVTSALPSEGKTTTSINTAIVLAQK-GN-RVLLVDADLRRPSIHKTLG-MG--PRT
A0A2V9QY75      PKIILITSALPREGKTTTSVNTAIVLAQK-GT-RVLLIDADLRRPSIHKALG-MG--PRV
A0A2V9SVU9      PKVILITSALPQEGKTTTSINTAIVLAQK-GV-RVLLIDADLRRPSIHKTLG-MG--PKT
A0A2V8W5N5      SYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLALG-AP--MAP
A0A2V8XG53      SYTLLVTSSLPDEGKTFVAQNLSQAIVQKPRQ-RVLMIDADLRYPQLHLALG-AP--MAP
A0A2V9XV04      LKKLLVTSALPKEGKSFTSANLAQVMVRQHGR-RALLIDADLRGPRLHQMLG-AP--KGP
A0A2V9CBY1      IQTLLITSTIAAEGKTFVAMNLAQSIARQRGR-RALLVDADLRASRLHIALG-AP--SAP
A0A2V9D656      IQTLLITSTTAAEGKTFVAMNLAQSIARQPGR-RALLVDADLRASRLHIALG-AP--CAP
A0A352EZH8      MRTFVVTSAGMGEGKTLTALNLAWLLAQSEGV-KALVIDSDLRQPCATNYLA-ID--APR
A0A0B6X033      VQAVVITSAGVLEGKTVTAINLAWLLAQTDGV-RALLIDGDLRRPCALSYLG-LD--RRP
A0A2V8R0I3      MRAFVITSPGVGEGKTLTALNLAWLLAQTDGV-KALLIDADLRQPCAAAYLG-IE--TDC
A0A2V8N1U8      KRAFVVTSAGIGEGKTLTTLNLAWLLAQTDGV-TALVIDADLRQPCAADYLG-IE--TER
A0A2V8QL35      KRAFVITSAGQGEGKTLTALNLGWLLAQTDGA-TALLIDADLRQPCAAEYLG-IQ--TEV
A0A352FU10      KHAFVVTSAGMGEGKTLTALNLAWLLAQTDGA-TALLIDADLRQPCAAEYLG-IQ--TEC
A0A2V8LCU0      KRAFVITSAGMGEGKTLTALNLAWLLAQTDGV-SALVIDADLRQPCAAEYLG-IE--TEV
A0A1Q7NGT0      MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADYLG-IE--TDC
A0A2V8MLP9      MRAFVITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADYLG-IE--TDC
A0A2V8PQZ0      MRAFVITSAGIGEGKTLTALNLAWLLAQTDGV-KALVIDADLRQPCAADYLG-IQ--TDC
A0A3B9MKY6      MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEYLG-ID--API
A0A3D5SKZ1      MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDSDLRQPCATEYLG-ID--API
A0A2V8NRW2      MQAFVVTSAGVAEGKTLTALNLAWLLAQTDGV-RALIIDSDLRNPCAADYLG-IE--DAI
A0A2V8TKR9      PKIVLVTSAQPGEGKSTTVVNTAISLAQLGS--SVLIIDCDLRRPSTHKILG-IN--PAE
A0A2V8LBV1      PHVLVITSTSPRDGKSTIASNLAVALAE-TKR-RILLIDADLRRPHLHTVFE-MDNR--W
A0A2V8GAF9      LQVLAVTSPGPGDGKSVTALNVAGALAQSPHA-QILIVDADLRRPTVAEYLG-LGSQRSP
A0A2V8CN98      PLVVTITSPGPGDGKSFVSANLALACAQ-AGQ-RTLLIDGDTRRGALHRVLG-AVRR--P
A0A1Q7LC46      PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRLLN-LGTGKYA
A0A1Q8BDC5      LKVLTVSSPDPRDGKSLISSALAFSFSMDPGR-RVIIVDCDLRNPSLDGYLG-VTPE--P
A0A2V9Q1Y8      PKTILITSALPQEGKTTTSINTATVLAQ-KGT-RVLLIDADLRRPSIHKTLG-MGPR--A
A0A2V8JXG1      PKTILVTSVRMEEGKTTTATNTAIALAQ-LGA-SVLLIDCDMRKPSVHDVFG-TSRT--L
A0A350D2W9      LKTIMVTSPLPEEGKSATISNLAVSLAQ-TGK-KILLIDADLRRPKQHQIFK-MKNH--E
A0A2V9I4J1      VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VSVE--P
A0A2V8PQZ9      MRAFVITSAGVGEGKTLTALNLAWLLAQTDGV-RALVIDADLRQPCAADYLG-IETD--C
A0A2V8D8B1      TQSICITSSGPGEGKTLVGSNLAVALGQ-TGQ-RVLLIDADMRRPRVHEVFE-MAQE--P
A0A3B9LSB4      PRSLLVTSSLPGEGKTTTAVNTAVSLAQ-TGA-SVVIIDADMRRPRLRSIFG-LSDR--A
A0A2V9H7U2      PQVLLITSATAREGKSTTALNLAIALAQ-RGD-STLIIDADLRRPGIAESLD-IDDG--E
A0A2V8NJB5      AQVMIVSSPENGDGKSLVSANLALSYSLEVAR-RVIIVDCDLRNPSLHRYLG-VTEG--P
A0A2V9JMZ4      VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VSVE--P
A0A2V9MDJ6      VQTIAISSPRPQDGKSLIAVNLAFCLAQDLDR-RVILVDGDLRNPTVNRYLG-VSVE--P
A0A2V8QJT6      PKTLLVTSSLPGEGKTTTAVNTAISLAQ-TGA-SVVIIDGDMRRPRLRSIFD-LPER--E
A0A2V8FSM8      PRVLVLTSASPKEGKTTVVSNLAITVAE-IRR-RVLVIDADMRRPRLHKVFS-VDND--H
A0A359M0J2      PGLVLVTSPSPGEGKTTIAANLGVAMAE-VNR-RTVVIDMDLRRPSLHNTFGSIPEV--D
A0A2V8JLJ1      LKTILISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTVLG-TPSREGK
A0A2V9GAQ1      PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKSGIGRLLN-LASGNYA
G8NS05          PKVILLTSATPSEGKTTVSTNLACVFAQ-RDV-RVLLIDADLRRPTVHHRLG-LNGK--V
A0A2V8KZ20      LKTILISSSGAGEGKTFSACCIAGMLAQEPGK-QVLLIDADLRRSTATTVLG-TPSREGK
A0A3D0NWU2      PQSILVTSSQPSEGKTTTAINTAITLAQ-ADV-DVVIVDCDLRRPRIHNYFD-LENS--E
A0A2V8EPD9      LKVIMTSSAMPGEGKSLTSVNLALTLSDSYRK-RVLLIDVDLRRPTVQRIFG-LPPV--G
A0A3N5NSX5      TRVIALTSAQPLEGKTTTACNMAIALAY-GGS-RVLLIDADMRRPSVSRTLG-IENN--V
A0A2V8MUA1      LSRILIASAIPNEGKTFSACCLAGILAQEPRK-RVLLIDADVRTGSISHTLGIIDAGRGK
A0A2V8MBH9      PKTLLITSSLPGEGKTTTAVNTAITLAQ-TGA-SVVIIDADMRRPRLRSIFD-LPER--E
A0A3N5ZPQ7      HKVITVTSPHIQDGKSLVSANLAFSFARDSGT-RTILVDCDLRRPSLHRYLG-IPPE--P
A0A3N5P5F2      CRRLVVTSTAPREGKSVVASNLAAGLAM-AGH-RVVLIDADMRRPRVHAIFD-VELS--P
A0A2V9G1P7      PSSLLVTSTQPAEGKTTVACNLAISLAQ-LGH-RVLLLDADLRYPSLHKLFG-TSGS--L
A0A2V9BCK9      VRTLLVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVRMG-APSA--P
A0A2V9TMX2      PKVILVTSAMPREGKTTISANSALVLAQ-RGS-RVLLVDADLRRPGVEKLFG-IRAH--G
A0A2V8N2J7      AKTVIVTSAAGGEGKSLTAINVAMALAAATDG-RVLLMDADMRKPRIGEYLK-LSVPTDK
A0A3N6BI26      PKVIMVTSSVPGEGKTTTVANTGIVLAQ-TGA-RTLLIDLDMRKPALASTFG-YNGN--Q
A0A2V9JMM3      SRVLTVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEYLG-IEPR--P
A0A2V9M815      SRVLTVTSASGGEGKTLTAVNLSFALAESGLG-KVLLLDADLRKPRTHEYLG-IEPR--P
A0A2V9A795      PGSLLITSTQPGEGKTTIATNLAISLAQ-LGQ-RVLLVDADLRFPSLQRLFC-IREG--L
A0A355ESH9      LKVVAVTSAMAGEGKTATASNLAVVLAQ-LGR-PVVIIDCDLRKPRIHQVFK-LSNR--S
A0A3D0NW85      PKSLLVTSSLPSEGKTTTATNTAISLAQ-TGA-KVLIIDADMRRPRLHSVFG-VSNG--E
A0A353CAT5      PKSLLITSSLPSEGKTTTATNTAISLAQ-TGA-RVLIIDADMRRPRLHSVFN-ITNG--I
A0A2V9HB55      PQVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVIVDADLRKPGIGRLLN-LGGGKYA
A0A2V8CU57      VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IAND--T
A0A2V8BDI4      VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IAND--T
A0A2V8F8T3      VRTVMITSAVAAEGKTLTATNLALTLSHSYKR-RVLLIDADLRRPTVHEAFR-IAND--T
A0A2V9J901      PRVILITSALPGEGKTTTAVNLGAALASFGS--KVVVIDCDMRRPSCHRSVG-VK--NSP
A0A2V8MKQ7      PRTILVTSSQPSEGKTTTAINTAFMLAQTGA--EVLIIDGDLRRPRLHAHFN-IP--NVR
A0A3M1SNQ5      LKVITITSINPNEGKSITALNLAWLLAQTDGI-STLLIDADLRNPSLASYLG-IE--PDK
A0A2V8QJ59      ----LVTSSQPSEGKTTTAINTAFILAQTGA--EILLIDCDLRRPRLHVHFN-IS--NAR
A0A1Q7HTA7      -----MTSATSGEGKTTTAINLAAAMAQDAEA-RVLLVDADLRAPSVAPLLG-LGD-SLP
A0A2W0B5E2      PQTVLITSAKIGEGKSSTALNLAMALAQCGS--SVVLLDCDLRKPVLARLLG-IQ--NER
A0A2V8NMG8      PQTLLITSSVPSEGKTTTSINTAISLAQTGA--NVLIIDADMRRPRLHSIFD-VE--NRN
A0A2V8TBM7      PKTVLVTSSQPSEGKTTTVVNIATMLAQTGA--DVLVLDCDLRRPRVHAHFG-LP--NSR
A0A1Q7HEZ8      VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IGAADPR
A0A1Q7JW36      VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IGAADPR
A0A1Q7MUR4      VRLIAVTSPSAGDGKTVTALNLAGVLACGSDA-RVLLIDADLRRPTVAARLG-IGAADPR
A0A3N5PFU4      LRVIAVTSPGAADGKTVTSINLAGALARGAAA-RVLLVDADLRRPQVADHLH-I-PQGAA
A0A1F2T1R8      VKIIAITSPAAGDGKTVTAVNLAGALARGSDG-RVLLIDADLRRPSVATLLG-IET-TGP
A0A2V9BW09      LSKVLVTSAIPREGKTVVATNLAFTLARSSS--HVLLVDADLRLSAVHQMLG-IP--PMA
A0A3M1SSE1      PKSLLVTSSLPAEGKTTTAVNTAITLAQTGA--KVLVIDADMRRPRIHSIFN-IS--NRE
A0A2V9GQV7      LHSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRAHGLTSMLD-HP--NSP
A0A2V7YV88      LKTIVLTSAAPGEGKSRTASNLAIALAHAGQ--RTLLIDADFRRPSLHRIFG-RI--RNV
A0A2V8YCY6      -QVILVTSALPREGKTTAAANLAVTLAQ-LGD-STVLVDADLRKPGIGRLLN-LGTGKYA
A0A2V8EGM3      IRSVMITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAATN-LAKAE--
A0A2V8FGH1      IRSVMITSAVPADGKTLTALNLSLILSESYKR-RVLLIDGDLRRPTISAATN-LAKAE--
A0A2V8D468      APTILVTSTGPGEGKTMTSCNLAVSIAQTRQ--RVLLIDADMRRPRVHEVFD-VE--QEP
A0A1F2R977      VKTLMVTSALPREGKTLTVTNLALTLSEYFGR-RVLLIDGDLRHPSIHEILG-LP--NTT
A0A2U3LF12      GRVLVVTSAAGGEGKSLTALNLSMALASSVEG-RVLLVDCDLRRPQVHERLG-LK--DPS
A0A3N5G7M6      MRSVVVTSACAGDGKTLVASNLAVALALAEH--RVLLIDADLRRPTLHTAFN-VK--SEP
A0A1F2S3Q7      VRTIAVSSPAAGDGKTVTAINLAGTLARGSDD-RVLLVDADLRRPSVASLLA-IPG-GGL
A0A2V8GVG4      LQVIAVTSPAAGEGKTLTAINLAGALARGADDARVLLIDADLRRPAVAKQLA-IDE-LSQ
A0A143PNR5      LQVVLVASAVPGEGKSLTAANVALTLTTSYSR-KVLLIDADLRRPSLHGLFR-AP--ETS
A0A2V8PJQ0      PKTILVTSSQPSEGKTTTAINTAFMLAQT-GA-EVLIIDCDLRRPRLHSNFN-IS--NVR
A0A3N5YKY1      CRSLVVTSPMPGDGKTVTSANLALSMAQEFHR-KVLIIDADLRKGALHRMFG-VD--NEP
A0A2V8H566      TRVLMMTSTLASEGKTLTATNLALTLSESYRR-RVLLIDADLRRPTIHDMFD-LP--NVS
A0A2V8UVN4      PRLVVISSAGSGDGKTVTSINLAGAMSLKTEA-EILLIDADLRKAQIAPLLG-IS--GEP
A0A321LXF5      MRSLVISSAAPGDGKTLTAFNMALCFARIQNW-PVLLVDADLRTQGMSSLLG-RA--GAA
A0A1Q7JFB1      LKVVMVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEVFQ-VK--NVT
A0A2V8DMJ9      FQVIGVTSPCPGDGKTVTTLNLAGALAQSPDS-RVLVVDADLRRPSVAEYLA-LPRTSFP
A0A2V8GGF6      SRVLAITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEYLG-LEARRSP
A0A2V8HKU7      SRVLAITSPGPGDGKTLTTLNLAGALAQCRDL-RVLVIDADLRRPAVSEYLG-LEARRSP
A0A1Q6Y875      FRTLLVTSAQAGEGKSFVSLNLARAIVHQHER-HALLIDADLRAPKLHVSLG-AP--SSP
A0A2V8DZN4      PRVLVLTSASPKEGKTTVVSNLAITVA-EIRR-RVLVIDADMRRPRLHKVFS-VD--NDH
A0A2V8I604      LRAILVTSPGKGDGKSLTAANLALTMAQEFQQ-RVLLVDSDLRRPTVHRLFG-LQ--QSP
A0A2V8J066      VRVLIVTSPAKGDGKSLTAANLALAMAEEFSQ-RVLLIDADLRRPSVHHLFD-LP--EAP
A0A1I6MMC5      LKTVLVSSGLPGEGKSFVSANLAISLARRKQN-RVLLIDGDMRRSSLHKLLG-AP--CEP
A0A2V9D5W7      VRTILITSAVAGEGKTFVAFNLAQAIVRQPDQ-RVLIIDADLRCSRLHGIFG-AP--NAL
A0A2V9D4I4      LGTILITSAVPGEGKTFVAANLAQAIVRQAER-RVLIIDADLRSSHLHRMLG-AP--AAP
A0A2V9D6L7      LRTILVTSAVAGEGKTFVVANLAEAIGRQRDR-RVLIIDADLRASRLHLMVG-AS--AAP
A0A2V8ZJV2      LKRVLLTSAVAGEGKTFVAFNLAQSIAQQPDL-RVLLVDADLRSPRLHHLFG-AP--ICP
A0A2V9AWB5      LKRVLITSGVASEGKTFVASNLAQSIAQQPEL-RVLLIDADLRSSQLHVVFG-TQ--GRP
A0A2V8Z1Y8      LRRLLLTSTVAGEGKTFVAANLAQAIIREPER-RVLLLDADLRVPQLHAVLG-AP--SSP
A0A1Q8AX10      VRTLLVTSAVPGEGKTFVSLNLALAIARQHER-RALLIDGDLRASRLHVRMG-AP--SAP
A0A2V9A773      IRTLLVTSTLPGEGKTFVALNLALAIARQHER-RALLIDADLRASRLHVRLG-AP--SAP
A0A2V9AND3      IRTLLVTSTLPGEGKTFVALNLALAIARQPER-RALVIDADLRASRLHVRLG-AP--SAP
A0A2V9BTJ7      LRRVVVTSSLPAEGKTFVAANLAQSIVRQPDR-KVLLIDADLRASRLHQLLG-AP--RSP
A0A2V8W2M7      LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP--TSP
A0A2V8XNW2      LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP--TSP
A0A1Q7CJC1      LRKVLVTSSVPNEGKTFVAANLAQSIVHQPDR-RVLLIDADLRAPLLHVTLG-AP--TSP
A0A2V9UEM7      LKRLMVTSALPKEGKSFVAANLAQVMVRQHGR-RVLVIDADLRSPGMHRHLG-AS--QTP
A0A1Q7V300      LSKVLVTSPLPKEGKSFVTANLGQVLVRQQGK-RVLLIDADLRNPHLHSTLG-AE--SGP
A0A2V9ZCI3      LKKILISSSLPKEGKSFVAANLAQVMVKQHGR-RVLLIDGDLRGSRLHQTLG-CP--NTP
A0A2V9WCB3      LRTVLVTSALPKEGKSFTSANLAQVLVRQHGR-RVLLIDADLRGPRLHLMLG-TP--MGP
A0A2V9VQW5      VKKILVTSALPQEGKSFVAANLAQVLVRQHGR-RVLLIDGDLRVARLHSALG-TT--SSP
A0A2V9WTP3      LKKILVTSALPKEGKSFTAANLAQVMVRQHGR-RVLLIDADLRGPRLHLMLG-TS--SAP
A0A2V9NLA9      LKKVLVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNALG-TE--SSP
A0A2V9RKJ9      LKKVLVTSALPKEGKSFVAANLAQVLVQQQGR-RTLLIDGDLRGARLHNALG-TE--SSP
A0A2V9RN95      LKKILVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA--SSP
A0A2V9N406      LKKVLVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA--SSP
A0A2V9U6D9      LKKILVTSSLPKEGKSFVAANLAQVMVRQQGR-RALLIDGDLRGPRLHQVLG-TA--SSP
A0A2G6HQA4      AGTIMVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIKKLFG-RD--EDF
A0A2V7ZTY7      LKVVMVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRVFQ-LK--NAG
A0A2V7ZVL9      LKVVMVSSAVSGDGKTLTSTNLALTLSESYHR-RVLLIDADLRRPSVHRVFQ-LK--NAG
A0A1Q7QYI4      LKVVMVSSAVSGDGKTLTSTNLALTLSESYRR-RVLLIDADLRRPSVHEVFQ-VK--NVT
A0A2V8G9Y9      IKVVMITSAAPGEGKTLTSTNLALTLSQSYRR-NVLLIDGDLRRPSVHSVFD-VP--NVL
A0A143PXU3      LKSLLVTSPAPGDGKSHVAVNLALTLSESYRR-KVLLVDADMRRPTLHHLFH-VS--GAH
A0A2V8D8G9      LKTVMITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTVLD-IP--NDR
A0A2V8ESQ4      LKTVMITSALPQEGKTLTLVNLALTLSESYAR-RVLVIDADLRWPGLHTVLD-IP--NDR
A0A1E3Y5Q0      LRVITVASAMPGEGKTLTAANLALTLSESYQR-KVLLIDGDLRKPSQHAVFG-LP--VSP
A0A2W4TWK5      VKVIAVSSALANEGKSLTASNLAMTLSESYQK-RVLLIDGDLRRPSLQQIFG-LP--GEG
A0A3N5NYV3      IKTVLVASTMAGEGKTLTAVNLALTFSESYGR-NVLLIDGDLRRPTTHAVLE-VP--NIL
A0A2V2RJF9      PHTILITSSRPGEGKTFVACNLAISLAQ-LDK-RVVLIDGDMRNPRVHRVWGI---RNDT
A0A2G6HNT3      AGTIMVTSAMPGEGKSFVAANLSLAFASGLDQ-YVLLVDGDLRRPSIQTLFGR---KENF
A0A2V7YWD4      SRVIAITSPISGDGKTLTAVNLAGTIARGGQS-RVLMVDADLRRPSLAKVLGHSNVHRGW
A0A192WXK4      -RVLSITSAAPDEGKSFVSLNLSMAFGA-ENP-STLLIDADLRRPSIQRWITP---TPTI
A0A2V2R8T6      MRAFVITSAGIGEGKTLTALNLAWLLAQAEGV-RALIIDSDLRHPCAADYLGI---DAPV
A0A1Q7RGF1      LRSVVVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRTLGF---PPGP
A0A2V9BLX2      LRSVVVTSATPGEGKTLTSLNLSLCCAQLHDL-RVLLIDADIRTSGLSRTLGF---PPGP
A0A2V9ZA03      LKKVVITSTIKGEGKSVVSANLAVTLAR--RQ-RTLLIDGDLRQSGLRELLTT---HGLP
A0A3N5ZNH4      PRTILVTSSIPGEGKTTTVANIGIVLAQ-TGA-RTLLVDLDMRKPALDDKFNC---RGEK
A0A2V8GEZ2      AKVLMISSAMPGEGKTLTATNLALTLTESFRR-RVLVIDADLRRPSMHHTFGL---PNNT
A0A3N5ZFD3      LKIVMVVSSMAGEGKTLTATNLALTLSESYQR-QVLLVDADLRRPSLHRVFGL---PNAT
G8NXD3          --VVLITSPSAEDGKSLNCQNLAWALAE-AGH-KTLLLDLDLRRPSLLAALG----GVCP
A0A2V9VR38      Y---------PQEGKTTTSINCAVVLAQ-KGV-RVLLIDADLRRPSIHKTLGM---GPHS
A0A2V9EY04      VKTIAITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTALLDH---PCTL
A0A2V9HAK9      LRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTSMIDH---PSSP
A0A1Q7FS15      LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH---PSTP
A0A1Q7K9P1      LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH---PSTP
A0A1Q7N989      LKSIVVTSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDADLRTCGLTSMLDH---PSTP
A0A2V9G7Y0      LRSIVITSSLPGEGKTLTTMNLGLCYAQLPQQ-RVLVIDGDMRTRGLTAMLDH---PNSP
A0A2V8T7Z1      LRVIAVSSPAVGDGKTTTTVNLAVTMAQNPAA-RVLLVDADVRRPAVGRKLGLGK-VRLP
A0A2V7U8G5      LRILAVTSPAAGDGKTTTSINLAATLAQTPGS-RVLLVDTDLRRPFVATNLGL-S-PDRP
A0A2V7UNP9      RKVIAITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAANLGL-D-MDAP
A0A2V7VLD7      RKVIAITSPAAGDGKTTTAINLAATLAQSSRS-RVLLVDTDLRRPFVAANLGL-D-MDAP
A0A2V7XGA3      RQVLAVTSPTAGDGKTTTAVNLAVTLAQSPGA-RVVLIDADLRRPFVATSLGLDD-RRGP
A0A2V7YAG6      RQVLAVTSPTAGDGKTTTAVNLAATLSQLPGA-RVLLMDTDLRRPFVAAGLGLED-GSAP
A0A2V7VK33      LSIIAVTSPDVGDGKTTTSVNLAGTLSQDPGT-RVLLVDADLRRPSAAPLLGFGDRGDGP
A0A3M1VTE1      PRVIVVTSGMPQEGKSLTAVNLALAFAACGDE-RVLLVDGDLRRGGLARFL--EP-APRA
A0A2V7TTM7      AQVLAVSSAAAGEGKTTTAINLAATLAQSPDM-RVLLMDTDLRRPSVASNLALGS-SAGT
A0A2V8VI82      MSVIAVTSAAAGEGKTTTAINLAAALAQDAES-RILLVDADLRVPSAGRLLGLGD-DL-P
A0A2V7U4P9      ATTTAVTSPSGGEGKTTTAINLAGALAQAADQ-RVLLVDADLRRPGVAAQLRIAS-TA-P
A0A2V7TQY5      LNVIAVSSATVGDGKTTTSINLAGTLAQNTTA-RVLLIDVDLRRGSVAAGLRLRA-PEAN
A0A2V7TU87      LSVLAVSSATVGDGKTTTAINLAGALAQAADA-RVLLMDVDLRRPAIAERLGLEE-GR-H
A0A2V8SEH0      LTVVAISSPTPADGKTTTAINLAGALAQDPQA-RVLLVDGDLRVPSVSEQLGLGE-VAGP
A0A2V8VU54      LQVLAVTSAVVGDGKTTTAINLAGSLAQARDA-RVLLVDADLRRASAGLQLGLED-PRGA
A0A1Q7RML7      LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD-PRGA
A0A1Q7ZIQ5      LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD-PRGA
A0A2V8TKD8      LQVIAVTSATIGDGKTTTAINLAGALAQAREA-RVLLVDADLRRPSVALQLGLDD-PRGS
                             **:      .            :::* * *                 

A0A1F2U8T6      GLSHVLGG-----RARLRDV----IQR--------TV-DLNLFAIT----AGPTPSEPS-
A0A2V8BV42      GLSQVLIG-----QARVRDV----IQR--------TV-DPNLLAIT----AGKMPPNPS-
A0A2V8F916      GLSQVLIG-----QARVRDV----IQR--------TV-DPNLLAIT----AGKMPPNPS-
A0A1Q7K833      GLSQVLIG-----QARVRDV----IQR--------TV-DPNLLAIT----AGRTPPNPS-
A0A1Q8AMY4      GLSQVLIG-----QARVRDV----IQR--------TV-DPNLLAIT----AGRTPPNPS-
A0A2V8BM40      GLCQVLMG-----QARVRDV----IQR--------TV-DPNLLAIT----AGSTPPNPS-
A0A2V8CRT6      GLCQVLMG-----QARVRDV----IQR--------TV-DPNLLAIT----AGSTPPNPS-
A0A1F2VH76      GLSQLLAG-----QARMREV----VQR--------TH-DPNLLVIT----AGRTPANPS-
A0A1F2R0X5      GLSQVLVG-----QARVRDV----IQR--------TV-DPNLLAIT----AGRPPSNPS-
A0A2V8B278      GLSQVLIG-----QARVRDV----IQR--------TV-DPNLLAIT----AGRTPPNPS-
A0A2V8CEF9      GLSQVLIG-----QARVRDV----IQR--------TV-DPNLLAIT----AGRTPPNPS-
A0A2V8KZG2      GLSTYLAQ-----NGKIDDL----IHHA----------SENLYLMP----AGPTPPNPA-
A0A1Q7LG57      GLSDVLWG-----DTPLETLPISHLVR--------ETEVAGLSLLP----GGSCGITPT-
A0A2V8YMQ4      GLVSYLTG-----QEDWRTA----VCP--------SG-SPGLDLLP----CGPVPPNPA-
A0A1Q7L5B1      GLTEFLQG-----AADASSI----IQT--------DT-EGKLFFIS----AGSAVSNPT-
A0A2V9DKV4      GLTEFLQG-----AADASSI----IQT--------DT-EGKLFFIS----AGSAVSNPT-
A0A2V8W380      GLVSYLTG-----QQDWRAV----VHP--------SG-SRGLDLLL----CGPVPPNPS-
A0A2V8ZIV5      GLVSYLTG-----QQDWREA----VRP--------SG-SPGLDLLL----CGPVPPNPA-
A0A2V9EVA0      GLSDYLRG-----DADEFSI----IQS--------GT-GENLFFIP----AGRPVSNPT-
A0A1Q7RB73      GLSDYLSG-----AKDELAI----LQR--------GP-LENLFFIA----GGKAASNPT-
A0A2V9K0H7      GLSDYLSG-----AKDELAI----LQR--------GP-LENLFFIA----GGKAASNPT-
A0A3N5YN96      GLTDVLAG-----DVPLEEA----LIW--------IP-EYRLTLLP----AGRPTNQPT-
A0A1Q7Y646      GLSEVLAG-----TATLEES----IIR--------LE-PAGLYLLP----GGEPRDDVA-
A0A2V8QZU0      GLSEVLAG-----EATLAES----IVR--------LE-PAGLHLLP----GGAARDDVA-
A0A2V8RSQ9      GLSEVLAG-----QASLNDT----IVR--------LD-PSGLFLLP----GGTPRDNVA-
A0A2V9LS17      GLAEYLSG-----EANELSV----IQR--------GP-LENLYFIP----GGKHPANPA-
A0A2V9AGR3      GLTNCVRG-----ETDEFSV----IQI--------GA-QSNLAFLP----SGDAVADPA-
A0A2V9G0N7      GLTDYLRG-----EVDEYAI----IQS--------GP-DENLCFIP----GGNDVSNPS-
A0A2V9GQ44      GLTDYLRG-----EVDEYAI----IQS--------GP-DENLCFIP----GGNDVSNPS-
A0A2V9HRN3      GLTDYLRG-----EVDEYAI----IQS--------GP-DENLCFIP----GGKDVSNPS-
A0A2V8WG13      GLTDYLRG-----EAEKEAV----IQN--------GL-EGNLCFIP----GGSEVSNPS-
A0A2V8X987      GLTEYLRG-----EADEYSI----IQK--------GM-EGNLFLIP----GGSPVFNPS-
A0A1Q7KX94      GLSDYLRG-----DADEYAV----IQK--------GT-KENLFLIP----GGSLVSNPS-
A0A2V8XHT0      GLSDYLRG-----DADEYAV----IQK--------GT-KENLFLIP----GGSLVSNPS-
A0A2V9L2P7      GLSGILTG-----GYGLQEA----LLR--------VEDIEGLWVLS----SGPNPPNPA-
A0A2V7UMX0      GLSEAVQA-----RLGLDAV----MQR--------CPPRVDLWLLT----AGRPPEDPY-
A0A136K497      GLSDILTG-----DANFKDT----IVK--------LE-PSGLYLLA----GGAARPDVA-
A0A399W9E4      GLSDILTS-----DARLQDT----IVK--------LE-PSGLYLLA----GGTARPDVA-
A0A2V7X0V9      GLSEYLQG-----KNDEFSI----MQR--------GP-LENLFFIP----SGTGIEDPA-
A0A2V9X518      GLSEYLLG-----ES---------VQR--------GP-MENLFFIP----SGRTVSNPA-
A0A2V9VC62      GLADYLLG-----ESDEFSI----MQR--------GP-MENLFFLP----CGRTVAHPA-
A0A2V9S1P8      GLSDYLLG-----EKDEFAV----MQR--------GS-MENLFFIP----SGRSIGNPA-
A0A2V9RTW2      GLAEYLLG-----ENDEFGI----MQR--------GA-MENLFFIP----SGRSVSNPA-
A0A2V9TGF1      GLAEYLLG-----ENDEFGI----MQR--------GA-MENLFFIP----SGRSVSNPA-
A0A2V9XEV6      GLSEYLLG-----ESDEFSV----MQR--------GP-MENLFFIP----SGRTVSNPA-
A0A2V9Y3Q6      GLSEYLLG-----ESDEFSI----MQR--------GP-MENLFFVP----SGRTVSSPA-
A0A2V9R269      GLGDYLRD-----EADEYSI----IQR--------GS-MENLFLIP----AGRISPNPA-
A0A2V9PTS3      GLSEYLAS-----ESDEFSI----LQR--------GP-MENLFLIA----AGHRSQNPA-
A0A2V9NPF4      GLSEYLAS-----ESDEFSI----LQR--------GP-MENLFLIA----AGHRSQNPA-
A0A2V9PNZ0      GLSEYLAS-----ESDEFSI----LQR--------GP-MENLFLIA----AGHRSQNPA-
A0A321LMC5      GLVDVIER-----RAAVSDS----IVA--------IK-PHGMYVLADRSNGDIPNLSAG-
A0A2V8X713      GLSDYLNG-----RADEFSV----LQA--------DA-KADLFLIP----AGRFVPNPA-
A0A2V8ZLE9      GLSDFLGA-----KVDEFSI----LQA--------DP-KFELFFVP----AGRPVPNPS-
A0A2V8Y4D3      GLSDYLSG-----KADEFSI----LQA--------DP-KVELFLVP----AGKPVPNPS-
A0A2V8Z2X8      GLSDYLSG-----HADEFSI----LQA--------DP-KVELFLVP----AGRPAPNPS-
A0A2V9C3F6      GLSDYLSG-----RADEFSI----LQA--------DP-KVELFLVP----AGRSAPNPS-
A0A2V9QMU9      GLSSVLTG-----SANVQQT----IVR--------SALLPSLFILP----AGPPPPNPA-
A0A2V9QY75      GLSNVLTG-----GATSQQA----TVR--------SPILPNLFILP----AGTPPPNPA-
A0A2V9SVU9      GLSNVLTG-----NATLQQA----TVR--------SSILPGLFILP----AGTPPPNPA-
A0A2V8W5N5      GLTDYLRG-----EADEMAA----IQY--------SD-NENLCFMP----GGKQVTNPS-
A0A2V8XG53      GLTDYLRG-----EADEMAA----IQY--------SD-NENLCFMP----GGKQVTNPS-
A0A2V9XV04      GLAEYLLG-----KADEASV----IQR--------GP-MEGLFFMA----SGESIEDPA-
A0A2V9CBY1      GLSDYLAG-----ESDESAV----IQA--------GA-QEGLFFIP----GGKPRSNPA-
A0A2V9D656      GLSDYLAG-----ESDECSI----IQA--------DS-QEGLFFIP----GGKPRSNPA-
A0A352EZH8      GLSEILGG-----ELSLRDA----IVR--------LD-PAGLYLLP----GGQAREDVA-
A0A0B6X033      GLSEVLAG-----EAELDAT----IVR--------LE-PAGLYLLP----GGSERNDVA-
A0A2V8R0I3      GLSEVLTG-----VTRLTEA----ILK--------LN-PAGLHVLP----GGASREDVA-
A0A2V8N1U8      GLSEVLTG-----ETRLAEA----IVR--------LN-PAGLHVLP----GGAAREDVA-
A0A2V8QL35      GLSEVLTG-----ETKLTQA----ILK--------LE-PSGLHLLP----GGAAREDVA-
A0A352FU10      GLSEVLTG-----ETKLTQA----ILK--------LE-PSGLHLLP----GGAAREDVA-
A0A2V8LCU0      GLSEVLTG-----ETKLTEA----IVK--------LK-PSGLHLLP----GGAAREDVA-
A0A1Q7NGT0      GLSEVLTG-----ETKLLEA----IVK--------LQ-PSGLHLLP----GGAAREDVA-
A0A2V8MLP9      GLSEVLTG-----ETKLLEA----IVR--------LR-PSGLHLLP----GGAAREDVA-
A0A2V8PQZ0      GLSEVLTG-----ETKLLEA----IVR--------LR-PSGLHLLP----GGAAREDVA-
A0A3B9MKY6      GLSEVLGG-----AVRPEEA----IVR--------LD-PAGLYLLP----GGKARDDVA-
A0A3D5SKZ1      GLSEVLGG-----AVRPEEA----IVR--------LD-PAGLYLLP----GGKARDDVA-
A0A2V8NRW2      GLSDVLSG-----EATLEEA----ILH--------LN-PSGLYMMP----GGEARDDVA-
A0A2V8TKR9      GLSSYLTR-----NIGIDRL----IHK--------LQ-IPNLSLLP----CGPIPPNPA-
A0A2V8LBV1      GLTDILQADIEIQEYPLEML----VQQ--------TV-VPNVYITG----SGSGRESSV-
A0A2V8GAF9      GLVEAILD----PQYTLQRV----VRR--------LE-GFNLSVLP----AGTPQSTPY-
A0A2V8CN98      GLTDFLA-----GHVSFEGL----IQT--------LK-FGSLQFIG----GGSRIRESP-
A0A1Q7LC46      GLSSYLA-----GVSSLDLV----SVP-------HPA-IPNLVAIP----TGPLPPNPA-
A0A1Q8BDC5      GLLQYL------ASTNMSPY----CYV--------RR-IESLYFLT----VGGVATNSI-
A0A2V9Q1Y8      GLSNVLT-----GGTTLQQA----TVR-------STL-LPNLFILP----AGTPPPNPA-
A0A2V8JXG1      GLSTYLA-----RNVEIDEL----IQD--------LP-GENLRMIS----SGPIPPNPA-
A0A350D2W9      GLTSYL------ALDLPVQK----LIK-------PTM-VPSLYLIN----SGPIPPNPA-
A0A2V9I4J1      GLSGYL------ENGHLQPY----CYM--------RR-FKNLYIMT----AGGVCTNPV-
A0A2V8PQZ9      GLSEVLT-----GETKLLEA----IVK--------LQ-PSGLHLLP----GGAAREDVA-
A0A2V8D8B1      GLSNLLV-----GDTKTAEA----VKQ--------TR-SKGLWVLP----AGRIPPNPA-
A0A3B9LSB4      GLSSILSSDV--SEADMLEM----VST--------DE-ATGLRVLT----SGPIPPNPA-
A0A2V9H7U2      GLASFLT-----GAHSIEAA----LRQ-------FSP-VPTLWVLP----AGPKPPNPA-
A0A2V8NJB5      GLLQYL------SNGRLAPH----CYV--------RR-LENLFFLT----SGGIAENPI-
A0A2V9JMZ4      GLSGYL------ENGHLQPY----CYM--------RR-FKNLYIMT----AGGVCTNPV-
A0A2V9MDJ6      GLSGYL------ENGHLQPY----CYM--------RR-FKNLYIMT----AGGVCTNPV-
A0A2V8QJT6      GLSSILASDT--TADDMLRS----VVR--------DV-SSGLFIMP----SGPVPPNPA-
A0A2V8FSM8      GLSNLLMEPEPLDAAALEGG----CVP--------TQ-VPNLFLLP----SGTSRTHAS-
A0A359M0J2      WTSLVMDDAP--ITAERIEP----LLQ-------ATD-FEGLSLLA----AKAASASTIH
A0A2V8JLJ1      NLGAIL---R--GRSKVEES----LER--------CE-DLNLYFLS----SGPMSSNPG-
A0A2V9GAQ1      GLSSYL---A--GVSSLDLV----SVP-------HPA-IPNLVAIP----TGPLPPNPA-
G8NS05          GLTSVL---T--GSHTLEQA----IQN-------VPE-MPSLDILV----SGPVPPFPT-
A0A2V8KZ20      NLGAIL---R--GRSKVEES----LER--------CE-DLNLYFLS----SGPMSSNPG-
A0A3D0NWU2      GLTNYLSGDR--NTKNLIKA----CR----------D-LPRLKVIT----SGPIPPNPA-
A0A2V8EPD9      GLTEAL------TADEDRQI----VLT--------RV-SDSLFVLP----AGRPESDPM-
A0A3N5NSX5      GLSHLL---T--GQATARQA----IHR--------TN-VQNLWVMT----AGMTPPNPS-
A0A2V8MUA1      GLADVL---R--GSATLEES----LVE--------CS-DLNFSLLP----SGTIVQNPT-
A0A2V8MBH9      GLSSILSSEI--KPEDMLHA----IHR--------DE-ATGLNVLA----SGPIPPNPA-
A0A3N5ZPQ7      GLIGYL------STNLLRPY----CFM--------RQ-VQGLFVLA----AGGISDSPI-
A0A3N5P5F2      GLSQLI------VGSAKAEV----IRR--------SR-IPNLWIVP----AGEVPPNPA-
A0A2V9G1P7      GLVSYL---T--GQQDWRAV----VRP--------SG-SRGLDLLV----CGPVPPNPS-
A0A2V9BCK9      GLTEYL---R--GEADEFSI----IQA--------DS-KDDLFFIP----AGRSVLNPA-
A0A2V9TMX2      GLSTLISGSS--NAEE--VI----LPS--------SE-VPNLWILP----AGPIPPQPT-
A0A2V8N2J7      GFHNLLVHSD--GNPDRYVM----------------Q-FKQLYVIP----GGVSQANPV-
A0A3N6BI26      GISAYL---S--GNGDLSSQ----IRQ--------TS-YPNLFLLP----AGFRPPNPA-
A0A2V9JMM3      ALSNLL------QDPERDIY----REA--------VR-LKDLFVIP----GGSDFENPV-
A0A2V9M815      ALSNLL------QDPERDIY----REA--------AR-LKDLFVIP----GGSDFENPV-
A0A2V9A795      GIVSYL---T--GQQDWRAA----VRP--------SG-SPGLDLLP----CGPVPPNPA-
A0A355ESH9      GLVNQL---T--GTAELDAV----IFP--------TE-VPNLWVIP----SGPMPPNPS-
A0A3D0NW85      GLSTILSSEM--SENEILGV----IQQ--------EP-STKLNLLT----SGPIPPNPA-
A0A353CAT5      GLSTLLSSEL--SEAEILKA----IRT--------DD-GTKLNLLT----SGPIPPNPA-
A0A2V9HB55      GLSSYL-AGV--SSLDL-VC----VPH--------PT-IANLVAIP----TGPLPPNPA-
A0A2V8CU57      GLVDVL-RKT--ETRRLPLC----RAS--------ET----LWILT----AGMPTSDPM-
A0A2V8BDI4      GLVDVL-RKT--ETRRLPLC----RAS--------ET----LWILT----AGMPTSDPM-
A0A2V8F8T3      GLVDVL-RKT--ETRRLPLC----RAS--------ET----LWILT----AGMPTSDPM-
A0A2V9J901      GFVQCLTG-----HVELAEA----VLP-------APG-VPNLSVIP----CGPIPPNPA-
A0A2V8MKQ7      GLTNCLSG-----ESRDLDA----LIQ------TSEK-QPNLKLLP----LGPIPPNPA-
A0A3M1SNQ5      GLAHVLSG-----EIKLRES----ICR--------LE-PSSLHLIA----GGAIKSDSS-
A0A2V8QJ59      GLTNCLSG-----EASEIDS----VIQ------SYAQ-LPNLKVLP----SGPMPPNPA-
A0A1Q7HTA7      GLAELALG-----SRAGLDD----TVR-------WCP-PSRLCVLP----AGRTPANPY-
A0A2W0B5E2      GMSTHLTG-----HDSINDV----IQQ-------YKE-QPNLWLIP----SGPIPPNPA-
A0A2V8NMG8      GLSTILSSEM--KEAEVLAL----IQQ-------HEE--SGLHLMT----SGPIPPNPA-
A0A2V8TBM7      GVTNYLSG-----DSQVADL----VQT-------YER-MPNLKVIT----SGPVPPNAA-
A0A1Q7HEZ8      GLVDAIAD-----TNVWLDQ----VTR-------QVD-GFNLSVIP----AGVTRVPIH-
A0A1Q7JW36      GLVDAIAD-----TNVWLDQ----VTR-------QVD-GFNLSVIP----AGVTRVPIH-
A0A1Q7MUR4      GLVDAIAD-----TNVWLDQ----VTR-------QVD-GFNLSVIP----AGVTRVPIH-
A0A3N5PFU4      GFADLVVS-----ARASLGE----AVR-------PLD-GFNVDVLP----AGVVAGPIH-
A0A1F2T1R8      GLADVLSG-----NRDAAEV----FRR--------IE-PFNLSVLP----AGATRAGVT-
A0A2V9BW09      GLGEVLQG-----RLDVRAA----IRR--------LD-PSGLYYLP----AGHPPPNPA-
A0A3M1SSE1      GLSNLLSS-----EIKRDKV----LDS-----IYFDM-SSRLYLLP----SGPVPPNPA-
A0A2V9GQV7      GLAEILSG-----DVAPDEA----IVA--------TN-QKNLFILP----AGMVSSPPP-
A0A2V7YV88      GLSNLTVQ-----DADEREA----ITA-------VEE-VPNLWLMT----SGPIPPNPS-
A0A2V8YCY6      GLSSYLAG-----VSSLDLV----SVP-------HPA-IPNLVAIP----TGPLPPNPA-
A0A2V8EGM3      GLSEIIAA-----ADERRVP----LV---------QL-TETLTLLP----GGRPNPDPL-
A0A2V8FGH1      GLSEIIAA-----ADERRVP----LV---------QL-TETLTLLP----GGRPNPDPL-
A0A2V8D468      GLSNLMVG-----TAQSREA----MHP--------SG-VKDLWILP----AGHIPPNSA-
A0A1F2R977      GLGDGLRS-----ERVQIPF----YEL-----------SPTLTVLP----AGPLHASSV-
A0A2U3LF12      GFSDLLAL-----TDREVSP----FVS---------K-AGNLHVMP----GGTQLSDPV-
A0A3N5G7M6      GLTDFLIG-----EGRIANL----IRR--------TR-IPRLHLLT----AGTLPPNPS-
A0A1F2S3Q7      GLADALGS-----GRGA-AD----VVR-------TVD-GCLLDVIP----AGSPRAGIS-
A0A2V8GVG4      GLTEVVEN-----AQTSLGA----VTQ-------KLK-PFNLSIVT----AGTRKGAVH-
A0A143PNR5      GLSEGLDA-----ATASRVS----AIQ---------L-SPLLALLP----AGRPVENPV-
A0A2V8PJQ0      GLTNFLSG-----ELPLDEV----IQP-------FEK-LPNLKLLP----SGPIPPNPA-
A0A3N5YKY1      GLTDVLAG-----DVPLEEA----LIW--------IP-EYRLTLLP----AGRPTNQPT-
A0A2V8H566      GLNDVLYA-----RDAALRC----ELF--------TM-TAQLCVLT----AGRPNPDPI-
A0A2V8UVN4      GLADVLMG-----TCRLEDA----IVR-------LEQ-FPNLCVLP----SGKPTAHPT-
A0A321LXF5      GLADILES-----DCAYDQA----VLQ--------TD-VPDLYVLP----AGKSSTPAP-
A0A1Q7JFB1      GLTDSLKA-----ENDRRLP----LIQ---------A-SAYLSLLL----AGRPDSDPM-
A0A2V8DMJ9      GLAEAILD-----PAYDLAA----VVR-------CLD-TFNLSVLP----AGTPQVTPY-
A0A2V8GGF6      GLADLLRD-----PDYEIDQ----VTH-------RLE-RFNLSVVP----AGSPQPAAY-
A0A2V8HKU7      GLADLLRD-----PDYEIDQ----VTH-------RLE-RFNLSVVP----AGSPQPAAY-
A0A1Q6Y875      GLSDYLRG-----DADEFSI----IQS--------GT-GENLFFIP----AGRPVSNPT-
A0A2V8DZN4      GLSNLLME-----PEPLDAA----ALE---GGCVPTQ-VPNLFLLP----SGTSRTHAS-
A0A2V8I604      GLVDILMG-----GSTLEES----LVS--------IA-EHHLTILP----SGPVPTRPA-
A0A2V8J066      GLTDVLMG-----GATLDDA----LVT--------LA-DHHLTVLP----SGVPPSHPA-
A0A1I6MMC5      GLTDYLSG-----NASMFDV----MQRAHASDGMPSA-LSSLTFIA----GGGDADNAA-
A0A2V9D5W7      GLSDYLGG-----RADELAI----IQS--------GH-EGNLYLIP----GGTRIANPS-
A0A2V9D4I4      GLSDYLRG-----DANELAV----TQS--------GQ-EGNLWFIP----GGTNIANPS-
A0A2V9D6L7      GLSDYLRG-----DIDEVAA----IQS--------GQ-DSSLYLIP----GGTKIANPS-
A0A2V8ZJV2      GLSDYLRG-----DVDEYAI----VQK--------GM-NESLFLIP----GGSLVSSPS-
A0A2V9AWB5      GLSDYLRG-----DADEYAV----IQK--------GM-SKNLFLIP----GGNLVSNPS-
A0A2V8Z1Y8      GLTDYLLG-----DADECAI----IQQ--------GL-QPNLFLIA----AGRAVSNHS-
A0A1Q8AX10      GLTEYLRG-----EADEFSI----IQA--------DS-KDDLFFIP----AGRSVLNPA-
A0A2V9A773      GLSDYLGG-----RADEFSI----LQA--------DP-KVELFLVP----AGRPVGNPS-
A0A2V9AND3      GLSDYLNG-----RADEYSI----IQA--------DP-KVELFLVP----AGRPVHNPS-
A0A2V9BTJ7      GLSDYLLG-----MADEFRV----VQK--------GS-ESNLCFIP----AGSEAPNPS-
A0A2V8W2M7      GLTDYLRG-----EANEYDV----IQH--------SS-EVNLCFIP----CGHPVSNPS-
A0A2V8XNW2      GLTDYLRG-----EANEYDV----IQH--------SS-EVNLCFIP----CGHPVSNPS-
A0A1Q7CJC1      GLTDYLRG-----EANEYDV----IQH--------SS-EVNLCFIP----CGHPVSNPS-
A0A2V9UEM7      GLSEYLMG-----ECDEFAI----MQR--------GP-MDNLFFVP----AGRQATGAP-
A0A1Q7V300      GLSEFLKG-----EMDEFTI----IQS--------GP-MENLFLIP----AGTRNENPA-
A0A2V9ZCI3      GLSNYLMG-----ENDEFAV----VQR--------GP-LENLFFVP----AGKQVSSPA-
A0A2V9WCB3      GLSDYLQS-----KNDEFSI----IQQ--------GP-MENLFFMP----SGSGIEDPS-
A0A2V9VQW5      GLADYLMG-----ESDEFSI----MQR--------GP-MENLFFVP----CGRTVTHPA-
A0A2V9WTP3      GLSDYLQG-----ANDEFSI----MQR--------GA-LENLLLIP----SGCEVSNPA-
A0A2V9NLA9      GLTEYLLG-----EADEFAI----LQR--------GP-MDNLFFIP----CGRKVTSPA-
A0A2V9RKJ9      GLTEYLLG-----EADEFAI----LQR--------GP-MDNLFFIP----CGRKVTSPA-
A0A2V9RN95      GLSEYLLG-----EADEFGA----IQR--------GP-MDNLFFIP----SGRTVSSPA-
A0A2V9N406      GLSEYLLG-----EVDEFGA----IQR--------GP-MDNLFFIP----SGRTVSSPA-
A0A2V9U6D9      GLSEYLLG-----EVDEFGA----IQR--------GP-MDNLFFIP----SGRTVSSPA-
A0A2G6HQA4      GLVNYLEH-----QTALPKL----IVR--------SR-KPKLSLLL----AGKPPSNPS-
A0A2V7ZTY7      GLSECLTA-----EIE-RRL----PLV--------QA-TPYLSLML----AGRPDSDPM-
A0A2V7ZVL9      GLSECLTA-----ETE-RRL----PLV--------QA-TPYLSLML----AGRPDSDPM-
A0A1Q7QYI4      GLTDSLKA-----END-RRL----PLI--------QA-SAYLSLLL----AGRPDSDPM-
A0A2V8G9Y9      GLSDGLKS-----EVE-HKL----SLI--------QI-SEHLTVLP----AGRPDSDPM-
A0A143PXU3      GLLDALRA-----EAE-DVP----AVV--------PV-TGTLSLLP----AGRPQANPV-
A0A2V8D8G9      GLSEALR------DGR-HEL----PFV--------EV-SSRLSVLT----AGKPGPTPL-
A0A2V8ESQ4      GLSEALR------DGR-HEL----PFV--------EV-SSRLSVLT----AGKPGPTPL-
A0A1E3Y5Q0      GLTEGVV------GTD-AAL----SLH--------RV-SPTLTVIT----AGEPTDDPM-
A0A2W4TWK5      GLTAAFAP-----RSD-HRI----RLH--------RI-TPHLTVLT----AGRPTTDPM-
A0A3N5NYV3      GSGIGSKQ-----ETD-QKL----SLI--------QV-SPRLSVLT----AGQPDPDPM-
A0A2V2RJF9      GLSRFLTSDVKAGEVIR--P---------------SK-VKGLSLIT----SGSKTPRPA-
A0A2G6HNT3      GLVDYLQQQGSLPELIV--R---------------SR-KPKLSLLL----AGDTPPNPS-
A0A2V7YWD4      GLVDAILDRRLSLEQIA-WP---------------LQ-PFNLSVVT----SRRPQADTY-
A0A192WXK4      GLTELMTDQVELDHVLF--P---------------MQ-NSQTTILP----AGGTPSDPT-
A0A2V2R8T6      GLAEVLGGQARFEDAIV--R---------------LD-PAGLYLLP----GGGVRNDVA-
A0A1Q7RGF1      GLVDVLSGKCEPRNAIL--A---------------TD-IPNLYTLG----SGSHTTQPA-
A0A2V9BLX2      GLVDVLSGKCEPRNAIL--A---------------TD-IPNLYALG----SGSHTTQPA-
A0A2V9ZA03      GITD-WWQETADVSEFL-RR---------------VN-GFPLWYLP----AGEAMGQPL-
A0A3N5ZNH4      GMSSYLSGN-SDLSSLI-RP---------------TA-YPNLFILP----AGFRPPNPA-
A0A2V8GEZ2      GLNDALLGR-DNMPTAF------------------EM-SSRLTVLP----AGCPNPDPI-
A0A3N5ZFD3      GLNEALTEEAGNPPALF------------------SI-SPQLTLLA----GGRPHPDPM-
G8NXD3          QSIEQVLKGEVTPEAAI-RS---------------VG-DLPLYIIG----LDKAVSKPV-
A0A2V9VR38      GLSNVLTGSTTTEQAIT-RT---------------TI-LPNLFVLA----AGTPPPNPA-
A0A2V9EY04      GLAEVLAGKATLEEAMV--A---------------TN-QKNFFVLP----AGTISSPPP-
A0A2V9HAK9      GLAEILSGDVAPDEAIV--A---------------TN-QKNLFILP----AGTVSSPSP-
A0A1Q7FS15      GLAEVLAGEVTPDEAIV--A---------------TN-QKNLFVLP----AGTVLSSPP-
A0A1Q7K9P1      GLAEVLAGEVTPDEAIV--A---------------TN-QKNLFVLP----AGTVLSSPP-
A0A1Q7N989      GLAEVLAGEVTPDEAIV--A---------------TN-QKNLFVLP----AGTVLSSPP-
A0A2V9G7Y0      GLAEILSGDVGPDEAIV--A---------------TN-QKNLFILP----AGTISSPSP-
A0A2V8T7Z1      GLVELIADPSLGIGGLARRV---------------GP-A-NLSVLL----AGRSHADPF-
A0A2V7U8G5      GLAEAAIDEGLQLSDVV-QS---------------TP-Y-NLAVLP----AGAPPANPY-
A0A2V7UNP9      GLADAVRDEQIDLAAVV-QA---------------TP-Y-TLAVVP----AGAAPADAY-
A0A2V7VLD7      GLADAVRDEQIDLAAVV-QA---------------TP-Y-NLAVVP----AGAAPADAY-
A0A2V7XGA3      GLAATALDPKLELEQLV-RP---------------TP-F-NVDVVP----AGPSTPSAY-
A0A2V7YAG6      GLATMALDPDLELDQMV-RR---------------TP-Y-NFDIVP----AGPAAPNAY-
A0A2V7VK33      GLAGAILDSHRSLASVV-RA---------------RP-PFNLSVLP----AGRFHDLPF-
A0A3M1VTE1      GLRELLEGKVPEEEALL--E---------------VS-GTRLAVVP----AGRPVANPV-
A0A2V7TTM7      GLAGAVLDPRVELATVV-RP---------------TP-F-GFSILP----AGTSPSNAY-
A0A2V8VI82      GIADAVREPGALLEDFVRRR---------------PP-S-RLSILP----AGRTSDNPY-
A0A2V7U4P9      GLAEAVADGARPLDELC-QQ---------------VA-GFNLWVLP----AGHAVMAPY-
A0A2V7TQY5      GLVDAILTPGLDLSAVV-RE---------------LP-EFRLSVVP----SGRCPAAPY-
A0A2V7TU87      GLVDAILSHDLKLADVARPC---------------GP-L-NLAVVT----AGVFSDIPY-
A0A2V8SEH0      GLVEAILDPGRSLDDVV-RD---------------LP-LFNLSVLP----AGRSPSAPY-
A0A2V8VU54      GLADAILDPDRSLPGLV-QS---------------LP-A-NLGILP----AGRLAPQPY-
A0A1Q7RML7      GLADAILDPERSLESVILRR---------------LP-L-NLGVLT----AGRLPPAPY-
A0A1Q7ZIQ5      GLADAILDPERSLESVILRR---------------LP-L-NLGVLT----AGRLPPAPY-
A0A2V8TKD8      GLADAILDPERSIESVILRR---------------LP-L-NLGLLT----AGRLPPAPY-
                                                                            

A0A1F2U8T6      ELLASERMKMLLSSLAQGPF--D--WIIIDTPPVLGVSDAVVLTPLVTGVTFVVGAEMTR
A0A2V8BV42      ELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVSGVTFVVGAEMTR
A0A2V8F916      ELLASERMRTLLTNLAHGPF--D--WIIIDTPPVLAVTDAVILAPMVSGVTFVVGAEMTR
A0A1Q7K833      ELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAEMTR
A0A1Q8AMY4      ELLASERMKTLLTNLSHGPF--D--WIIIDTPPVLAVTDAVILAPAVSGVTFVIGAEMTR
A0A2V8BM40      ELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMSGVTFVIGAEMTR
A0A2V8CRT6      ELLASERMKTLLTNLSHGPF--D--WILIDTPPVLAVTDAVVLAPMMSGVTFVIGAEMTR
A0A1F2VH76      ELLAADRMRALISGLENGPF--D--WVIIDTPPVLAVTDAVIIAPLVAGVTFVVGSEMTR
A0A1F2R0X5      ELLSSERMKTLITNLRSGPF--D--WIVIDTPPVLAVTDAVILAPLVNGVTFVIGAEMTR
A0A2V8B278      ELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVSGVTFVVGAEMTR
A0A2V8CEF9      ELLSSERMKTLLTNLAHGPF--D--WIIVDTPPVLAVTDAVILAPLVSGVTFVVGAEMTR
A0A2V8KZG2      ELLSSGKMKRLIEIMAE-RY--D--HVVIDTPPLGSVTDPVILSTMVDGVVLVVHAGRNK
A0A1Q7LG57      NLFYSPRMARFLKRMRK-EF--E--MVMIDAPPMIHLADARVLGRHADGVILVMRAGQTT
A0A2V8YMQ4      ELLSSKSMGAFLGSAKS-EY--A--FVILDSSPLLTLADSRILASLVDGVLLVAKSGATP
A0A1Q7L5B1      ELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCDGVIVVVRAGSTG
A0A2V9DKV4      ELLSTERLECFLRQMAA-LF--D--WVIIDAPPVLPVSDAIVLAGRCDGVIVVVRAGSTG
A0A2V8W380      ELLSSQSMGALIRSASA-EY--G--FVILDSSPMLALADSRILAPLVNGVLLVVRSGTTP
A0A2V8ZIV5      ELLSSKSMGAFLVSAKS-EY--A--FVILDSPPLLTLADSRILASLVDGVLLVVKSGATP
A0A2V9EVA0      ELLGSTRAKSLFERLNT-LF--D--WVIVDTSPVLPVSDATVLAPMCDGVILVVGAGRTS
A0A1Q7RB73      ELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLDGVLIVVQSDATP
A0A2V9K0H7      ELIGNGRLRLLLRRLCP-AF--D--WIIMDSPPVIPVSDAKLLAEYLDGVLIVVQSDATP
A0A3N5YN96      ELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSDGVLLVVRAGQTP
A0A1Q7Y646      ELLSGPKFDKVLAEARR-MF--D--YIIIDAPPMGIFTDANLLINSADGAMLVVRAGKTR
A0A2V8QZU0      EMLSGPKFSAVLKEARR-MF--D--YVIIDAPPLGIFTDASVLINRADAALIVARAGRTR
A0A2V8RSQ9      ELLSGPKFSAVLAELRR-SF--N--YIIIDAPPLGIFTDATVLINRADGALVVVRAGRTR
A0A2V9LS17      ELVSNGRFKNLLRRLSP-VF--D--WIVVDTPPAIAVSDAQVLAAACDGVLLVVAAGSTS
A0A2V9AGR3      ELILGGRVKKLLDFVTP-AF--D--WVILDSPPALAVHDPSLFADLCDGVLFVVKAGETS
A0A2V9G0N7      ELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCDGVLFVVRAGVTD
A0A2V9GQ44      ELLPSDRMRHLLDVVTP-MF--D--FVILDSPPATPVHDPIVLADLCDGVLFVVRAGVTD
A0A2V9HRN3      ELLPSDRMRHLLDVVTP-MF--D--FVILDSPPASPVHDPIVLADLCDGVLFVVRAGVTD
A0A2V8WG13      ELLLGDRMKKLLDLVTP-IF--D--WIILDSPPALAVHDASSLADLCDGVLFVVKAGETN
A0A2V8X987      ELLLHERMKRLLDLLTS-AF--D--WIIIDSPPALLVHDASILADLADGVLFVVQAGMTH
A0A1Q7KX94      ELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVDGVLFVIRAGSTD
A0A2V8XHT0      ELLLNERMKHLLNLVAP-SF--D--WIIIDSPPTLPVHDASILADLVDGVLFVIRAGSTD
A0A2V9L2P7      ELLCSTKMQELLKQMRE-RF--D--HVIVDSPPVLPITDATILSSRVDGVIMVVENEVTT
A0A2V7UMX0      DVIRSPHFADLLEEARR-RF--D--FVVIDTPPILPVPDGREIARWVDGFLVVVAAHRTP
A0A136K497      ELISGPKFAEILAEARE-MF--D--YVIIDAPPLAIFTDATVLINKADGALLVVRANRTK
A0A399W9E4      ELISGPKYAELLAEARE-MF--D--YIIIDAPPLAIFTDATVLINKADGALLVVRANRTK
A0A2V7X0V9      ELVGNGKLKTFLQRVEP-LF--D--WIIVDSPPAIPVSDASVLAKACDGVLMVVRSNATP
A0A2V9X518      ELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLDNFCDGVLIVVRSNTTP
A0A2V9VC62      ELIANGRLKMLLQRVEP-LF--D--WIILDSPPAVPVSDASQLANFCDGVLMVVRSNATP
A0A2V9S1P8      ELVANGRTRFLLNRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLMVVRSNATP
A0A2V9RTW2      ELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCDGVVMVVRSNATP
A0A2V9TGF1      ELVANGRLKILLNRVEA-LF--D--WIIIDSPPAVPVSDASLLANYCDGVVMVVRSNATP
A0A2V9XEV6      ELVANGRLKFLLTRVEP-LF--D--WIIIDSPPTVPVSDSSLLANFCDGVLIVVRSNTTP
A0A2V9Y3Q6      ELVANGRLKFLLNRVEP-LF--D--WIIIDSPPAVPVSDASLLANFCDGVLIVVRSNTTP
A0A2V9R269      EMLSNGRIKTLLHRLEP-LF--D--WIIIDSPPAVPVADAAMLANHCDGVLLVVRSNSTP
A0A2V9PTS3      ELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYADGVLLVVRSNTTP
A0A2V9NPF4      ELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLARYADGVLLVVRSNTTP
A0A2V9PNZ0      ELLANGRMKFLLERLQP-IF--D--WIIIDSPPAALVSDAGLLAKYADGVLLVVRSNTTP
A0A321LMC5      DILTTSRVEGVLDELES-AF--D--FVVIDAPPITDFADAQRLAALADGTVLVVKAGRTH
A0A2V8X713      ELLANGLLKGLLDRVSP-LF--D--WVILDAPPVLAVSDAGVLAGLCDGVIVVVRAGATA
A0A2V8ZLE9      ELLANGMLKAFIHGISP-VF--D--WVIVDAPPVLAVADAGIIADFCDGVIVVVRAGETA
A0A2V8Y4D3      ELLANGMLKSFIDGVSP-VF--E--WVIVDTPPVLAVADAGIIAEFCDGVMVVVRANKTP
A0A2V8Z2X8      ELLANGMLKGFIDKIGP-IF--D--WVIVDAPPVLAVADARIIAEFCDGIMVVVRAGQAG
A0A2V9C3F6      ELLANGTLKRFLDGMSP-IF--D--WVIIDAPPVLAVADPSIIAEFCDGVLVVVQAGETA
A0A2V9QMU9      ELLSSGNMKKVLDELRE-QY--D--HIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTT
A0A2V9QY75      ELMASQQMFDLLAELRE-QY--D--HIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSSQTT
A0A2V9SVU9      ELLASSNMKDVLAELRE-QY--D--HIVVDTPPTLSVTDAVVMSTRADAVVLVIRSGQTT
A0A2V8W5N5      ELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSNGVLLVVRAGSTS
A0A2V8XG53      ELLSNGRLKILLDRLTP-IF--D--WIIVDSSPCLLVADASMVAGVSNGVLLVVRAGSTS
A0A2V9XV04      EMVASSRLKVLLQRIEP-VF--D--WIIIDSPPAIPVSDASVLAKACDGVLMVVRSNSTP
A0A2V9CBY1      ELLANNKLRALFSRVLA-LF--D--WIIVDAPPALPVSDASVLSGMCDGVIFVVRAGMTA
A0A2V9D656      ELLANNLLRALFSRVLP-LF--D--WIIVDAPPALPVADASVLAGMCDGVIFVVRAGVAA
A0A352EZH8      ELLSGPTFAGVIAEARR-LF--D--FIIIDAPPLGIFTDANVLISRADGALLVVRAGKTR
A0A0B6X033      EMLSGPRFSSVLAEVRR-MF--D--YIVIDAPPLGIFTDATVLINRADAALIVVRAGYTR
A0A2V8R0I3      ELLSGPRFARLLDEARK-LF--D--YIIIDAPPLGIFTDANLLINRADAAMLVVRASKTR
A0A2V8N1U8      ELLSGPRFGRLLDEARK-MF--D--FVIIDAPPLGVFTDANLLINRADAAILVVRASKTR
A0A2V8QL35      ELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRADAALLVVRAGVTR
A0A352FU10      ELLSGPRFGRLLEEARK-LF--D--YIIIDAPPLGVFTDANLLINRADAAMLVVRAGVTR
A0A2V8LCU0      ELLSGPRFGRLLEEARR-LF--D--YIIIDAPPLGVFTDANLLMNRADAALLVVRASATR
A0A1Q7NGT0      ELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAAKTR
A0A2V8MLP9      ELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAAKTR
A0A2V8PQZ0      ELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAAKTR
A0A3B9MKY6      ELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRADGALLVVRSGKTR
A0A3D5SKZ1      ELLSGPSYARILTDVRR-MF--D--YIIIDAPPLGIFTDANVLMNRADGALLVVRSGKTR
A0A2V8NRW2      EILSGPKFGQLLAELRR-MF--D--YIIIDAPPLGIFTDATVLINRADAALLVVRSGKTR
A0A2V8TKR9      ELISSARMRDLLKEMAA-RY--D--HILIDSPPMMNVTDPVILSRMVDGVILVVHGGKSP
A0A2V8LBV1      HLLHSKRLPDLLRRVRK-EF--D--VVLIDAPPVSQIADARVLARLSDGVIFVVRSAETT
A0A2V8GAF9      ELLNSRRLEGLLSEARR-LY--D--FVLIDTPPLVPFPDCRLLGRWADGFVLIVGANKTP
A0A2V8CN98      ELLGSPRMVELLVRLRA-MY--P--VIIVDSPPLGAGVDPYTLGTMTGAMMLVLRTGATN
A0A1Q7LC46      DLLSSHRLADAIAELRT-KF--K--FIVIDSPPIMAATDAVILSVLADGVLLIVRSGETP
A0A1Q8BDC5      EILSLRKMKELIESLRK-DF--D--TIILDAPPFAPIADARIVTGLSDGLIMVLRRGKTS
A0A2V9Q1Y8      ELLASSQMLDLLAELRE-QY--D--HIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTT
A0A2V8JXG1      ELLSSDRMKRLLAQLSE-RY--D--HIVLDSPPLGSVTDAVILSTMVNGVILVVHGGRNS
A0A350D2W9      ELLGSDRMSKLLALLKD-QF--D--FVLIDTPPILTVTDAQILGKLVDGLVLVVQAGTTP
A0A2V9I4J1      ELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTP
A0A2V8PQZ9      ELLSGPRFGHLLDDARK-MF--D--YIIIDAPPLGVFTDANLLINRADAALLVLRAAKTR
A0A2V8D8B1      ELLGSTRFKDFVTTVGQ-HF--D--WVVIDSPPVMAVADAAVIANIASGVVFVVGAEMTS
A0A3B9LSB4      ELLGSDQMRRLMATLQS-QF--S--HVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSS
A0A2V9H7U2      QLLSSSAMESLLKELRQ-RF--K--FIVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTA
A0A2V8NJB5      ELLSLRRMKDLIEYLKN-DF--D--TIILDAPPLSPIADARIVTALSDGCIMVIRRGKTS
A0A2V9JMZ4      ELLSQDKMRELIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTP
A0A2V9MDJ6      ELLSQDKMRDLIQYLKT-EF--D--TIIFDAPPFAPIPDARIIMGLSDGLVLVVRRGKTP
A0A2V8QJT6      ELLGSDQMRKLLATLSE-KF--T--HIVIDSPPVNSFTDGVLIGSMVDGVLLVVHGGKSS
A0A2V8FSM8      SLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSDALILVVRSGQTT
A0A359M0J2      SIFNSPRLGELLAVLRQ-RF--A--MVLLDSPPVLQFPEARLAGRFADGAVVVLRSRHTE
A0A2V8JLJ1      ELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCDAILLVVQSGKTP
A0A2V9GAQ1      DLLSSHRLVEAVAELRT-KY--K--FIIIDSPPIMAATDAVILSVQTDGVLLVVRSGETP
G8NS05          EMLSSETMAELLEKCRG-IY--T--HILIDSPPLLSVTDGIILGRDADAVVLIVRHGKSN
A0A2V8KZ20      ELLSSAHIELVLRECAE-SF--D--WVIVDTPPILGAADVNLMAPFCDAILLVVQSGKTP
A0A3D0NWU2      ELLSSNEMRNLLQFLRS-KY--K--HVIIDSPPAISFTDAAILSTQVDGVILVAMAGKSS
A0A2V8EPD9      SGLTSDRMKRVLAQAAS-HF--D--WVLVDSPPVGLLPDASLLATLVDGVLLVIRSGKAP
A0A3N5NSX5      ELLASDRMKTLIANVQTGPF--D--WVLIDTPPVLAVTDAVIIAPWVSGVVFVIGSEMTQ
A0A2V8MUA1      EVLSSPEFERVMKDLAQ-FF--D--WIVVDSPPSLAMADADLLLRQCDAALLVVNADKTP
A0A2V8MBH9      ELLGSEQMRKLIAVLSG-AF--T--HIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSS
A0A3N5ZPQ7      ELLSLRKMRELFDYLRI-EF--D--VVIIDSPPLNPISDTRLISGFSDDVILVIRRGRTP
A0A3N5P5F2      ELLSAQQFEHFLNSLSA-RF--D--WVILDAPPVLAVTDASIVAHSASGVVFVTSADLTD
A0A2V9G1P7      EMLSSQSMSALIRSASA-EY--G--FIILDSSPMLALADSRILAPLVNGVLLVVKSGTTP
A0A2V9BCK9      ELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCDGVIVVVRAKLTA
A0A2V9TMX2      ELLGSTVMKDYISRWRN-EF--D--HIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTT
A0A2V8N2J7      AALSSAKARAVFEQLKQ-KF--A--YIIVDAPPVLPIADSQILAGIVDKVLFVIRARQTP
A0A3N6BI26      ELIGSERMESALRLLGD-YF--K--YILIDTPPILSVTDGLLLCPHVDGVVMVIKGGSTP
A0A2V9JMM3      GVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYADGVLLVVRARRTR
A0A2V9M815      GVLGSERMRRLVERLRL-EF--R--FIVLDAPPILPIADPQVLAGYADGVLLVVRARRTR
A0A2V9A795      ELLSSKSMGAFITSAKS-EY--G--FVILDSSPLLTLADSRIVASLVDGVLMVVKSGATP
A0A355ESH9      ELLASERLRDLLRTLRS-RF--D--YVIVDTPPALAVTDATLVGIQTDGVVLTLRSHKVT
A0A3D0NW85      ELIGSQPMAELLVTLQK-NF--T--HVVIDSPPITSFTDGVLIASMVDGVILVVHSGKSS
A0A353CAT5      ELIGSEQMASLLKVLQK-HF--T--HVVIDSPPITSFTDGVLIASMVDGVILVVHSGKSS
A0A2V9HB55      DLLSSHKLADGITELRT-KF--K--FIVIDSPPIMAATDAVILSVQADGVLLVVRSGETP
A0A2V8CU57      SALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDATILVIGAATTP
A0A2V8BDI4      SALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDATILVIGAATTP
A0A2V8F8T3      SALASEEMKLLLGEAIE-HF--D--WVIVDSPPVALLSDANLVAAMVDTTILVIGAATTP
A0A2V9J901      EVLSSSLAAESLRKLRA-DF--D--YVLVDSPPLLSVADGRILATMVDGAVLVARAFETP
A0A2V8MKQ7      ELLGSDEMRRLLASLSE-KF--T--HIVVDSPPAISFTDASILSTVVDGVILVVHGGRSS
A0A3M1SNQ5      ELLSGPKFRDLLQHLKK-MF--D--YILIDAPPLAIFSDAKVSINQSDAAILVVRSGHTK
A0A2V8QJ59      ELLGSEEMRKLLIALSK-KF--T--HVIVDSPPAISFTDASILSTFVDGVILVVHGGRSS
A0A1Q7HTA7      EVLKSAGIGEVIQAARR-RY--D--AVVVDTPPLLPVPDNRALAKWVDGFLLVVAAHRTP
A0A2W0B5E2      ELLCSEAMESLFGELRR-RF--K--HIIIDSPPLLAVTDATVLASAVDGVILVVESGVTP
A0A2V8NMG8      ELIGSEQMRRLITTLQS-TF--T--HIIIDSPPIASFTDGVLIASMVDGVVLVIHGGETS
A0A2V8TBM7      ELLGSEEMRKLLYLLTE-NF--T--HIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSS
A0A1Q7HEZ8      EILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIVVVAANQTP
A0A1Q7JW36      EILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIVVVAANQTP
A0A1Q7MUR4      EILRSPRLERLLQEARQ-RY--D--FIVLDTPPLLPVFDAATISKLVDGLIVVVAANQTP
A0A3N5PFU4      DVFRSARLPQLLSEARA-RY--D--YVVLDTPPLVPVVDSVLLSRVVDGVLVVVAANKTP
A0A1F2T1R8      EMLRSPRLEQLLQEARR-EY--A--YVVIDTPPLLPIFDASVLAKLADGVLMIVAANQTP
A0A2V9BW09      ELLQSPRIQELLTQISS-AF--D--WIVLDAPPVNLFADARHLANLADAVVLVLRVGVTP
A0A3M1SSE1      ELIGSAQMSTLMEIFQK-EF--T--HVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTS
A0A2V9GQV7      ELFAGTRWQEFLGHCGE-MF--K--VILIDAPPILPRVDFELISAACDGIVMVVRAHHGQ
A0A2V7YV88      ELLGSGRMKELIAQMLS-HF--T--HVIFDTPPINAVTDAVILAASADGTIVVVEQGRTT
A0A2V8YCY6      DLLSSHKLADAIVELRA-KF--K--FIVVDSPPIMAATDAVILSVHADGVLLVVRSGETP
A0A2V8EGM3      SGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVDGTLLVVRAGKTP
A0A2V8FGH1      SGISSLRMQQLLREAVE-RF--D--WVILDTPPVGVAADAGLLCPMVDGTLLVVRAGKTP
A0A2V8D468      ELLTSQQFKDLLSALGG-HF--D--WIVLDSPPVSAVTDAVQLSHDVSGVLFVVGAGKTG
A0A1F2R977      GGLASNRMKAVIDGAAP-RF--D--WVLVDTPPIGLLSDAQFLAGLVDGVLLVIGAAKTP
A0A2U3LF12      ELLSSRRTREILARLRQ-EY--Q--LIVLDSPPIVPIADSHFLAGLADGVILVIRARQTR
A0A3N5G7M6      ELLDSQRFRKFLARLGN-HY--D--WVILDSPPVMPVTDAIVLAEAATGVIFVTAAETTP
A0A1F2S3Q7      EILRSPRLDAFLQELRQ-RY--A--YIVLDTPPLLPVFDAALIAKSVDGVLMVVSANRTP
A0A2V8GVG4      QVLRSPRLDAVLAEARG-RY--D--FVVLDTPPLLPVFDSALLANAVDGVLMVVAANQTP
A0A143PNR5      PLLTSERMGELVRDARQ-HF--D--WIVIDTPPVALLTDANLLTKECDGALLVIHANRTP
A0A2V8PJQ0      ELLGSEQMRRLLTLLGE-KF--A--HIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSS
A0A3N5YKY1      ELLGSFEMRRAVDTLRT-HF--D--RIVIDTPPALALADVGVVGPLSDGVLLVVRAGQTP
A0A2V8H566      GGLTSERMRQLVAAGTA-EF--D--WVVIDTPPVGLLTDARLMSSMVDAVIFVISAGRTP
A0A2V8UVN4      ELLDSNRWTALCASVRQ-QF--K--FVILDTPPIAAVADYDLIDAQCDGVVLVVRPDHTD
A0A321LXF5      ELFSRAAWKEFIGWSSE-SF--K--LVLIDSPPMLDLADFELIASPCEAVMLVARSGKTS
A0A1Q7JFB1      SGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVDAAILVIGAGKTP
A0A2V8DMJ9      ELLNSPRLEGLLRDARR-TY--D--CVLIDTPPAVALPDCRLIERFVDAFLVVVAAHKTP
A0A2V8GGF6      ELLNSTRLESSIETARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVDGFLLIVAAHRTP
A0A2V8HKU7      ELLNSARLESSIEEARR-RY--D--YVLIDTPPLVPLPDCRLLAKCVDGFLLIVAAHRTP
A0A1Q6Y875      ELLGSTRTKSLFERLNT-LF--D--WVIVDTSPVLPVSDAAVLAPTCDGVILVVGAGRTS
A0A2V8DZN4      SLVHTERLAEIVVLARE-HF--D--MVIIDTPPMVNIADARVLARHSDALILVVRSGQTT
A0A2V8I604      ELLGSSAMRRLLDTVRT-QF--D--RVLLDMPPVAPLADVSIVASMIDGVLMIVRAGATT
A0A2V8J066      ELLGSAAMRRTIDTLRT-RF--D--RLILDMPPVAPLADVNIAAAVADGILLIVRAGMTQ
A0A1I6MMC5      DLSSNNRFKELIVKASA-FF--D--WIIVDSSPVNVIADGVNLAHACDGVLLVARGGVTK
A0A2V9D5W7      ELLANGRFKRLIERVAP-LF--D--WIIVDSTPCLPVTDANIAANSCDGLLLVVKAYSTP
A0A2V9D4I4      ELLSNGRLKSLLDHMAP-FF--D--WIILDSPPCLPVMDANVVADLCDGLLFVVKAGSTP
A0A2V9D6L7      ELLSNGRLKKLLDRVAP-LF--D--WIIIDSPPCLPVADANVVSNFCDALLFVVKAGSTP
A0A2V8ZJV2      EVLRTERMKQLLNRVTP-LF--D--WIILDSPPSLRADDAGILADLADGVLLVIQAGSTA
A0A2V9AWB5      ELLLSERMKHLLNVVSP-AF--D--WIILDAPPTLPVHDASILADLVDGVLFVIRAGSTH
A0A2V8Z1Y8      DLLLSKKMKHLLNYLTP-IF--D--WVIMDSPPTLPVHDASVLADLADGVLLVVQAGSTA
A0A1Q8AX10      ELLADNRMKVLIDRMAP-VF--D--WVIVDAPPVHPVGDAGVLAGLCDGVIVVVRAKLTA
A0A2V9A773      ELLANGKLKGFLNGINS-VF--D--WVIVDAPPVLAVADAGIIAQFCDGVIVVVRAGETA
A0A2V9AND3      ELLGNGLLRDFLHGMSP-IF--D--WVIVDAPPVLALADAGIVAEFCDGVIVVVRAGQTS
A0A2V9BTJ7      ELLLNDRMKRLLDLMTP-IF--D--WIIIDTPPALPVHDASMMADLCDGVLFVVRAGATD
A0A2V8W2M7      ELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLFVVRAGETN
A0A2V8XNW2      ELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLFVVRAGETN
A0A1Q7CJC1      ELLSGDRMKKLLDLVTP-VF--D--WVILDSPPSLAIHDASILADLCDGVLFVVRAGETN
A0A2V9UEM7      ELLANGRLKLFLQRVEP-LF--D--WIILDTPPVIPVADSTLLANFCEGVLMVVRSNSTP
A0A1Q7V300      ELVASGRMSTLLHRLEP-LF--D--WIIVDSPPAVAVSDAALLAKYCDGVIMVVRSNATP
A0A2V9ZCI3      ELVANGRLKFLLNRVES-LF--D--WIIVDSPPAVPVSDASLLANFCDGVLIVVRSEVTP
A0A2V9WCB3      ELIANGRLKMLLQRLEP-LF--D--WIIVDSPPAIPVSDASVLAKACDGVLMVVRSNATP
A0A2V9VQW5      ELIANGRLKMLLQRVEQ-LF--D--WIIVDSPPAVPVSDASQLANFCDGVLMVVRSNATP
A0A2V9WTP3      ELVANGRLKFLLQRVEP-LF--D--WIIIDSPPAVPVSDASLLANSCDGVLMVVRSNATP
A0A2V9NLA9      ELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCDGVLMVVRSNSTP
A0A2V9RKJ9      ELVANGRLKTLLNRLEP-LF--D--WMVLDSPPAVPVSDAGLLANYCDGVLMVVRSNSTP
A0A2V9RN95      ELVANGRLKFLLNRLEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLIVVRSNATP
A0A2V9N406      ELVANGRLKFLLNRIEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLIVVRSNATP
A0A2V9U6D9      ELVANGRLKFLLTRVEP-LF--D--WIIIDSPPAVPVSDAGLLANYCDGVLIVVRSNATP
A0A2G6HQA4      ELLGSILMKDLIAELSS-RY--TDRTIIFDAPPVLLTAEARTLAHHVDGVVMVVRQGIVG
A0A2V7ZTY7      SGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPIVLMPDANLLAAMADAAILVIGAGKTP
A0A2V7ZVL9      SGLTSNRMRRLVGEAAA-TF--D--WVIIDTPPVVLMPDANLLAAMADAAILVIGAGKTP
A0A1Q7QYI4      SGLTSGRMRRLIGEAAA-TF--D--WVIIDTPPVVLLPDANLLAAMVDAAILVIGAGKTP
A0A2V8G9Y9      SGLTSDRMRRLVAEAAA-RF--D--WVLIDTPPVGFLSDANLLAAMADVTLFVVRAGRSP
A0A143PXU3      GDLSSGRMSRLIANAGS-TY--D--WVIVDSPPAAGLADARIILETVDGAILVVRAAATR
A0A2V8D8G9      AGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVGAVILVIGAGSTP
A0A2V8ESQ4      AGLTSSRMGEVIEECAA-RF--D--WVLIDTSPVGVLPDAQVLARLVGAVILVIGAGSTP
A0A1E3Y5Q0      VTLAAERMQALITEARE-QF--D--WIVIDTPPVGLLPDAGLISGLADGTVVVVRADATQ
A0A2W4TWK5      AVLASERMRDLLADVRE-DY--D--WVVIDTPPIGLLADANLLADVSDGMVLVVKAGTTP
A0A3N5NYV3      SRLASDRMRRVLMEAAT-QF--D--WVIIDTPPVGTVPDANLLATMADVVLLVVQAGRTP
A0A2V2RJF9      ELLSSHRLTQLLEQLKA-EF--D--HVIVDSPPLMPVTDAVILAAKSNCVVMVVHGGVTP
A0A2G6HNT3      ELLSSVLMKDLIKELSS-RYTDR--TIIFDAPPVLLTAEARILAHHVDGVVMVVRQGVVG
A0A2V7YWD4      ELLASGRFGELLRDARQ-RY--D--CVVVDTPPVLPAPDSRLLAEWIDGYVIVVAADKTP
A0A192WXK4      ALLSSSKFAKLVEELRN-RF--D--WILIDTPPVVLFSDADAVSANCDGVLLVVRAGRTP
A0A2V2R8T6      ELLGGPTYARLLTDARR-MF--D--YVIIDAPPLGVFTDASVLISRADGALLVVSAGKTR
A0A1Q7RGF1      ELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACDGVVMVVRAQHAK
A0A2V9BLX2      ELFASSHWQEFISWCSE-SF--K--LVLIDSPPVLNLTDVDLIAAACDGVVMVVRAQHAK
A0A2V9ZA03      EILQSQRMSEMLTQVAE-WF--E--WVIIDSPPLAPVADPNLWAMQADGTLLVVEQGKTP
A0A3N5ZNH4      ELIGSDKMETGLKLLGE-YF--K--YVVVDSPPVLAVTDALVISPLVDGVVLVVRGGATP
A0A2V8GEZ2      GVLTSPAMRQLVKFARD-GY--D--WVLIDTPPVGLLTDAHLVAQMVDAVVMVVSAGAVP
A0A3N5ZFD3      AVLTSDRMRRLMEEAAA-GF--D--WVVVDTPPVGLLPDANLLAAMVHAAVLVVEAGKTD
G8NXD3          PLLRAPELSNLLKWAQK-NF--Q--WVLLDAPPVLPVADVEQLLPSADLVLMVVRERVTR
A0A2V9VR38      ELLASTNMRDLLAQLRE-QY--D--HIVIDTPPSLSVTDAVVLSPRADAVVLVIRSGQTT
A0A2V9EY04      ELFTGSHWQELLGRCSE-LF--E--VVLVDTPPIIPLADFELISVACQGVVMVVRARHGQ
A0A2V9HAK9      ELFIGTRWQEFLGHCGE-MF--K--VILIDAPPILHLADFELISAACDGIVMVVRAHHGQ
A0A1Q7FS15      ELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLMVVRAHHGQ
A0A1Q7K9P1      ELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLMVVRAHHGQ
A0A1Q7N989      ELFTGTHWQEFIARCSE-LF--K--VILIDTPPILPLADFELISAACDGVLMVVRAHHGQ
A0A2V9G7Y0      ELFTGTRWQEFLGQCGE-MF--K--VILIDAPPIRPLADFELISAACDGIVMVVRAHHGQ
A0A2V8T7Z1      DVLRSPRFEEFLRQARE-SY--D--SVVLDTPPLLMVPDCRQLSAWVDGILLVVAAHRTP
A0A2V7U8G5      QALESPRIGQLLEQARD-AY--E--YVVLDTPPVLLVPDCKLMSQWIDGFLLVVAAHRTP
A0A2V7UNP9      RVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWIDGFLLVVAAHRTP
A0A2V7VLD7      RVLESARVGQLLDTARG-SY--D--CVILDMPPVLLVPDCRLMSQWIDGFLLVVAAHRTP
A0A2V7XGA3      RLFDSARVGQLLDQARR-RY--D--HVLVDTPPVLLVPDCRLMSQWVDGFIVVVAAHRTP
A0A2V7YAG6      RVFDSPRVGELLEQARR-TY--D--YVVLDTPPVLLVPDCRLMSQWVDGFLIVVAAHRTP
A0A2V7VK33      ELLRSPRLADLLAEARQ-QY--D--YVVVDTPPLLLLPDCRAVAQQVDGFLLVGA-----
A0A3M1VTE1      GLLSSGRMAGLLAEWRS-RF--Q--RVVVDTPPIVPFADAGILGELSDGVLLVARAGRTP
A0A2V7TTM7      QILESPRIGQLLQEARR-SY--D--RVVLDTPPLLLVPDCRLLSQWVDAFVIVVAARRTP
A0A2V8VI82      DVLKSPRMGEIVQAARR-RY--D--TIVIDTPPIVPVPDSRVLAKWVDGFLLVVAAHRTP
A0A2V7U4P9      EILRSPRVAELLAEAHS-LY--D--YVIIDTPPVIPCPDYRLLEPFIDGVMLVVAADKTA
A0A2V7TQY5      EMLKSPRLGQLIGQARD-RY--E--YVVIDTPPLVPVPDARVVEKWVDGFVIVVRAHRTP
A0A2V7TU87      ELLRSSRLGDLLDQARR-DY--D--YVVLDTPPLVPIPDARVISKWVDSFLLVVRANTTP
A0A2V8SEH0      EVLKSPRLGDLFQEARR-RF--D--YILVDTPPIVPVPDCRVISKWVDGFMVVVAAHKTP
A0A2V8VU54      EVLKSPRFGAVLEEARR-MF--D--YVVVDTPPLIPVPDCRLIARWVDGLLMVVAAHRTP
A0A1Q7RML7      EALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTP
A0A1Q7ZIQ5      EALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTP
A0A2V8TKD8      EALKSPRLGALFEQARR-LF--D--YIVVDTPPLVPVPDCRLLARWVDGLLMVVAAHRTP
                                   :      ::.* .*     :            .        

A0A1F2U8T6      RQVAEHAIETILSSRPKLLGVVLN----KV-----DFARNKY-----YYSRY--------
A0A2V8BV42      RRLAERALETIMSSRPRYAAIILN----RV-----DFARNKY-----YYSRY--------
A0A2V8F916      RRLAERALETIMSSRPRYAAIILN----RV-----DFARNKY-----YYSRY--------
A0A1Q7K833      RRLAERAIETILQTRPKYTAVVLN----KV-----DFARNKY-----YYSRY--------
A0A1Q8AMY4      RRLAERAIETILQTRPKYTAVVLN----KV-----DFARNKY-----YYSRY--------
A0A2V8BM40      RRLAERAVETVMQARPKYAAVVLN----KV-----DFARNKY-----YYSRY--------
A0A2V8CRT6      RRLAERAVETVMQARPKYAAVVLN----KV-----DFARNKY-----YYSRY--------
A0A1F2VH76      WRLAERAVETLLSGNPRHLCAVLN----KV-----DFARNKY-----YYSRY--------
A0A1F2R0X5      RRLAERAIETIMEARPRQVGVVLN----KV-----DFARNKY-----YYTRY--------
A0A2V8B278      RRLAERAIETVMQTHPKYAAVVLN----KV-----DFARNKY-----YYHRY--------
A0A2V8CEF9      RRLAERAIETVMQTHPKYAAVVLN----KV-----DFARNKY-----YYHRY--------
A0A2V8KZG2      RNAVQRACRELSAVGARIFGVVLN----NV-----NMKREGYADYQYYYYGY--------
A0A1Q7LG57      TESALYASQRFAEDGTRVLGTVLN----SW-----DPKNSHR--YGYGSYAD--------
A0A2V8YMQ4      REQIRQSQSGIRSAGANLIGVVLN----NV-----TLHTNGY--YGLGIYGS--------
A0A1Q7L5B1      YDVVSTALQELRG--KKILGVVLN----RA-----EEKEATY--GAYPYYGG--------
A0A2V9DKV4      YDVVSTALQELRG--KKILGVVLN----RA-----EEKEATY--GAYPYYGG--------
A0A2V8W380      REQLLHAQSGIRSVGGNLIGVVLN----SV-----DIRTN----GYY-NYGS--------
A0A2V8ZIV5      REQVMQSQSSIRTAGANLIGVVLN----IV-----RLHTN----GYY-GLGM--------
A0A2V9EVA0      SDLARTACQELRE--SRLLGVVLN----GV-----EDDAVGS--PYA-YYGR--------
A0A1Q7RB73      HDLARKACQEFAS--KKIVGVVLN----RV-----KPEYSYG--SQY-YATT--------
A0A2V9K0H7      HDLARKACQEFAS--KKIVGVVLN----RV-----KPEYSYG--SQY-YATT--------
A0A3N5YN96      RPAIERALRQVAP--ARVLGLVLN----DV-----GEI---S--SGY-AYGR--------
A0A1Q7Y646      YATVERLLEQLPR--ERMLGVVLN----RS-----EETMEDS--SAY-YYRR--------
A0A2V8QZU0      YAALERLLEPLPR--ERLLGVVLN----GS-----DEQLSEQ--NYY-YYRR--------
A0A2V8RSQ9      YGTLDRVLEPLPR--ERLLGVVLN----GA-----DSAPDAQ--SYY-YQRR--------
A0A2V9LS17      CEASQKTRDQFKG--RRVLGVVLN----RV-----DPRGSSS--YKY-YDYY--------
A0A2V9AGR3      YENAVKGSSEFRE--KNLLGVVLN----QI-----QEADMYA--GDY-YYGK--------
A0A2V9G0N7      FEVAERAVAEFRE--KNLLGVVLN----GA-----EQGAAY---GEY-YNHY--------
A0A2V9GQ44      FEVAERAVAEFRE--KNLLGVVLN----GA-----EQGAAY---GEY-YNHY--------
A0A2V9HRN3      FEVAERAVAEFRE--KNLLGVVLN----GA-----EQGAAY---GEY-YNHY--------
A0A2V8WG13      HQLAEKASAEFLK--KNLLGVVLN----SA-----EIDASY---GDY-YSGY--------
A0A2V8X987      VGEAEKAAEEFQN--KNLLGVVLN----KV-----EKRDSY---GAY-YHGH--------
A0A1Q7KX94      AAIAERTAAEFQG--KNLLGVVLN----QV-----ERSDSY---GDE-YQNY--------
A0A2V8XHT0      AAIAERTAAEFQG--KNLLGVVLN----QV-----ERSDSY---GDE-YQNY--------
A0A2V9L2P7      RATLSRACSVIRHSGGKILGAVVN----KV-----DARRDGY--YGH-YHYY--------
A0A2V7UMX0      RPLLAEALGVLEP--DKVVGLVLN----GD-----DSFSSEY--YRY-YRGY--------
A0A136K497      YGALDRILEPLPK--DRMLGVILN----QS-----EEVLDES--HYN-YGYY--------
A0A399W9E4      YSALDRILEPLPK--DRMLGVILN----QS-----EEVLDES--HYN-YGYY--------
A0A2V7X0V9      CDVARKAREEFPD--QSLIGVVLN----GT-----SDDAASY--ARY-YYEA--------
A0A2V9X518      FDMARKARLEFQD--KHLIGVVLN----GI-----EADSSPY--SRY-YYGV--------
A0A2V9VC62      YDTAQKARQEFQG--KTLVGVVLN----GI-----TRGDS-Y--SRY-YYEA--------
A0A2V9S1P8      FDVARKARQEFRD--KHLVGVVLN----GV-----STESS-Y--TQY-YYAT--------
A0A2V9RTW2      VDMARKARQEFRD--KHLVGVVLN----GI-----EADSSPY--NQY-YYGA--------
A0A2V9TGF1      VDMARKARQEFRD--KHLVGVVLN----GI-----EADSSPY--NQY-YYGA--------
A0A2V9XEV6      FGMARKARLEFQD--KHLIGVVLN----GI-----EADSSPY--SRY-YYGV--------
A0A2V9Y3Q6      FDIARKARQEFED--KHLVGVVLN----GI-----EPDSSPY--SRY-YYGS--------
A0A2V9R269      IDAARRARAEFTG--RNVVGVVLN----GI-----TAEMSPY--MQY-YYSA--------
A0A2V9PTS3      ADAARKARQEFAD--HNIVGVVLN----GI-----TPELSPY--SQY-YYSV--------
A0A2V9NPF4      ADAARKARQEFAD--HNLVGVVLN----GI-----TPELSPY--SQY-YYSV--------
A0A2V9PNZ0      ADAARKARQEFAD--HNIVGVVLN----GI-----TPELSPY--SQY-YYSV--------
A0A321LMC5      HSAVANALKLIPK--ERRVGVVLN----VA-----EVFNEEV--TYY-YGAK--------
A0A2V8X713      HDLVQTTLQEFRG--KNLLGVVLN----RA-----EREANYG--AYS-Y--G--------
A0A2V8ZLE9      HNLVKTTLQEFRG--SNLLGVVLN----GG-----SEAANYG--GYA-CSAG--------
A0A2V8Y4D3      HDLVKTTLQEFRG--NNLLGVVLN----DA-----SEGANYG--GYS-FRAG--------
A0A2V8Z2X8      RDLVKTTLQEFRG--NNLLGVVLN----GS-----DQDASCA--SYS-YYAG--------
A0A2V9C3F6      HDLVKTTLQEFRG--NNLLGVVLN----GA-----NEGTNYG--GYS-YYAG--------
A0A2V9QMU9      RQALRRARDILLQVNAHATGVLLN----AV-----DLNSGDY---YY-YEYQ--------
A0A2V9QY75      KPALRRTRDILTQVNARVAGVLLN----AV-----NLNSPDY--SYY-YEYQ--------
A0A2V9SVU9      KQALRRSRDLLMQVNARIAGVLLN----AV-----DLNSPDY--YYY-YEYQ--------
A0A2V8W5N5      VDVAEKVCQQLKG--KNIVGVVLN----GA-----EKSDLVD--SHY-HAYG--------
A0A2V8XG53      VDVAEKVCQQLKG--KNIVGVVLN----GA-----EKSDLVD--SHY-HAYG--------
A0A2V9XV04      SDVARKARMEFPD--QMLVGVVLN----GT-----DRDEAEY--ARY-YYES--------
A0A2V9CBY1      FDMAQAACGELRN--KNLLGVVLN----GV-----EEEAIYG--AYG-YY----------
A0A2V9D656      FDMAQAACGELKH--KNLLGVVLN----GV-----EEEAIYG--AYG-YYYG--------
A0A352EZH8      YAQVNELLEQLPR--ERMLGVVLN----RA-----DEELESG--AYY-YQQR--------
A0A0B6X033      YSLLDRLLEPLPR--ERLLGIVLN----GV-----DETLDEH--SYY-YRRY--------
A0A2V8R0I3      YAVVDRLLEQLPR--ERVLGVVLN----RA-----ETRLDDA--AYY-YQSR--------
A0A2V8N1U8      YSIVDGLLEQIPR--ERLLGVVLN----RA-----QAATDET--AYY-YQPR--------
A0A2V8QL35      YAVVDRLLEQLPR--ERMLGVVLN----RA-----QGKPDDA--VYY-YQPR--------
A0A352FU10      YAVVDRLLEQLPR--ERMLGVVLN----RA-----AGKTDDA--AYY-YQPR--------
A0A2V8LCU0      YSVVDRLLEQLPR--ERILGVVLN----RA-----EAKPEDT--AYY-YQPR--------
A0A1Q7NGT0      YSVVDRLLEQLPR--ERMLGVVLN----RA-----EIEPDET--AYY-YQPR--------
A0A2V8MLP9      YSVVDRLLEQLPR--ERMLGVVLN----RA-----EIGPDET--AYY-YQPR--------
A0A2V8PQZ0      YSVVDRLLEQLPR--ERMLGVVLN----RA-----EIGPDET--AYY-YQPR--------
A0A3B9MKY6      YALIDRLLEQIPR--EKLLGVVLN----RV-----DEQFDET--AYY-YQRH--------
A0A3D5SKZ1      YALIDRLLEQIPR--EKLLGVVLN----RV-----DEQFDET--AYY-YQRH--------
A0A2V8NRW2      YAALDRIIEQLPR--ERLLGVILN----RS-----DEQLDET--SYY-YQRR--------
A0A2V8TKR9      RTTVQRARQELQGVGAKIYGVVLN----NI-----DLRRE-------GYDSY--------
A0A2V8LBV1      RDMAMAACRQFSEDRSRVLGTILN----MW-----DPREHNQ--G---HYSH--------
A0A2V8GAF9      RKLLAQALNLLDP--AKLIGVVLN----GE-----DRPLSSH--YGYYYDTH--------
A0A2V8CN98      LDLARTKVAMLENLPIRVVGAVLN----DV-----RLGQ---------MYGE--------
A0A1Q7LC46      KAAFTRTRDLLNSVKSRILGVVLN----AV-----DSSAPDY--Y---YSYR--------
A0A1Q8BDC5      YADTDRAFQAIDR--NKLLGVVFN----DV-----QRLFKTY--S---HYGQ--------
A0A2V9Q1Y8      KPALRRSRDILAQVNARVAGVLLN----AV-----DLDSPDY--Y---YYYE--------
A0A2V8JXG1      RQAVQRACHELSAVGARVFGIVLN----NV-----DLRREGH--D----DYY--------
A0A350D2W9      REALVQTRELIDLLKLRTLGVVVN----SL-----NLENHGY--YGRHYYRH--------
A0A2V9I4J1      FSAIEKAFKVLDR--KKLLGIVFN----DV-----KPMLLHT--H---YDHG--------
A0A2V8PQZ9      YSVVDRLLEQLPR--ERMLGVVLN----RA-----EIEPDET--A---YYYQ--------
A0A2V8D8B1      RTVARTAVEQLANARGRVIGAVLN----RV-----DLDNNAY--Y---YSQY--------
A0A3B9LSB4      RHVVRRSRQLLHDVGAKIFGVVLN----NV-----ALQSHDY--Y---YYQR--------
A0A2V9H7U2      RGAVVRARRVLENAGARILGLVLN----KV-----DVRHNGY--Y---GYYG--------
A0A2V8NJB5      YRSIEGAFRVIDQ--AKLLGIVFN----DV-----KPMLFHT--Y---YKRG--------
A0A2V9JMZ4      FSAIEKAFKVLDR--KKLLGIVFN----DV-----KPMLLHT--H---YDHG--------
A0A2V9MDJ6      FSAIEKAFKVLDR--KKLLGIVFN----DV-----KPMLLHT--H---YDHG--------
A0A2V8QJT6      RDVVRRSRQLLLDVGAKIVGVVLN----NV-----SVRSHEY--Y---YYYQ--------
A0A2V8FSM8      RDAARWAQARFAEDGTAVLGTILN----FW-----NPKTPGY--A---YYKH--------
A0A359M0J2      RDAAMIALRRMAEDGIPLLGTILN----DW-----DPKSGAH--HSHGYGAD--------
A0A2V8JLJ1      LKVIKDSIKRVGR--EQICGVILN----RV-----KVARYGS--Y---YDAY--------
A0A2V9GAQ1      KKAFTRTRDLLSSVKCRILGVVLN----AV-----DSSAPDY--Y---YSYR--------
G8NS05          KHTIRRARDLLLRAGVHITGIALN----AI-----DLNSPE---Y---YGYY--------
A0A2V8KZ20      LKVIKDSIKRVGR--EQICGVILN----RV-----KVARYGS--Y---YDAY--------
A0A3D0NWU2      MHLMRRFKQRLGNIGARIYGVVLN----GI-----KQGSVEY--G---YYGS--------
A0A2V8EPD9      FPLVKRAVEIITH--QRILGVVMN----AI-----DFKHDRN--A---GGYY--------
A0A3N5NSX5      RRLAERAVETLLTSRPHVLGAVLN----RV-----DIIRNKY--Y---YSRY--------
A0A2V8MUA1      LKLIRDAVERMGR--DRICGVLMN----RV-----RNLSSSH--Y---YSRY--------
A0A2V8MBH9      RGVVRRSRQLLTDVGAKIFGVVLN----NV-----SARSHDY--Y---YYYQ--------
A0A3N5ZPQ7      FATIEQGLKVVDR--KKILGVVFN----DL-----DEKESQF--S---YYQH--------
A0A3N5P5F2      RNAAVQAVSQLRSAKANFLGVVLN----RV-----NLSRNAF--F---YAPY--------
A0A2V9G1P7      REQFMHAQSGIRGVGGNLIGVVLN----NV-----DICT-NG--Y---YNYG--------
A0A2V9BCK9      YDLVQTTLQEFRG--KNLLGVVLN----GA-----DEEAT----------YG--------
A0A2V9TMX2      RPALRRACDLLLQVNARVMGIVLN----AL-----NLHSVEG--Y---YYYG--------
A0A2V8N2J7      RELFQHAIEGFEA--ANLLGAVLN----DV-----DYQRSRY--A---YAYE--------
A0A3N6BI26      KEAARKAGNHLTSVGARILGALIN----NV-----DMNAPEY--S---YYYR--------
A0A2V9JMM3      RELFKHAIESFRA--TNVLGVVLN----GA-----DYAGSRY--A---RAYE--------
A0A2V9M815      RELFKHAIESFRA--TNVLGVVLN----GA-----DYAGSRY--A---RAYE--------
A0A2V9A795      RDQVMQSQAGIRSAGANLIGVVLN----SV-----TLHT-KG--Y---YGLG--------
A0A355ESH9      REEVRLVRDRLRQADVKILGAVLN----RY-----RALQAGA--A---AGYR--------
A0A3D0NW85      RQIVRRAKQLLNDVGARIFGVVLN----NV-----DLRSQEN--Y---YYYQ--------
A0A353CAT5      RQVVRRTKQSLIDVGAKIVGVVLN----NV-----NLRSQDN--Y---YYYQ--------
A0A2V9HB55      KAAFTRTRDLLNSVKCRILGVVLN----AV-----DSSAPDY--Y---YSYR--------
A0A2V8CU57      YPLVRRAVESVGA--SRIIGTVLN----RI-----ERG--QM--V---GGYG--------
A0A2V8BDI4      YPLVRRAVESVGA--SRIIGTVLN----RI-----ERG--QM--V---GGYG--------
A0A2V8F8T3      YPLVRRAVESVGA--SRIIGTVLN----RI-----ERG--QM--V---GGYG--------
A0A2V9J901      YDLVCRARSLLYGAGARILGVALN----DV-----DLRREGY--GHNGSYGY--------
A0A2V8MKQ7      RAVVRRTKQQLMDVGANIFGVVLN----NV-----KVE-SHD--Y--YYQGY--------
A0A3M1SNQ5      YSTMTRILEGL-PR-EKMLGVVLN----DS-----EDLLQNE--S--YYRSY--------
A0A2V8QJ59      RAVVRRAKQQLLDIGAHIFGVVLN----NV-----KIEKTHD--Y--YYGGY--------
A0A1Q7HTA7      RHLLEEGLRVL-EH-ARVAGIVFN----GD-----DRPSSA------CYGYY--------
A0A2W0B5E2      KKFVSRARNILDGANARLLGVALN----KV-----HMRHDGY--YGSYYSGY--------
A0A2V8NMG8      RSLVRRSKQQLQDIGAKIFGVVLN----NV-----DLHRHDY--Y--YYHRY--------
A0A2V8TBM7      RAVVRRAKQQLQDVGAHIFGIVLN----NV-----KLEGTDY--Y--YYSGY--------
A0A1Q7HEZ8      RKLLAEALTLL-DP-ATVLGLVFN----RD-----VQP---------LFGYY--------
A0A1Q7JW36      RKLLAEALTLL-DP-ATVLGLVFN----RD-----VQP---------LFGYY--------
A0A1Q7MUR4      RKLLAEALTLL-DP-ATVLGLVFN----RD-----VQP---------LFGYY--------
A0A3N5PFU4      RRLLEEGLNAL-DS-AKVLGLVFN----SD-----VRP---------LYG-Y--------
A0A1F2T1R8      RKLLAEALNLL-DP-AKVLGIVFN----QD-----DRP---------LFGYY-----NSY
A0A2V9BW09      RESTQQVSAAL-DG-AFIAGVVVN----GD-----VNP-LQD--R--YYYSY--------
A0A3M1SSE1      RQIVRRSCQLIQDVGAKIFGVLLN----NV-----NISSQDN--Y--YYYQS--------
A0A2V9GQV7      RERLQNTASTL-DR-KKLLGVVFN----AT-----DVSAKDY--H--GYEYG--------
A0A2V7YV88      FPTLRHAKQMLDRVGGHTLGVVMN----KV-----RASGGSS--Y--SYAYG--------
A0A2V8YCY6      KVAFMRTRDLLASVKSRVLGVVLN----AV-----DSS-APD--Y--YYSYR--------
A0A2V8EGM3      YKAIEHALEAIG--RDRLLGVVLN----GV-----QEH-DRA--E--AYESG--------
A0A2V8FGH1      YKAIEHALEAIG--RDRLLGVVLN----GV-----QEH-DRA--E--AYESG--------
A0A2V8D468      RRIAQWALDQLGLAQATMFGAILN----GI-----NVD-RHP--Y--YYSGY--------
A0A1F2R977      YPLVQRAVAAL-GP-DRLIGIVLN----RV-----EEQTITA--D--AYYRH--------
A0A2U3LF12      RELLQRAVESL-GA-TNIVGVVLN----DV-----EYG-DTR--Y--AYAYR--------
A0A3N5G7M6      IPASRSAVDQLRRAPAPLLGVVLN----RA-----DLK---------RRGYYTRYYRRAY
A0A1F2S3Q7      RKLLGEALNLL-DA-SKVLGIVFN----RD-----AHP---------LFGYY--------
A0A2V8GVG4      RKLLGEALNML-DP-GKVLGIVFN----RD-----AKP---------MFGYY--------
A0A143PNR5      YALVQKAVQAL-GK-PKIFGVVLN----RL-----EDHITVH--S--GYGKY--------
A0A2V8PJQ0      RAVVRRAKQQLLDVGAHIFGIVLN----NV-----KLD-THG--Y--YYGGYYGRYYYKY
A0A3N5YKY1      RPAIERALRQV-AP-ARVLGLVLN----DV-----GEI-SSG--Y--AYGRV--------
A0A2V8H566      YRLVHRAVEAV-GR-DRIFGVVLN----KV-----AVQ-DLW--R--DYGSY--------
A0A2V8UVN4      RKLCMQAIDIV-PK-DRLLGVVLN----CV-----RDW-F-------LWKTQ--------
A0A321LXF5      LETFTKTCARV-DP-KKLAGVVLN----AC-----EEV---------GDKDY--------
A0A1Q7JFB1      HKLIMRAIDAL-GR-NRILGVVLN----RV-----DPS-CLA--G--GYG-Y--------
A0A2V8DMJ9      RTLVAEALNVL-DP-AKIAGVVFN----AD-----DRS-RP------SEYGY--------
A0A2V8GGF6      RKSLARALDML-DP-SKLIGIVFN----GD-----DAS-GS------HQNSY--------
A0A2V8HKU7      RKSLARALDML-DP-SKLIGIVFN----GD-----DAS-GS------HQNSY--------
A0A1Q6Y875      SDLARTACQEL-RE-SRLLGVVLN----GV-----EDD-A-------LGSPY--------
A0A2V8DZN4      RDAARWAQARFAEDGTAVLGTILN----FW-----NPK-TPG--Y--AYYKH--------
A0A2V8I604      KPAIERALSGL-DA-SKVLGIVLN----EA-----GSD-G-------AGYAY--------
A0A2V8J066      KPAIERALGGL-DT-TKVLGLVLN----EV-----GAE-A-------TYQDY--------
A0A1I6MMC5      FETAQRALSQL-KA-SNVLGIVLN----AV-----SDP-P-------VSGGY--------
A0A2V9D5W7      AEIAQRARQEL-QD-RNVLGVVFN----SV-----QES-IV------SYGSY--------
A0A2V9D4I4      AEIAQRARQEL-GG-RNLLGVVLN----AV-----SEK-AL------AYGSY--------
A0A2V9D6L7      AEIAQRARHEL-EG-RNVLGVVLN----SV-----SEK-GL------AYGSY--------
A0A2V8ZJV2      AQIAERTAAEF-QG-KNLLGVVLN----QV-----EKR-D-------CWND---------
A0A2V9AWB5      AEIVERTASEF-QD-KNLLGAVLN----QV-----EKS-D-------SYGA---------
A0A2V8Z1Y8      VDDARKAAEEF-RN-KNLLGVVLN----QV-----EKS-D-------AYIAP--------
A0A1Q8AX10      YDLVQTTLQEF-RG-KNLLGVVLN----GA-----DEE-A-------TYGAY--------
A0A2V9A773      HDLVKTTLQEF-RG-NNLLGVVLN----GA-----NEG-A-------DYGGH--------
A0A2V9AND3      HDLVKTTLQEF-RG-INLLGVVLN----GA-----NLE-A-------NYSSY--------
A0A2V9BTJ7      HEMATKAAAGF-QD-KNLLGVVLN----RV-----DGD-A-------GYGGY--------
A0A2V8W2M7      HETAERAASEF-RN-KNLLGVVLN----RV-----EQA-A-------GYGDY--------
A0A2V8XNW2      HETAERAASEF-RN-KNLLGVVLN----RV-----EQA-A-------GYGDY--------
A0A1Q7CJC1      HETAERAASEF-RN-KNLLGVVLN----RV-----EQA-A-------GYGDY--------
A0A2V9UEM7      SDLARRAREEF-QD-KLLLGVVLN----GI-----PAD-QL------PKSRY--------
A0A1Q7V300      FDIAQRARQEF-GD-N-LVGVVLN----GI-----DTL-P-------EYSQY--------
A0A2V9ZCI3      FDMARKARMEF-RD-KQLLGVVLN----GI-----DSS-SS------AYSRY--------
A0A2V9WCB3      SDAARRARQEF-PE-NALVGFVLN----GT-----SEE-NA------PYARY--------
A0A2V9VQW5      YDTAQKARQEF-QG-KLLVGVVLN----GI-----MRS-DS------YYSRY--------
A0A2V9WTP3      VDMARKARQEF-PD-KVLVGVVLN----GT-----SAD-TE------AYSRY--------
A0A2V9NLA9      FDMARKARQEF-SG-KQLVGVVLN----GI-----DQG-N-------SYSQY--------
A0A2V9RKJ9      FDMARKARQEF-SG-KQLVGVVLN----GI-----DQG-N-------SYSQY--------
A0A2V9RN95      FDIARKARQEF-RD-TSLVGVVLN----GI-----DVG-S-------SYTQY--------
A0A2V9N406      FDIARKARQEF-RD-TSLVGVVLN----GI-----DVG-S-------SYTQY--------
A0A2V9U6D9      FDIARKARQEF-RD-TSLVGVVLN----GI-----DVG-S-------SYTQY--------
A0A2G6HQA4      KAKIEETINAI-GP-ERILGIVFN----DH-----HG------------AYF--------
A0A2V7ZTY7      YKLITRAVDTL-GR-AKIIGVVLN----RV-----DRR-HVA--G--GYT-Y--------
A0A2V7ZVL9      YKLITRAVDTL-GR-GKIIGVVLN----RV-----DRR-NVA--G--GYT-Y--------
A0A1Q7QYI4      HKLIMRAIDAL-GR-NRILGVVLN----RV-----DPS-CLA--G--GYG-Y--------
A0A2V8G9Y9      FRLIQRALDAV-GR-NRIIGVVLN----AV-----KES-DDV--V--GFGYY--------
A0A143PXU3      FAELQAATDAL-GP-GRLLGVILN----AV-----DPR-EI--------HRE--------
A0A2V8D8G9      AAAVERAVAELGGP-DSIIGTVLN----RV-----EEG-RI--------PDA--------
A0A2V8ESQ4      AAAVERAVAELGGP-DSIIGTVLN----RV-----EEG-RI--------PDA--------
A0A1E3Y5Q0      YDFVQRSIAEL-GR-ERILGVVLN----LA-----TPP-TDV--R--YGANY--------
A0A2W4TWK5      YDVVQKAVELL-GR-DRILGVVLN----QA-----EPD-S---------L-A--------
A0A3N5NYV3      ARLVQRTADAL-GR-ERVMGVVLN----RA-----DDL-V---------VSS--------
A0A2V2RJF9      RDVVQMAKQKLVKSDATMAGVVLN----YI-----DLTDPYY--YYSYYSRYYAYRYGEQ
A0A2G6HNT3      KAKVEETINAIGP--ERILGIVFN----DHHGAYFSKSSKYG--YGYGYGSKYE------
A0A2V7YWD4      RKLLEETFALLGP--AKILGLVFN-----------RESYKGS-RYGRYYYAYSSRS----
A0A192WXK4      KPMFKQAIGSLTS--APVVGTVIN----DVTFNLPDRQSHYSGYYNWYYYEDRKK-----
A0A2V2R8T6      YSVVDKLLDQLPR--DRVLGVVLN----RT-----DEALEPSTYYQYRYYNQRSLPPGDP
A0A1Q7RGF1      REVLQKCAGQIDP--KKLLGVVYN----AV-----ESGAHDHYSYGGYTAARKEST----
A0A2V9BLX2      REVLQKCAGQIDP--KKLLGVVYN----AV-----ESGAHDHYSYGGYTAARKEST----
A0A2V9ZA03      KKLLRKSLESIEN--LKLIGVVMN----GS-----QDADHQY--YRQYYKSPANSRASAG
A0A3N5ZNH4      KDVVRKAGGHLVGVHARILGAVIN----NV-----NMDAPEYVHYYRHYYDETYSNDFSA
A0A2V8GEZ2      YRVVQRSADALGR--DRIIGVVLN----RAAAAPFERAYG-YGGYGGYYGAHSHEDQEQA
A0A3N5ZFD3      YASVQRAVAAIGR--DKIIGIVLN----RA-----ERPAGTYGNYERYYAGYAKRTEG--
G8NXD3          RAAVQRAAEMLGE---HLSSLIFN----DV-----TMSIAAG--YGANYDRGYR------
A0A2V9VR38      KQALRRSRDVLTQVSANVVGVLLN----AV-----DLSSPDY--Y--YYYEYQGKYARYY
A0A2V9EY04      RETLQKSASSVDR--KKLLGLVFN----GT-----DANEKHY--YGYKYAEAKA------
A0A2V9HAK9      RETLQKTASTLDT--KKLLGVVFN----AT-----DVSVKDY--DVHEYGY---------
A0A1Q7FS15      RETLQKTARALDP--KKLLGLVFN----AT-----DVSRKDY--YGYGYGSSKS------
A0A1Q7K9P1      RETLQKTARALDP--KKLLGLVFN----AT-----DVSRKDY--YGYGYGSSKS------
A0A1Q7N989      RETLQKTARALDP--KKLLGLVFN----AT-----DVSRKDY--YGYGYGSSKS------
A0A2V9G7Y0      RETLRKTASTVDK--KKLVGVVFN----AT-----DVSVKDY--DGYE------------
A0A2V8T7Z1      RRLVEEALNVMEP--DRLVGLVFN----GD-----DRPLSGY--Y-RSYRAYG-------
A0A2V7U8G5      RKLLGEALSALDE--SKMLGIVFN----GD-----DRPMGGY--YGKYYGGYYHDRSRRE
A0A2V7UNP9      RKLLGEALSAMDE--AKVLGIVFN----GD-----DRPLSGY--YGGDYRSYYHHPSAPR
A0A2V7VLD7      RKLLGEALSAMDE--AKVLGIVFN----GD-----DRPLSGY--YGGDYRSYYH------
A0A2V7XGA3      RKLLVDGLGALEE--GKVLGVVFN----AD-----DRPLSGY--FGR-YEGYYGYHQPH-
A0A2V7YAG6      RKLLAESLGAIHQ--DKVLGIVFN----AD-----DRPLSGY--FTR-YQGYYGYGQPAN
A0A2V7VK33      ---VAAALDALEE--EKTIGIVFN----NE-----NRPPSSY--YKRYY-----------
A0A3M1VTE1      KALIEQVVEEAGS--VKLLGVVLNDWTGSL-----ADRRTGY--DSRYYSRYY-------
A0A2V7TTM7      RKLLAETLGSVDA--GKLAGIVFN----GD-----DRPLGGY--YKGYYMGYDGDRA---
A0A2V8VI82      QRLVEEALHLLSH--AKVAGIVFN----GD-----DRPSSAY--Y-GYYYGYG-------
A0A2V7U4P9      REMMDTALDLLDK--PKTLGVIFN----GE-----TPQADRS--S-YYYSAAR-------
A0A2V7TQY5      QRLLEDALNMVSP--EKLIGLVFN----GD-----QRPTSRH--Y-GYYSSYY-------
A0A2V7TU87      RSLLEESLNLMEP--QKVLGLVFN----ND-----ERPRTTY--N-DYYAGSGRHDKGGA
A0A2V8SEH0      RRLLQEALNVTEP--GKLMGLVFN----RD-----ERLLTRA--Y-GYY-GYG-------
A0A2V8VU54      RKLVEEGLNLMEP--SKVIGIVFN----GD-----ARAFSGY--Y-GYYHAYG-------
A0A1Q7RML7      RKLVEEGLNLVDP--AKAIGVVFN----GE-----RRSRSGY--Y-GYYHAYG-------
A0A1Q7ZIQ5      RKLVEEGLNLVDP--AKAIGVVFN----GE-----RRSRSGY--Y-GYYHAYG-------
A0A2V8TKD8      RKLVEEGLNLVDP--AKTIGVVFN----GE-----RRSRSGY--Y-GYYHAYG-------
                                       *                                    

A0A1F2U8T6      --------YGRQYENHYAEAV---------------------------------------
A0A2V8BV42      --------YGHQYKNYYAEATG--------------------------------------
A0A2V8F916      --------YGHQYKNYYAEATG--------------------------------------
A0A1Q7K833      --------YGHQYKNYYAEATV--------------------------------------
A0A1Q8AMY4      --------YGHQYKNYYAEATV--------------------------------------
A0A2V8BM40      --------YGHQYKNYYAEAVS--------------------------------------
A0A2V8CRT6      --------YGHQYKNYYAEATS--------------------------------------
A0A1F2VH76      --------YGHQYKSYYAEAPAA-------------------------------------
A0A1F2R0X5      --------YGHQYKNYYAEKAS--------------------------------------
A0A2V8B278      --------YGHQYKNYYAEAAI--------------------------------------
A0A2V8CEF9      --------YGHQYKNYYAEAAV--------------------------------------
A0A2V8KZG2      --------SSKEEVSEN-------------------------------------------
A0A1Q7LG57      --------YEEYVGQ---------------------------------------------
A0A2V8YMQ4      --------NGNSHSETISDPAEPWNRLSK-------------------------------
A0A1Q7L5B1      --------NGMDKK----------------------------------------------
A0A2V9DKV4      --------NGMDKK----------------------------------------------
A0A2V8W380      --------YGSNRGDPPQETFVPTNLHLPPQQKASD------------------------
A0A2V8ZIV5      --------YGMNGNSHGKTSSDEADSWRTLSK----------------------------
A0A2V9EVA0      --------SEHVRS----------------------------------------------
A0A1Q7RB73      --------PETKK-----------------------------------------------
A0A2V9K0H7      --------PETKK-----------------------------------------------
A0A3N5YN96      --------VDNQNAGRRVARSGA-------------------------------------
A0A1Q7Y646      --------YYRRDDAVEDKTEKEVDEKA--------------------------------
A0A2V8QZU0      --------YGSRRDAGK-------EQEG--------------------------------
A0A2V8RSQ9      --------YYRRDETQPGAPTKDVEEDV--------------------------------
A0A2V9LS17      --------RGAAENANGKGRRAKT------------------------------------
A0A2V9AGR3      --------TYGRTRK---------------------------------------------
A0A2V9G0N7      --------TGR-------------------------------------------------
A0A2V9GQ44      --------TGR-------------------------------------------------
A0A2V9HRN3      --------T---------------------------------------------------
A0A2V8WG13      --------ATDDQKDSY-------------------------------------------
A0A2V8X987      --------LSENAEKAT-------------------------------------------
A0A1Q7KX94      --------YAERD-----------------------------------------------
A0A2V8XHT0      --------YAERD-----------------------------------------------
A0A2V9L2P7      --------GYYSKGYYDYAEGKGNGQG---------------------------------
A0A2V7UMX0      --------GTAARQSSDLTPGEAADGASRAPDSPPSSHPSTIQE----------------
A0A136K497      --------NYRRMAEDAAS-----------------------------------------
A0A399W9E4      --------NYRRMAEDAAS-----------------------------------------
A0A2V7X0V9      --------YEKRQPTTV-------------------------------------------
A0A2V9X518      --------NGNNKEMQETVQG---------------------------------------
A0A2V9VC62      --------YEKTAKPKA-------------------------------------------
A0A2V9S1P8      --------YG-RTNGRHESQG---------------------------------------
A0A2V9RTW2      --------YG-RPDAKGATQR---------------------------------------
A0A2V9TGF1      --------YG-RPDAKGATQR---------------------------------------
A0A2V9XEV6      --------NGNNKEMQETVQG---------------------------------------
A0A2V9Y3Q6      --------YG-NKETQETIQG---------------------------------------
A0A2V9R269      --------YSPNVRTEDKN-----------------------------------------
A0A2V9PTS3      --------YSEDGKAKG-------------------------------------------
A0A2V9NPF4      --------YSEDGKAKG-------------------------------------------
A0A2V9PNZ0      --------YSEDGKAKG-------------------------------------------
A0A321LMC5      --------NKRRGWFGKKH-----------------------------------------
A0A2V8X713      --------YGVDTK----------------------------------------------
A0A2V8ZLE9      --------FGLAKR----------------------------------------------
A0A2V8Y4D3      --------FGTDKK----------------------------------------------
A0A2V8Z2X8      --------FELDRK----------------------------------------------
A0A2V9C3F6      --------FGMDKK----------------------------------------------
A0A2V9QMU9      --------GKHGQRYFGQDEPAIAEEAKATSSGA--------------------------
A0A2V9QY75      --------GKHGQRYY--------------------------------------------
A0A2V9SVU9      --------GKYGHRYY--------------------------------------------
A0A2V8W5N5      --------YGEPMETPVSGLRRRVSPLHSWGPR---------------------------
A0A2V8XG53      --------YGEPMETPVSGLRRRVSPLHSWGPR---------------------------
A0A2V9XV04      --------YEKKPALPSVLPASRSCAAGGRGPDCLVVVCRGDHPSEPGELVASAERGGWV
A0A2V9CBY1      ------------------------------------------------------------
A0A2V9D656      --------GNGTGGE---------------------------------------------
A0A352EZH8      --------HYRQPRVP-------AGEDR-------------------------------L
A0A0B6X033      --------YRRA------------------------------------------------
A0A2V8R0I3      --------YQRQSPLVEAG----TEEV---------------------------------
A0A2V8N1U8      --------HQRAATEF-------VEDTV-------------------------------A
A0A2V8QL35      --------YQRAASAAD------VGDA---------------------------------
A0A352FU10      --------HQRVASAAT------TDVA---------------------------------
A0A2V8LCU0      --------HVRSVAVPDAPSKVKASEE---------------------------------
A0A1Q7NGT0      --------HQRMMAAP-------VEGT---------------------------------
A0A2V8MLP9      --------HQRVMAVP-------LEET---------------------------------
A0A2V8PQZ0      --------HQRVMAVP-------LEET---------------------------------
A0A3B9MKY6      --------YYNR-DRG-------LTEAK-------------------------------T
A0A3D5SKZ1      --------YYNR-DRG-------LTEAK-------------------------------M
A0A2V8NRW2      --------YYRREDKG-------ITKSA-------------------------------T
A0A2V8TKR9      -YYHYNRYYGGYPSDTNV------------------------------------------
A0A2V8LBV1      -YYDG-----YYTYYAKK------------------------------------------
A0A2V8GAF9      -ARDRHAGWWRRVWNARHSQGPQHLR----------------------------------
A0A2V8CN98      -YYGY-----MAGYGTTTEDGGTRIARRRLQGAL--------------------------
A0A1Q7LC46      -YYPY-----SYGYGPQEAGEPAQGDDASESVTEALSRHHDDDSQAL-------------
A0A1Q8BDC5      -YYYG-----PPADAKKVKGPKSKNYLQS-------------------------------
A0A2V9Q1Y8      -YQGKYGQRYYDEDMTGGDSVRAASGSA--------------------------------
A0A2V8JXG1      -YYSY-----QYSYSADGKRTKT-------------------------------------
A0A350D2W9      -YYKESRG----------------------------------------------------
A0A2V9I4J1      -YYRYGKQGAYPYYGTRKPRSRSKTYLEN-------------------------------
A0A2V8PQZ9      -PRHQRMMAAPVEGTEYDQGAANPEMIYLEEDMVS-------------------------
A0A2V8D8B1      -YRRQ-----YGEYYTSTSASA--------------------------------------
A0A3B9LSB4      -YYGA------RNYKSDGDDDIEPTSHARRNGSHNTLDLN--------------------
A0A2V9H7U2      -HYYY-----SSGSGKTKRTPASESVSSHLQG----------------------------
A0A2V8NJB5      -YYDYGRDSQYMYSRGRKRLEKPKNYLES-------------------------------
A0A2V9JMZ4      -YYRYGKQGAYPYYGTRKPRSRSKNYLES-------------------------------
A0A2V9MDJ6      -YYRYGKQGAYPYYGTRKPRSRSKNYLES-------------------------------
A0A2V8QJT6      -RYYH-----QSYYTQDPSEEVVATRS---------------------------------
A0A2V8FSM8      -YYAG-----YYHYYGDGSGKGGGNSVGPQDGEEPVAAERAAGASRWVADVDVHPDEGSR
A0A359M0J2      -YYSK-----YYEYQTMAESGKSGTS----------------------------------
A0A2V8JLJ1      -YRQP-----LNESSQRNSNLQLREGI---------------------------------
A0A2V9GAQ1      -YYPY-----SYGYGPQEAAEAPHEEDSEAIAHRVSRDRDDDSQAL--------------
G8NS05          -GYSG-----YSGYGSAGMDAAGWESQSGKSTGKGQK-----------------------
A0A2V8KZ20      -YRQP-----LNESSQRNSNLQLREGI---------------------------------
A0A3D0NWU2      -GYYD-----YYKSADADTTTPRMDSDANGNGSNGRA-----------------------
A0A2V8EPD9      -EYYG-----AGYYGAPSTK----------------------------------------
A0A3N5NSX5      -YGYK-----YKNYYVKSNAA---------------------------------------
A0A2V8MUA1      -YRQV-----SLSSK---------------------------------------------
A0A2V8MBH9      -RYYH-----QSYYSHDVESDGADERASA-------------------------------
A0A3N5ZPQ7      -SYYH---------------------PGKDRQSSRTRRRKRNAP----------------
A0A3N5P5F2      -YRRE-----YTDYYSRALRS---------------------------------------
A0A2V9G1P7      -PYGL-----NPDCPSHETVVTANFQMPPQQKASD-------------------------
A0A2V9BCK9      -AYSY-----YAGYGMDRK-----------------------------------------
A0A2V9TMX2      -TQYS-----NNYYSEES--------------PNNKPKAASKIS----------------
A0A2V8N2J7      -YYKK-----LA------------------------------------------------
A0A3N6BI26      -HYFD---------------------------ERYNTDLSSAAG----------------
A0A2V9JMM3      -YYRR-----TY-----------------------YKQNIRTGT----------------
A0A2V9M815      -YYRR-----TY-----------------------YKQNIRTGT----------------
A0A2V9A795      -IYGS------NGNSHSEIISDTADSWGTLSK----------------------------
A0A355ESH9      -YAEA------YGYGAEE-----------------TGSKAGSAA----------------
A0A3D0NW85      -SYYS-----QSQYRRDEE-----------------------------------------
A0A353CAT5      -SYYH-----RDNYRSGD-----------------------DPK----------------
A0A2V9HB55      -YYPY-----SYGYGPQEVVEAPHEEDSEAVTERVSRDDDSEAL----------------
A0A2V8CU57      -FYDY------YGYGTRD------DGARKAGKADAAREAAMDAA----------------
A0A2V8BDI4      -FYDY------YGYGTRD------DGARKAGKADAAREAAMDAA----------------
A0A2V8F8T3      -FYDY------YGYGTRD------DGARKAGKADAAREAAMDAA----------------
A0A2V9J901      --S-----YTGYGAPGSEASSRHGNT----------------------------------
A0A2V8MKQ7      --------YSGYYQAADYQEDTAPNPADSRAASS--------------------------
A0A3M1SNQ5      -QK-----YAEVVDS---------------------------------------------
A0A2V8QJ59      --------YGYYKSNYYTAEEDPEADQGSTAST---------------------------
A0A1Q7HTA7      --------YGYGRGRGGGAARGEHPAWRKAAAPWR-------------------------
A0A2W0B5E2      --------H------------------------A--------------------------
A0A2V8NMG8      --------YSSSYYKAEADDTEQVASSAH----G--------------------------
A0A2V8TBM7      --------Y-SGYYSDDDTAPEGAATAGERPGAG--------------------------
A0A1Q7HEZ8      NSS-----YRGYFGEARTA-----------------------------------------
A0A1Q7JW36      NSS-----YRGYFGEARTA-----------------------------------------
A0A1Q7MUR4      NSS-----YRGYFGEARTA-----------------------------------------
A0A3N5PFU4      DNN-----YRRYFSRAH-------------------------------------------
A0A1F2T1R8      SRY-----YREYFTDPTQIASGA-------------------------------------
A0A2V9BW09      --------YPRHKNA---------------------------------------------
A0A3M1SSE1      -YY-----YNSYYKKEEEEE----------------------------------------
A0A2V9GQV7      --------YGYGKD----------------------------------------------
A0A2V7YV88      --------YGNYGSKSNQGTTTVRSADPSAFQPRITHRERLARIALRLFWRLRSDLDRS-
A0A2V8YCY6      -YYPYSYGYGPQEAGEAAQGEASESVGGAISRHHDDDSQAL-------------------
A0A2V8EGM3      -YY-----YSSQASDNVTS-----------------------------------------
A0A2V8FGH1      -YY-----YSSQASDNVTS-----------------------------------------
A0A2V8D468      --Y-----RKEYTNQYTRTL----------------------------------------
A0A1F2R977      --Y-----YPSSGAKDG-------------------------------------------
A0A2U3LF12      --Y-----YQRHYVGRR-------------------------------------------
A0A3N5G7M6      QAY-----YGHPTPA---------------------------------------------
A0A1F2S3Q7      DAY-----CRQYFPGVSRIAGQA-------------------------------------
A0A2V8GVG4      DAY-----YKDYFP--EQAVTRA-------------------------------------
A0A143PNR5      GGY-----YNDYGRGGQ-------------------------------------------
A0A2V8PJQ0      GYY-----YSDYSDDDGKKAQTASG-----------------------------------
A0A3N5YKY1      -DN-----QNAGRRVARSGA----------------------------------------
A0A2V8H566      --S-----YSYYGYGSPRTKD---------------------------------------
A0A2V8UVN4      -DY-----YSYTEN----------------------------------------------
A0A321LXF5      -KY-----YRYAVGGPSSS-----------------------------------------
A0A1Q7JFB1      -GY-----YSYGERG---------------------------------------------
A0A2V8DMJ9      -GY-----YGYP-----ERVTWWQRLFGTVRSARVR------------------------
A0A2V8GGF6      -YA-----YYTPQGRDRQRRRWWRRG----------------------------------
A0A2V8HKU7      -YA-----YYTPQGRDRQRRRWWRRG----------------------------------
A0A1Q6Y875      -AY-----YGRSEHVRG-------------------------------------------
A0A2V8DZN4      -YY-----AGYYHYYGDGSGKGGGNSVGPQDGEEPVAVERAAGASRWVADVDVHPDEGSR
A0A2V8I604      -DG-----YGYIGG----------------------------------------------
A0A2V8J066      -AG-----YKYVAG----------------------------------------------
A0A1I6MMC5      -YG-----YDAPGKQTT-------------------------------------------
A0A2V9D5W7      -YN-----YPQNGHDEVKKTQAHRNKFRQ-------------------------------
A0A2V9D4I4      -YN-----HGYGNGRVKEPMKEKSD-----------------------------------
A0A2V9D6L7      -YN-----Y---RDHAHDPLKESTNRILD-------------------------------
A0A2V8ZJV2      --Y-----YGGRIVQLETTDRALPAGERLS------------------------------
A0A2V9AWB5      --E-----Y-----QNYHSDRD--------------------------------------
A0A2V8Z1Y8      -DY-----H---------------------------------------------------
A0A1Q8AX10      -SY-----YAGYGMDRK-------------------------------------------
A0A2V9A773      -SY-----YAGFGMDTE-------------------------------------------
A0A2V9AND3      -SG-----YAGVGMDKK-------------------------------------------
A0A2V9BTJ7      --Y-----YSYPSGEE--VKKSS-------------------------------------
A0A2V8W2M7      --Y-----YGSLGEEEQPVLRAS-------------------------------------
A0A2V8XNW2      --Y-----YGSLGEEEQPVLHAS-------------------------------------
A0A1Q7CJC1      --Y-----YGSLGEEEQPVLHAS-------------------------------------
A0A2V9UEM7      --Y-----YGEAVSSPA-------------------------------------------
A0A1Q7V300      --Y-----YTAYGNPNGKDPA---------------------------------------
A0A2V9ZCI3      --Y-----YG-YGDQ---------------------------------------------
A0A2V9WCB3      --Y-----YEAYENKGTATKA---------------------------------------
A0A2V9VQW5      --Y-----YESYEKTARQKA----------------------------------------
A0A2V9WTP3      --Y-----YGAYEKRGTEAKA---------------------------------------
A0A2V9NLA9      --Y-----YDAYGKPNGKNEQR--------------------------------------
A0A2V9RKJ9      --Y-----YDAYGKPNGKNEQR--------------------------------------
A0A2V9RN95      --Y-----YSSYGHPNSKGDGRR-------------------------------------
A0A2V9N406      --Y-----YSSYGHPNSQGDGRR-------------------------------------
A0A2V9U6D9      --Y-----YSSYGHPNSQGDGRR-------------------------------------
A0A2G6HQA4      -SK-----SSKYGYGYGYNYRYE-------------------------------------
A0A2V7ZTY7      -GY-----YGER------------------------------------------------
A0A2V7ZVL9      -GY-----YGER------------------------------------------------
A0A1Q7QYI4      -GY-----YSY--------GERG-------------------------------------
A0A2V8G9Y9      -GY-----YGHYGPQRKRGARRA-------------------------------------
A0A143PXU3      -DY-----YGNY-YGYGSK-----------------------------------------
A0A2V8D8G9      -DY-----YGQYGSSRDGR-----------------------------------------
A0A2V8ESQ4      -DY-----YGQYGSSRDGR-----------------------------------------
A0A1E3Y5Q0      -GR-----YAERTSPPGRR-----------------------------------------
A0A2W4TWK5      -DR-----YQSYYYSPARS-----------------------------------------
A0A3N5NYV3      -DS-----SSSYAYGPNNN-----------------------------------------
A0A2V2RJF9      PKALPPKFIQ--------------------------------------------------
A0A2G6HNT3      ------------------------------------------------------------
A0A2V7YWD4      ------------------------------------------------------------
A0A192WXK4      ------------------------------------------------------------
A0A2V2R8T6      NELVNQQQEVVTVN----------------------------------------------
A0A1Q7RGF1      ------------------------------------------------------------
A0A2V9BLX2      ------------------------------------------------------------
A0A2V9ZA03      HERRLS------------------------------------------------------
A0A3N5ZNH4      A-----------------------------------------------------------
A0A2V8GEZ2      ------------------------------------------------------------
A0A3N5ZFD3      ------------------------------------------------------------
G8NXD3          ------------------------------------------------------------
A0A2V9VR38      REDDSSEHDHDEEHAVEESSPSSSSA----------------------------------
A0A2V9EY04      ------------------------------------------------------------
A0A2V9HAK9      ------------------------------------------------------------
A0A1Q7FS15      ------------------------------------------------------------
A0A1Q7K9P1      ------------------------------------------------------------
A0A1Q7N989      ------------------------------------------------------------
A0A2V9G7Y0      ------------------------------------------------------------
A0A2V8T7Z1      ----YPPRLARAAARRPRLR----------------------------------------
A0A2V7U8G5      TGG------GRSSRQRDQKPRRSSWR----------------------------------
A0A2V7UNP9      RGGWWRSWRGQAKTKRGQKARPQPWR----------------------------------
A0A2V7VLD7      ---WWRSWRGQAKTKRGQKARPQPWR----------------------------------
A0A2V7XGA3      ------------------------------------------------------------
A0A2V7YAG6      GGRSW----WRFPWRRAAQGRFRPWR----------------------------------
A0A2V7VK33      ----GAPPGPRATRNRVTAGRGWRFWR---------------------------------
A0A3M1VTE1      ----GKGGR---------------------------------------------------
A0A2V7TTM7      ----GAGSKGRWSSWWRRRRSGRKPWR---------------------------------
A0A2V8VI82      ----RPRGDGRYDRGERPGSRKVAALWR--------------------------------
A0A2V7U4P9      ----PEPSRWSWFKRK--------------------------------------------
A0A2V7TQY5      ----HEPTNGQGTLWTRIADTAKRPFRSRVSGTAV-------------------------
A0A2V7TU87      PTWWRPFAKIRSVFDPDAAGRRRPERRREIR-----------------------------
A0A2V8SEH0      ----QQHGRARAAERGRGGAPRSQPCP---------------------------------
A0A2V8VU54      ----RPPGRGR---RPPQPATRETAPREAAPEPPLK------------------------
A0A1Q7RML7      ----RPPGRAR---RSGARSPAHDTLR---------------------------------
A0A1Q7ZIQ5      ----RPPGRAR---RSGARSPAHDTLR---------------------------------
A0A2V8TKD8      ----RPPGRAR---RPGARSPAHDTLR---------------------------------
                                                                            

A0A1F2U8T6      --------------------
A0A2V8BV42      --------------------
A0A2V8F916      --------------------
A0A1Q7K833      --------------------
A0A1Q8AMY4      --------------------
A0A2V8BM40      --------------------
A0A2V8CRT6      --------------------
A0A1F2VH76      --------------------
A0A1F2R0X5      --------------------
A0A2V8B278      --------------------
A0A2V8CEF9      --------------------
A0A2V8KZG2      --------------------
A0A1Q7LG57      --------------------
A0A2V8YMQ4      --------------------
A0A1Q7L5B1      --------------------
A0A2V9DKV4      --------------------
A0A2V8W380      --------------------
A0A2V8ZIV5      --------------------
A0A2V9EVA0      --------------------
A0A1Q7RB73      --------------------
A0A2V9K0H7      --------------------
A0A3N5YN96      --------------------
A0A1Q7Y646      --------------------
A0A2V8QZU0      --------------------
A0A2V8RSQ9      --------------------
A0A2V9LS17      --------------------
A0A2V9AGR3      --------------------
A0A2V9G0N7      --------------------
A0A2V9GQ44      --------------------
A0A2V9HRN3      --------------------
A0A2V8WG13      --------------------
A0A2V8X987      --------------------
A0A1Q7KX94      --------------------
A0A2V8XHT0      --------------------
A0A2V9L2P7      --------------------
A0A2V7UMX0      --------------------
A0A136K497      --------------------
A0A399W9E4      --------------------
A0A2V7X0V9      --------------------
A0A2V9X518      --------------------
A0A2V9VC62      --------------------
A0A2V9S1P8      --------------------
A0A2V9RTW2      --------------------
A0A2V9TGF1      --------------------
A0A2V9XEV6      --------------------
A0A2V9Y3Q6      --------------------
A0A2V9R269      --------------------
A0A2V9PTS3      --------------------
A0A2V9NPF4      --------------------
A0A2V9PNZ0      --------------------
A0A321LMC5      --------------------
A0A2V8X713      --------------------
A0A2V8ZLE9      --------------------
A0A2V8Y4D3      --------------------
A0A2V8Z2X8      --------------------
A0A2V9C3F6      --------------------
A0A2V9QMU9      --------------------
A0A2V9QY75      DESQTDENSIAAAS---GGA
A0A2V9SVU9      REEEMDNGGASLPSVRAGSA
A0A2V8W5N5      --------------------
A0A2V8XG53      --------------------
A0A2V9XV04      RQDSGRDSNRALDFALARPV
A0A2V9CBY1      --------------------
A0A2V9D656      --------------------
A0A352EZH8      RLVSELEEDEEVAIAS----
A0A0B6X033      ------EEAKKKAVAEGVAV
A0A2V8R0I3      ADDEATDQPEMIYIEEGFVS
A0A2V8N1U8      REHEDTDQLEMIYLEEDMVS
A0A2V8QL35      G-DAFEDRPGMIYIEEEGVS
A0A352FU10      DREAVEDEPEMIYIEEEGVS
A0A2V8LCU0      RYESTPGEPEMIYIEEEGVS
A0A1Q7NGT0      EYDQGGANPEMIYLEEEMVS
A0A2V8MLP9      EDDHG-ANPEMIYLEEDMVS
A0A2V8PQZ0      EDDHGAANPEMIYLEEDMVS
A0A3B9MKY6      KQLPGERQEEVALVN-----
A0A3D5SKZ1      KQLPGERQEEVALVN-----
A0A2V8NRW2      -QAEMKNAEEVIVAG-----
A0A2V8TKR9      --------------------
A0A2V8LBV1      --------------------
A0A2V8GAF9      --------------------
A0A2V8CN98      --------------------
A0A1Q7LC46      --------------------
A0A1Q8BDC5      --------------------
A0A2V9Q1Y8      --------------------
A0A2V8JXG1      --------------------
A0A350D2W9      --------------------
A0A2V9I4J1      --------------------
A0A2V8PQZ9      --------------------
A0A2V8D8B1      --------------------
A0A3B9LSB4      --------------------
A0A2V9H7U2      --------------------
A0A2V8NJB5      --------------------
A0A2V9JMZ4      --------------------
A0A2V9MDJ6      --------------------
A0A2V8QJT6      --------------------
A0A2V8FSM8      RRPRYARSEA----------
A0A359M0J2      --------------------
A0A2V8JLJ1      --------------------
A0A2V9GAQ1      --------------------
G8NS05          --------------------
A0A2V8KZ20      --------------------
A0A3D0NWU2      --------------------
A0A2V8EPD9      --------------------
A0A3N5NSX5      --------------------
A0A2V8MUA1      --------------------
A0A2V8MBH9      --------------------
A0A3N5ZPQ7      --------------------
A0A3N5P5F2      --------------------
A0A2V9G1P7      --------------------
A0A2V9BCK9      --------------------
A0A2V9TMX2      --------------------
A0A2V8N2J7      --------------------
A0A3N6BI26      --------------------
A0A2V9JMM3      --------------------
A0A2V9M815      --------------------
A0A2V9A795      --------------------
A0A355ESH9      --------------------
A0A3D0NW85      --------------------
A0A353CAT5      --------------------
A0A2V9HB55      --------------------
A0A2V8CU57      --------------------
A0A2V8BDI4      --------------------
A0A2V8F8T3      --------------------
A0A2V9J901      --------------------
A0A2V8MKQ7      --------------------
A0A3M1SNQ5      --------------------
A0A2V8QJ59      --------------------
A0A1Q7HTA7      --------------------
A0A2W0B5E2      --------------------
A0A2V8NMG8      --------------------
A0A2V8TBM7      --------------------
A0A1Q7HEZ8      --------------------
A0A1Q7JW36      --------------------
A0A1Q7MUR4      --------------------
A0A3N5PFU4      --------------------
A0A1F2T1R8      --------------------
A0A2V9BW09      --------------------
A0A3M1SSE1      --------------------
A0A2V9GQV7      --------------------
A0A2V7YV88      --------------------
A0A2V8YCY6      --------------------
A0A2V8EGM3      --------------------
A0A2V8FGH1      --------------------
A0A2V8D468      --------------------
A0A1F2R977      --------------------
A0A2U3LF12      --------------------
A0A3N5G7M6      --------------------
A0A1F2S3Q7      --------------------
A0A2V8GVG4      --------------------
A0A143PNR5      --------------------
A0A2V8PJQ0      --------------------
A0A3N5YKY1      --------------------
A0A2V8H566      --------------------
A0A2V8UVN4      --------------------
A0A321LXF5      --------------------
A0A1Q7JFB1      --------------------
A0A2V8DMJ9      --------------------
A0A2V8GGF6      --------------------
A0A2V8HKU7      --------------------
A0A1Q6Y875      --------------------
A0A2V8DZN4      RRPRYARSEA----------
A0A2V8I604      --------------------
A0A2V8J066      --------------------
A0A1I6MMC5      --------------------
A0A2V9D5W7      --------------------
A0A2V9D4I4      --------------------
A0A2V9D6L7      --------------------
A0A2V8ZJV2      --------------------
A0A2V9AWB5      --------------------
A0A2V8Z1Y8      --------------------
A0A1Q8AX10      --------------------
A0A2V9A773      --------------------
A0A2V9AND3      --------------------
A0A2V9BTJ7      --------------------
A0A2V8W2M7      --------------------
A0A2V8XNW2      --------------------
A0A1Q7CJC1      --------------------
A0A2V9UEM7      --------------------
A0A1Q7V300      --------------------
A0A2V9ZCI3      --------------------
A0A2V9WCB3      --------------------
A0A2V9VQW5      --------------------
A0A2V9WTP3      --------------------
A0A2V9NLA9      --------------------
A0A2V9RKJ9      --------------------
A0A2V9RN95      --------------------
A0A2V9N406      --------------------
A0A2V9U6D9      --------------------
A0A2G6HQA4      --------------------
A0A2V7ZTY7      --------------------
A0A2V7ZVL9      --------------------
A0A1Q7QYI4      --------------------
A0A2V8G9Y9      --------------------
A0A143PXU3      --------------------
A0A2V8D8G9      --------------------
A0A2V8ESQ4      --------------------
A0A1E3Y5Q0      --------------------
A0A2W4TWK5      --------------------
A0A3N5NYV3      --------------------
A0A2V2RJF9      --------------------
A0A2G6HNT3      --------------------
A0A2V7YWD4      --------------------
A0A192WXK4      --------------------
A0A2V2R8T6      --------------------
A0A1Q7RGF1      --------------------
A0A2V9BLX2      --------------------
A0A2V9ZA03      --------------------
A0A3N5ZNH4      --------------------
A0A2V8GEZ2      --------------------
A0A3N5ZFD3      --------------------
G8NXD3          --------------------
A0A2V9VR38      --------------------
A0A2V9EY04      --------------------
A0A2V9HAK9      --------------------
A0A1Q7FS15      --------------------
A0A1Q7K9P1      --------------------
A0A1Q7N989      --------------------
A0A2V9G7Y0      --------------------
A0A2V8T7Z1      --------------------
A0A2V7U8G5      --------------------
A0A2V7UNP9      --------------------
A0A2V7VLD7      --------------------
A0A2V7XGA3      --------------------
A0A2V7YAG6      --------------------
A0A2V7VK33      --------------------
A0A3M1VTE1      --------------------
A0A2V7TTM7      --------------------
A0A2V8VI82      --------------------
A0A2V7U4P9      --------------------
A0A2V7TQY5      --------------------
A0A2V7TU87      --------------------
A0A2V8SEH0      --------------------
A0A2V8VU54      --------------------
A0A1Q7RML7      --------------------
A0A1Q7ZIQ5      --------------------
A0A2V8TKD8      --------------------
                                    

© 1998-2019