BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

270 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKV
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      TDDRGPAGSGQVEVAYRDQRSPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDV
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      SGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPLPTGRERDRAPARRRPLWLVR
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      GSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIG
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      LPLLGDVAVTGLSASEIQRKLTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKA
A0A2V8JK38      -----MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWD
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      LRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHSLRLQFSGASPAPKDLVNLEV
A0A2V8JK38      RTSTLRPWSVGTAAVASTAGQQVTFTFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMY
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      PLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
A0A2V8JK38      SVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAFDIAPQVPATVNITSP
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      --------------------------------------------------------MAQE
A0A2V9R9V4      --------------------------------------------------------MSDQ
A0A321LE75      --------------------------------------------------------MSDE
A0A2V8R8U7      ---------------------------------------------------------MIQ
A0A2V8QMP4      ---------------------------------------------------------MMQ
A0A2V8R4S3      ---------------------------------------------------------MMQ
A0A2V8NJ55      --------------------------------------------------------MMSQ
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ---------------------------------------------------------MSQ
A0A317I2L9      --------------------------------------------------------MMSQ
A0A2V8LLF9      ---------------------------------------------------------MTH
A0A352FRF4      ---------------------------------------------------------MTQ
A0A2V8MKV0      ---------------------------------------------------------MTQ
A0A2V8PYY8      ---------------------------------------------------------MTQ
A0A1Q7YKQ8      --------------------------------------------------------MVSQ
A0A352F3R7      ---------------------------------------------------------MAQ
A0A0B6WXT1      ----------------------------------------------------------MQ
A0A3B9MEU8      --------------------------------------------------------MMSQ
A0A2V8MHG6      -----------------------------------------------------------M
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      -----------------------------------------------------------M
A0A1Q7NJH5      -----------------------------------------------------------M
A0A2V8PJY0      -----------------------------------------------------------M
A0A1Q7Y6W9      --------------------------------------------------------MKES
A0A2V8NC68      --------------------------------------------------------MKES
A0A399WK13      ----------------------------------------------------------MK
A0A352FLX4      -----------------------------------------------------------M
A0A2V8RTL7      ----------------------------------------------------------MK
A0A3E0PCJ6      ----------------------------------------------------------MR
A0A3M1S4R8      ----------------------------------------------------------MR
A0A1Q7YFI6      -----------------------------------------------------------M
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ----------------------------------------------------------MK
A0A3M2D6Y5      ----------------------------------------------------------MR
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      -----------------------------------------------------------M
A0A2V8MM59      -----------------------------------------------------------M
A0A2V8PFE8      -----------------------------------------------------------M
A0A2V8PWS6      -----------------------------------------------------------M
A0A2V8LCT5      -----------------------------------------------------------M
A0A352FTJ9      -----------------------------------------------------------M
A0A2V8G155      --------------------------------------------------MSDT------
A0A2V8HDM7      --------------------------------------------------MSDT------
A0A2V8DRT9      --------------------------------------------------MADQFQLDPG
A0A2V7VYF3      --------------------------------------------------MSKR------
A0A1F2SVH2      --------------------------------------------------MSEE------
A0A2V8AJG9      --------------------------------------------------MSEQFSSNPG
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------MSVPSQ
A0A1F2T595      -------------------------------------------MSTQIPPEFSQKAPASQ
A0A2V8JQV5      -----------------------------------------------------------M
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ---------------------------------------------------------MLP
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          -----------------------------------------------------------M
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      -----------------------------------------------------------M
A0A2V9BCA0      -----------------------------------------------------------M
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      -------------------------------------------------------MTNDN
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ----------------------------------------------------------MS
A0A1F2TPT3      ---------------------------------------------------------MSD
A0A2V8JTQ2      -------------------------------------MSESFELMNQRARDFDPVQLPRV
A0A2V8UZY0      -------------------------------------MSKYFELMNRLRRD-SPLAVSAC
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      -------------------------------------------------------MSQQS
A0A350UIQ4      -------------------------------------------------------MPKPT
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      -------------------------------------------------------MPYDP
A0A2Z5G448      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      -----------------------------------------------------------M
A0A2V8XIF4      -----------------------------------------------------------M
A0A3N5XQP8      ----------------------------------------------------------MA
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9KCS3      -MWRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADST
A0A2U3KC61      -------------------------------------------------MPLQPKRNNSD
A0A2V9Y2R7      -------------------------------------------------MDSPIVVRSAD
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ---------------------------------------------------------MDQ
A0A399WUJ8      ---------------------------------------------------------MDQ
A0A2V9L5B5      -------------------------------------------------------MNESI
A0A2V9L7I0      -------------------------------------------------------MDES-
A0A2V9LK56      -------------------------------------------------------MDEI-
A0A2V9YHT3      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      -------------------------------------------------MYLLFQFSIQL
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------MACWSALLGRNRMQDCCS
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      -------------MCSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCS
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ----------------------------------------------------MVGLNFFL
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ---------------------------------------------------------MEK
A0A3E0PHB0      ---------------------------------------------------------MES
A0A3M2D491      -------------------------------------------------------MNKER
A0A357F267      ---------------------------------------------------------MEQ
A0A353C9L6      -------------IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQ
A0A2V8RQV0      ---------------------------------------------------------MEQ
A0A2V8SJH5      ---------------------------------------------------------MEQ
A0A2V9QB26      ------------------------------------------------------MTEPMD
A0A2V9VYY4      -------------------------------------------------MALQPTRNNSD
A0A2V9KIE8      -----------------------------------------------------------M
A0A352F549      ---------------------------------------------------MKEPSDLSK
A0A3B9MLP9      ---------------------------------------------------MKEPSDLAK
A0A3D5SQ87      ---------------------------------------------------MKEPSDLAK
A0A2V8NW86      ---------------------------------------------------MDKHELPPT
A0A2V8ZHL8      ---------------------------------------------------------MPP
A0A2V9B240      ---------------------------------------------------------MPH
A0A2V9CBM2      -------------------------------------------------------MGEQN
A0A2V8XN17      -------------------------------------------------------MDDQN
A0A2V8WX45      -------------------------------------------------------MEDQK
A0A1Q6YR79      -------------------------------------------------------MDDQN
A0A1Q7VA32      -------------------------------------------------------MDDQN
A0A2V9EY85      -------------------------------------------------------MDDQN
A0A2V9H8K0      -------------------------------------------------------MDDKN
A0A2V9FFE5      -------------------------------------------------------MDDRD
A0A2V9GM43      -------------------------------------------------------MDDRD
A0A1F2RFI7      -------------------------------------------------------MSEEM
A0A1F2RZS3      -------------------------------------------------------MEENN
A0A1F2USE2      ---------------------------------------------MGEEIPDSKREVPDG
A0A2V9C238      -------------------------------------------------------MDPEN
A0A1F2Q9F5      -------------------------------------------------------MSDEK
A0A1F2QQH9      -------------------------------------------------------MSDEK
A0A1F2QXK7      -------------------------------------------------------MSDEK
A0A2V9DEM9      -------------------------------------------------------MDPEN
A0A2V9CYQ5      -------------------------------------------------------MGEQN
A0A2V9BWU8      -------------------------------------------------------MSEPN
A0A2V8ZG48      -------------------------------------------------------MSEQN
A0A2V8Y334      -------------------------------------------------------MGEQQ
A0A2V9AY68      -------------------------------------------------------MSEQN
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      --------------------------------------------------------MVGD
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ---------------------------------------------------MAYSFGYRL
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      -------------------------------------------------------MSRYF
A0A2V8EXP2      ---------------------------------------------------MSTQFRDST
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A3D4VGU2      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A3P0X3W6      -----------------------------------------------------------M
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      -----------------------------------------------------------M
A0A317HKM4      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ---------------------------------------------------MSERDERTH
A0A3N1JHC1      --------------------------------------------------------MRTP
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7YYV7      --------------------------------------------------MELGRYLRVA
A0A2V7Z0J5      --------------------------------------------------MELNRYLRVV
A0A2V7Z3M4      --------------------------------------------------MELNRYLRVV
A0A3M2D9H8      --------------------------------------------------MLPRDYLFLA
A0A399Y5V2      ------------------------------------------MTESHATTLELRDYLGIL
Q01X01          -----------------------------------------------------MECARTL
A0A2V7VMF7      PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRYYAGLV
A0A2V8JK38      PSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLAYWRVI
A0A2V9IXG5      --------------------------------------MQDLNVSESLPQLDIRYILHVL
A0A2V9J2P4      --------------------------------------MQDLNVSESLPQLDIRYILHVL
A0A192WQ77      --------------------------------MVDTTKAAGSGNASPDQTAHFREYWRVI
A0A1Q7RLS4      --------------------------------------------MEEKREIHLLDYWRTI
A0A2V2R525      ------MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGER------QDQSQASLAFYVQII
A0A321LPW6      RVELERVSTA----RVALDAAPPPR---YPALAGAAGTEYGLGYPEEYGRIHLLEVWRTI
A0A2V9R9V4      KRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLP---RYG----EAED-FHLRMLWRIV
A0A321LE75      RTDIERIKPE----EMAFGRPGYPRAVGYPEAYATGSYGYG----EADDRINIRAIWRTV
A0A2V8R8U7      DERL--V-------P-AGRGLDNSLADLTQAKPFGRYDRYN----SAPAETNVREYLYVI
A0A2V8QMP4      DNRL--L-------PLTPETLDRPLRDLAQPSP--VAV-------SSNEPVNLRDYLAVV
A0A2V8R4S3      DNRL--L-------PLTPETLDRPLRDLAQPSP--VAV-------SSNEPVNLRDYLAVV
A0A2V8NJ55      DNRL--L-------PLTSTSLDRPLSDLAQ-SK--KYYGV-----SATSETHLRDYLAII
A0A2V8Q7I0      ------M-------PAVDRGLEKPQTD----QI--RSYGP-----AANEPTQLRDYLFVV
A0A2V8S6K4      DNRLLPL-------PTPAGNIDRPLRDLTQPAV--QVTGSY----SLPEPTHLRDYLNIV
A0A317I2L9      DNRLMPM-------PAVERSLDKPLTDLN--AA--RSYGP-----AANEPTQLRDYLFVI
A0A2V8LLF9      DEHLVPA-------RT-GRDFDSTLADLTQSKPYGKYARYG----TTQSETNVKEYFFII
A0A352FRF4      DERLVPA-------RP-ARDLDRTLAELTQSKGYGGRYG-G----GSPAEVNLKEYLFVV
A0A2V8MKV0      DERLIPA-------RA-GRELDRSLADFATAKPYERY---G----AAGVETSLRDYLFVI
A0A2V8PYY8      DERLIPA-------RA-GRELDRSLADFATAKPYDRY---G----ATAVETSLRDYLFVI
A0A1Q7YKQ8      DNRLLPL-------PQ-ERGLDRPLSSLPHSKSYG-Y---G----AAAESTHLRDYLNVV
A0A352F3R7      DNRLLPV-------SALDRSIDRPLADLVPAKPYG-----T----SGSEPTTLRDYLFVV
A0A0B6WXT1      DNRLLPL-------SQTEQQLDRPLHDLTLGQP-------A----TFIEQAHLREYWAIV
A0A3B9MEU8      DNRLLPV-------SALDRSIDRPLADIAQAKPYG-----V----SGADTTTFRDYLSVV
A0A2V8MHG6      KEPTELIEKSNGS-RDVGGVLERSLTPYTRYDSYEDES---------NGYSRLRDYWRSV
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      KEPAELIEKSNGS-RDVGGVMERSLAPYTRYDSYADES---------NGYHRLRDYWRSV
A0A1Q7NJH5      KEPTELIEKSNGS-RDVGGPWDRSLAPYTRYDSYADDS---------NGYSRLRDYWRSI
A0A2V8PJY0      KEPTELIEKSNGS-RDVGGPWDRSLAPYTRYDSYADDS---------NGYSRLRDYWRSI
A0A1Q7Y6W9      RELITRVKEANEL-EVAGETFSPSPSAYKGYDSAAEDE------------VHLLDYWRSI
A0A2V8NC68      SRPTETTALVHGN-GNSGEPLM-QPSFRQDYRYMGEDSFQT----SGGGYARLREYWCSI
A0A399WK13      ETRNIITTTSPEP-VELQRPPDPAIPTTGR-YPGYSATPQG----EGFQ---LIDYWRAV
A0A352FLX4      NQSTNLSRTNTVPIGDEHIGLERTNGGHVLPGVMQGAYSYE----REERGSRLLDYWRIV
A0A2V8RTL7      EIRELVPTKPNDTVVELERPFETHVIPGTGRYPAYRDVYGP----EGFQ---IVDYWRAI
A0A3E0PCJ6      ESRDIVRNPRTES-AEVERPFEAVAPITNYGYARYRNEDLR----EHSP---LFEYWRII
A0A3M1S4R8      ESRELISTRSAGR-EELEPRWQ--SPSYYPSYKSFSEGSAK-----------IFEYWNAI
A0A1Q7YFI6      EKETQLVKASVEP-RVVELQANGNGAGLPYGSYAYGSSEPQ----EESGFSRLQAYWQSV
A0A136KC10      --------------MEMERPADPTIAATGR-YPGYPQTGQA----EGFQ---LIDYWRAI
A0A2V8SEX6      ETREIIQKPLNEP-VELERHFEPQIVPAGR-YPSYREN-VA----EGFQ---LLDYWKAI
A0A3M2D6Y5      KTNELIVREAQEN-TEVEFRSQPFVSSGNY-YSAATRD-SA----GSLK---LREYWNAI
A0A0B6WWQ6      ----MMKGDPEKE-PQSLIRLDASAPYPKL-YADYDHRWER----EERTQQIVAGYWRAV
A0A3B9MK99      ---------------------------------------------------------MCI
A0A352EX26      NPSNELIRKEPAD-TAIGRPADSNGIPHSY-NYGVDPNA-E----SEVH---LLDYWRAV
A0A2V8MM59      NEGTKLARVETEP-QDLDRRLDDHGP-RPY-AYGYGTNGFD----GEVN---LLDYWRAV
A0A2V8PFE8      NQATKLVKREDEP-GEIDRRFDGSANYRGP-VYGYGPESSE----GEVH---LLDYWRAI
A0A2V8PWS6      NQGTKLVKREDEP-GEMDRRFDDAANYRGG-VYGYGPEGSE----GEVH---LLDYWRAI
A0A2V8LCT5      NEATKLVRRDDQP-REIDRRTGDTTSYRTA--YGYNMDAGE----NEVH---LLDYWRAI
A0A352FTJ9      NEATKLVKQDE-S-RPVERRSDESQPYR-G--YGYGADAGD----GEVH---LLDYWRAI
A0A2V8G155      --------------------KEGLRMMGAPAPG----DYALNDAALPPASPHVVNSLMVV
A0A2V8HDM7      --------------------KEGLRVVGAPAPG----DYALNDAALPPASPHVVNSLMVV
A0A2V8DRT9      DLDNQKKNLAP---------RPRRAVRAASGKP--------AAAEHALEEVHLSDYVKIM
A0A2V7VYF3      ----------IGHDETAEDTRPQAESYWNDDRD---------ADNAAPEEAHLLEHLRVL
A0A1F2SVH2      --------------------SPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLDYVKVL
A0A2V8AJG9      PAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRG---PAYGYGSNVIGDGEVHLLDYVKVL
A0A2G6PYV5      --------------------------------------MQDNQPFDQQADFNIFHYIGLL
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      FERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIHYLQVL
A0A1F2T595      GSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDS------ELTLVHYLQIL
A0A2V8JQV5      DMEFSEHDLTNKGNGEPSQDPVRKVSKSGKPQQSPAYSGPMTS------PAGVFDYWRVF
A0A2V9AC41      ---------MEQVNQPSPYFIKRTARVEQGTIDLNEFAVVDDQ------VHPLREYWLTI
A0A2V8K4L4      ----------MRNHDDSSNLPVPFTPPPGNQLSTPLQARFMPEPQEEASREGVVAYWRMV
A0A2V8NCZ3      ----------MKDQDDSSNLPVPFKSARGSQLPTPVPARFTAE--DDSSREGVVAYWRMV
A0A2V9MAM9      VSKLSKAPQRPSHSLSRAEFQRLARPSPEALAAGTSAEIETG-------SLSIIEYLRVL
A0A2V9M454      ---------MNGDELVPLNSGPVTPPPNRNGSGP----HSYIDLEQVDAFGQLRATWDIL
A0A2V9IVR7      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9ILE2      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9LGY4      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9J4D6      --------MTHRSRFTPSSASLRPGSSNAPPSFA--PLPSCASAGG------------KS
A0A2V9L9C5      ----------MREEFGKSGTLVGRAINDSPEPIH--PIISITSAGEFE--RPSVLRAIAV
A0A2N9M9N1      -------------MAENDKLIPVSAVSSDRLGYSGYPVTDLDPAGSEA--YSFQSYWEIL
A0A2V9JEC4      --------MPRNTDHEQTASARSETALSERPAIGEYVVPQLEDAEGGA--SAFRVYWHVL
A0A2V9LPQ3      -----MADIQKLTTTEPAPLARRRAASSESIGFG--LLPT--DFDGFS--SVLRVYWEIV
A0A348V070      MDKITPTTPTTGARQTQQNL-----------------------------LEQILYYWHAV
A0A2Z5G3A3      --------------------------MKTLPSPQSIYTPIPET------PLTISDMGALV
A0A2V7UGP8      ------------------------------------MDVLSQK------EINLVDYWNVL
A0A239MKT6      ---------------------------MAFDNNDASIASDLNDAEQGSSDLTLESVWEFL
A0A3E0PCN7      -MQKNKQLALRPKEEGQETIVYGDYEGDYFDSSYYGGAPAPSE------RQQLMAAIGVL
A0A2V8IYW3      --------------------------------------MIPGH------KYTPQDVLDAV
G2LEI9          PQEHPNNNVMLAPTAAELDLATPTVQDRMRRRGSYQYTLPQEDA-----GQPIRQAFLTI
A0A317J121      -------MRHLNHDQPEPGNNRLPALPNSYFVQPGELTIEPAS------SSPGIDYWHLL
A0A2V7YW66      ----------------------------MSPLSPVPFEEEPEGAAEPASELNFGEYLGIA
A0A2V7Z0V0      ----------------------------MSPLTPVPLDDEPEVAPEPESELNLTEYLGML
A0A2V8GFD4      --MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFDYLRIL
A0A2V8HSS5      --MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFDYLRIL
A0A2V8KP55      ----------------------------------------EED------ETHLLAYWRVI
A0A399WNU1      -MQSNFQVVKRNSRQDPESLDFYDQDDLYPESYYGDSIQEPTE------KQQLFNLLSIL
A0A2V9CG11      -----------------------------MESPPNREVATAGG------YDSFLDYWRIL
A0A2V2R0I6      MADEHKLVRRESGSNVPVEIVPPANRLPAWELSPR--------------EPHLYDYLLVL
A0A2V8XAR9      MADDNKLVPRENGSNGPVELVPLPARLPSWELSPR--------------EPHLYDYLLVL
A0A2V8VZA0      MADENKLVPRENGSSGAVEVVSLSNRVPSFELSPR--------------EPHLYDYLLIL
A0A1Q7CB82      MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPR--------------EPHLYDYLLIL
A0A2V8WIU1      MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPR--------------EPHLYDYLLIL
A0A1Q6Y9F5      MADENKLVPRENGSNGAVELVSLQSRVPSFELSPR--------------EPHLYDYLLIL
A0A2V9EVV8      MADENKLVPRENGSNGAVELVSLQSRVPSFELSPR--------------EPHLYDYLLIL
A0A2V8YF91      MTDENKLVSRGNGSNGAIELAPVTPRFVSFDLSPR--------------EPHLYDYLLIL
A0A2V8XZK2      MAEENKLVPRENGSNGAVELVPNTPRFASFELSPR--------------EPHLYDYLLIL
A0A2V8ZTX6      ----------------HVELAPLPNRFASFDLSPR--------------EPHLYDYLLIL
A0A2V9BT79      MTDENKLVPHENGSNGNVELVPIPGRFASFDLSPR--------------EPHLYDYLLIL
A0A1Q8B793      EENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPH--------------EPHLYDYLLIL
A0A2V9BCA0      EENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPH--------------EPHLYDYLLIL
A0A2V9BWU9      MDESTALMQRDRRAGSSFEVITAHPQFSSWETPPR--------------EPHLLDYWRIL
A0A2V9DKX2      MDESTALIQRDRRAGSSFEVITAHPQLSSWETPPR--------------EPHLLDYWRIL
A0A2V9JSI3      ALAPIEHVPFERVGYRKPSVVTVEAEEFDS-------------------PLDLRHYWNNL
A0A2V9WI32      MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEE------GFLLREYGRIL
A0A2V8IVN9      DIRNFDPSVKLRFEEAANPEDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLDYVRVL
A0A1F2TPT3      EPRSNPPAEATPPDDIRLSMEGTAEPALRRYENDALWQGLEGE------DRHFQYYLAVL
A0A2V8JTQ2      ALSSG--------------------PNPANHYLPRVG---APD------EVFAAGMWRII
A0A2V8UZY0      DIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASD------EMFAAGLWRII
A0A3N5YNR8      ------------MGDLIRREYSSIPDPSIRIQRNTEYQWASDDD-----SLDIRRYFQVL
A0A350UEK1      PPP---GDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLDYWRIL
A0A350UIQ4      PPSNPQGDSASANSRLPVKFEIVDA--PPANSDP---YYGGPQFDSDEEEGGLLEYWRIL
A0A3N6A5T6      -------MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVE------VPHLRDYWNVV
A0A1F2Q9L4      -----------------------MVARRPAAPDKIGFEVEPES------EFHISQWLGVV
A0A1H5SQF5      LQDVTSRSASTHRRSAFRR------------------------------EMHLSDALVIL
A0A2Z5G448      ---------------------MQGPDPASERQQGTSVAGKPAGSDRQDFILTPADFRKIL
A0A3E0NV31      -----------MDRESYFNEDLRRHGGGGVGPGARRGDNDPSE------GIKVRQLIESI
A0A3N5M5V0      ------------MGDLIRREPSSFADPTIRMQRTGNYQWGPDED-----SLDVRRYFQIL
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      KPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPG------YDSLLDYWHIL
A0A2V8XIF4      QASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPG------YDNLLEYWHLL
A0A3N5XQP8      DLAKQSRQGMQERGGGPRLFEPSPSSRD---------------------RSTVRFYWEAI
A0A2Z5G7H4      ---------------------------------MGPRADVRER------PITLGDLRHIF
A0A2V9KCS3      SGALMDQIVHLPKGPQRELIRRTNGGVPASGSLPYGDSPVDQEYGADAVSGGLLYYWHMI
A0A2U3KC61      ALEALEPIDPLPVKGPQSVYPH-----------FAQPQNS------------ILHYWQIL
A0A2V9Y2R7      NLPGQRSLEILDQTPPSCQIPY-----------SYNSYSASGH------AINLLHYWHVL
A0A372IT17      ---MTSPTHILER-----------------------DAMAVYD------EWTVADLLSIL
A0A136JPP4      DQRLTPLPKGLELNQPAGDLTTSYA--------AYYDHESQSG------KRTLRQYVRVV
A0A399WUJ8      DQRLTPLPRGLDLNQPHGELPAAYT--------AYYDHESQSG------QRTLRQYVRVI
A0A2V9L5B5      DVHQRRGLVQGDQDSSGESQHAIEPAFSRSLQESEVLDVSPEE------VPHLLDYWQVV
A0A2V9L7I0      ------------ENLQRDPVRALARTATQPLEKPEILDVSPEE------VPDLIDYWQLI
A0A2V9LK56      ------------QNSNGFQGASLAPRTT-ALPDSRVLDIGPEK------VPSLFDYWQII
A0A2V9YHT3      -------MDSGKLIRAEDAGNGKSSLDFPPPLLPAGYFPATLP------QPALLDYWHIL
A0A2V9NGH6      ---MDSAPLIAANTRVLRELPSAHPVEFRRQFGFGIYNPATFQ------DSVVHEYLRVL
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      GRQMEPSPVMQI-GNQVREM-GPASMQIGRNI-AAIHPAMAAQ------DSILREYLRVL
A0A2V9QD92      ---MEPSPVMQI-GNQVREM-GPASMQIGRNI-AAIHPAMAAQ------DSILREYLRVL
A0A2V9WPZ6      GVGMDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLREYLRVL
A0A2V9ZLH4      ---MEPGSLIPSNGQPVRELQAIAPVEFSQQVGPGVYPPLPTN------DSVLREYLRIL
A0A2V9RQF1      ---------MPANAQGLRESPDPLPVEVNRTTQHYAYPVLPSQ------DSVLREYLRVL
A0A2V9YDK8      ---MDSGPLVQTNGQTIREVQPVYPVEFGRQMLTGIYPTLHPQ------DSALREYLRVL
A0A2V9V8F7      GVGMDSGPLVHTNGHMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLREYLRVL
A0A2V9XGR9      ---MDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLREYLRVL
A0A2V9V3Q5      ---MALGPLVPHNDG-FREIQPAEPTELIKPIGPGLYTVLPSQ------ESALREYLRVL
A0A2V9NWS3      GASMASGPLIPANGQMLREISSLSSFDLNR-QLAAYYPNAPIQ------DSVVREYMRVL
A0A2V9USA9      ---MDSGPLVPANSGVVREI-PLTSPEFGRAAVPQVYPVLPSQ------ESAAGEYIRVL
A0A2V9XW18      ---MDLGPLAPLGTPTIREIQPSQNVDLVRPQDPRFYPPLASH------ESGAREYLRTL
A0A3M2BZG9      -MKMIPSSEQPLPRPAV-RDDFLAYDAAPATATPVPPMPGDAG------ELDVAKYLGAL
A0A1Q7N5R7      -----MPDHTSLRRTPPPPLTAADLSRAGTAVEKF--SPNGDE------GPDWHRYLTVV
A0A3M1SIV3      DERLLPLPKELEANKNAITYQEEGPRYFASYA--Y-GDDILEK------KFNPRDYLLVI
A0A3E0PHB0      NDRLLQIPEIQERRSKK-SLQTAPQDYPPAYSPFY-DDEALGD------SRSIREYFNIV
A0A3M2D491      DERLLPLPKEIQEYELT-S------RYYPSYGG---STELVEQ------RFDPREYLIII
A0A357F267      DQRLTHLPKAVDLRANG-G------DYGSGYSSFY-DEEIADG------RRSLQQYFNIV
A0A353C9L6      DQRLTPLPKSADLRANA-S------EYGSSYSSFY-DEEVIEG------KRTVQQYFRIV
A0A2V8RQV0      EQRLTTLPHLGELRHSK-H------EYAGSYSGAY-SDEVIEG------RRTVQQYFNIV
A0A2V8SJH5      DQRLTPLPKSLDLRASK-T------EYPATYAGFY-DDEVSEG------RRSIQQYFNVV
A0A2V9QB26      KHALPPASHDLVLRKSE-GSPGHGEAGSY----LY-GHRDELE------PGGFVEDWRIL
A0A2V9VYY4      DFEALAPIDPLPVNGHQ-PLHTYFGEPHN----------------------ALLHYWHVL
A0A2V9KIE8      GKSEILPGDRLNRIAPV-SMEQVRGQ-------EF-LEVGHEE------APHLMDYWHLI
A0A352F549      ALEIILKNSALEQSNGS-SHNGHGNPPIV----AYGEEASPEG------EMHLRDYWKTI
A0A3B9MLP9      ALDIILKNSSLEPTNGS-LRNGYATPPIV----AYGEEASPEG------EMHLRDYWQTI
A0A3D5SQ87      ALDIILKNSSLEPTNGS-LRNGYATPPIV----AYGEEASPEG------EMHLRDYWQTI
A0A2V8NW86      SHELVPRKSTEAYPGHG-EAGSYLHGRRD----EF-E------------HGGFVEDWRIL
A0A2V8ZHL8      GVKDMPDNEALSLRGAK-LPVLESPQSPAFPVLGI-DVQDFES------FSYLQAYWNIV
A0A2V9B240      KVKDMPDNQALSLRGPR-LPVPESPHLPAFPVLGT-DVQEFES------FSYLQTYWNII
A0A2V9CBM2      QSEPYSHAHRLARK-RG-SLEASVVELAD----SY-EIIGPEE------GIDLRACGHIV
A0A2V8XN17      QVELYGRGHRLDRRGPG-APDSRVIELPD----SY-EILESGE------ALDLRSYGRIL
A0A2V8WX45      QVELYGRGHRLDRRGPG-ALDGRVVELPD----SY-EILESDE------GLDLRAYGRIL
A0A1Q6YR79      QVELYSRGHRLDRRGPG-ALDGRVLELPD----SY-EILEPGE------ALDLRSYGRIL
A0A1Q7VA32      QVELYSRGHRLDRRGPG-ALDGRVLELPD----SY-EILEPGE------ALDLRSYGRIL
A0A2V9EY85      QVELYGRSHRLDRRGPG-ALDSRIIELPD----SY-EILEPGE------ALDLRSYGRIL
A0A2V9H8K0      QVELYGRDQRLERRGPD-ALNTRVIEMPD----SY-EILESAE------ALDLRSYGRIL
A0A2V9FFE5      QVELYGRRHQLERRGPD-ALNTRIVELPD----SY-EILESGE------ALDLRSYGRIL
A0A2V9GM43      QVELYGRRHQLERRGPD-ALNTRIVELPD----SY-EILESGE------ALDLRSYGRIL
A0A1F2RFI7      SLEKIPPLKGE--------VPATTTVAAY----TI-SQEEEAA------TPSFLDYWRVL
A0A1F2RZS3      SLERVSRGQID--------APASVPVSSY----PV-EVLEEQD------SFPLLEYWRVL
A0A1F2USE2      RIERYEPSPPM--------LARPEPPVPV----AY-ETVETEE------APDLLAYWRVV
A0A2V9C238      KIKLYEPAVRK--------WERLRPTPAV----RA-EPLEMKE------SADLLAYWRVL
A0A1F2Q9F5      SVERYEPAART--------LERRRPGVPA----PL-QTLEMEP------AADLLSYWRIL
A0A1F2QQH9      SVERYEPAART--------LERRRPGVPA----PL-QTLEMEP------AADLLSYWRIL
A0A1F2QXK7      SVERYEPAARA--------LERRRPGVPA----PL-QTLEMEP------AADLLSYWRIL
A0A2V9DEM9      KIKLYEPAVRK--------WERLRPTAAV----RA-EPVEMKE------SADLLAYWRVL
A0A2V9CYQ5      QSEPYRHAHRLVRRTGN-GLEASVVELAD----SY-EILGPEE------GIDLRACGHII
A0A2V9BWU8      KLEPFAQGPRSGHGGLR-FMDNRVVDLSD----SY-EIIEAEE------PVDLRAYGRIL
A0A2V8ZG48      KVELYARDARFERARLG-FLDHRIVDLSD----SY-EILEPDE------PLDLRAYGRIL
A0A2V8Y334      NVELYSRGPRFERGGRA-FLDHRVLDLSD----AY-EIVEPEE------PLDFRAYARIL
A0A2V9AY68      KVELYARRPRFERGGSV-LLDNRVLDLSD----SY-EILEPDE------PLDLRAYGRIL
A0A257VBK0      --------------------------------MADSDPPQVQAEFSAAQDVDLLHWVQIL
A0A2V7XDY0      ----------------------------------MPSPVPAPAGGSSESPIDFRYYGNLL
A0A350UQT3      --------------------------------------------------------VSRI
A0A2U3JZ71      KEMVENNLTPALPAPLEALPGRNLPVPMEVYRTSNLMP----EVEAAPSSVPLSHYLWIL
A0A2V8TTB0      MKKFENNL-PAVP---------------EVYRAAAPVPVIDAEFEPQAPQVPLAHYLWIL
A0A1F2TCR2      ------------------MFDTHDLQQAPAIAIEAPPQLPMPPVAQSQQPLHVLDRLSAV
A0A2N9LQU7      ------------------MQNIPEQQLARVTARGRISGPVPLPPALRNPDVSLGEIWLKI
A0A2P6WFK7      -----------MRPAACQESHMPEIEQDSLATMRESGLKRFGNDSVTERELSVTEISRTI
A0A1F2V330      -----------------------------------------MPSDGTGKEISVLALLDIV
A0A2V8U914      --------------------------------------------------------MRVL
A0A2V7W309      ------------------------------------------MDLNTQQEVHLSQYWNVI
A0A2V8TLH7      -------------------------------------MSENLPIVEEQREVHLLDYWRTI
A0A1Q7ZJT1      -------------------------------------MPDSLNPLEEKREIHLLDYWRTI
A0A2V8VC99      -------------------------------------MPETLAPLEEKRDVHLLDYWRII
A0A348UZU3      -----------------------------------MSENYVDPQSLETAEIDLRKYIDIF
Q01XL7          --------------MNDHYEPESNGSGPHGLPVGPDVRMLPSPSDGWVPEPTKISYWKIA
A0A2V8ERZ5      --------MLPSSPPDAPAPSTTAVTAGSPSHAGSSHGQGSAPHYAPEQDVHLLDRLAVI
A0A2V8GTX0      --------MFTPGGLSTTGP---AAGSPPPVPVHQPQARKTAGLFSPDPNIHLFDRLAII
A0A2V8J0X9      --------MFDTQEVRAQLP---AEVSPSALIALPSSTSQST---------HVLDRLNAV
A0A372IRG7      -----------------------MQGSAIAPQGQQELHPPGGVPPHESPAFTPADFRKII
A0A1F2U158      ----------------MSESSPAHPTPASAPTSSGAPRAPQPLTYAVDKDVHILDRLAVV
A0A2V8F6S9      ----------------MADSTPSGSRPASSASNSNGGVAP-PLTYGTDGDVHILDRLAVL
A0A1I6MH75      -------------------MDRQTTETTSPTGVPHTPGGGFAAATAAT-ETTLSDALMTL
E8WVF6          -------------------MSSDNPYSNPGPGMSQAQQPTFVAPS--N-DTTLSEALITL
A0A1H5Z7N3      -------------------MIPVRAQTSQASESEVVMPQAMQDRA--SGDTTLSDAWLTI
A0A1G7JVV8      -------------------MPPLTNQPSD--RVVPETNAGFSAIT--A-ESALSEALNVL
A0A1H4T6W9      -----------------------MNQPVT--H-DPANPAGFTSTA--A-DSALSEALAVI
I3ZEU5          -------------------MPPATNQPVP--T-DPASPTGFTTTS--A-DSALSEALAVI
A0A428MDU2      -------------------MGLENPQQPGP-GAPETNPTGFSTTV--T-DTTLSEALITL
A0A239HDF6      -------------------------------------MPGSIPQA--A-DASLADALLTL
A0A1Q3QQB6      -------------------MGLQNTQPSADGDTSELNSPRFGSAV--T-DTALSDAILTL
A0A3N1K1G7      -------------------MGPKETPPVA--GAPDLSPSAFSSTA--T-DTTLSEAIITL
A0A2W0BGU4      ----MTNPLMKSDPATRRELVDYEIAPHPTPEPITIAPRYYPDPNASPEAGSLALYWNIL
A0A2W0BVQ9      ----MTNPLMKSDPATRRELVDYEIAPHATPEPITISPRYYPAPNSGPEAGSLALYWNIL
A0A3D1ASD2      -----------------MSEMRLDRSNLPALPSTYSVSHITAEPEARETTVPLTHYVWVL
A0A2N9MK30      ---------MNTSLQELTIVEERGPRSLPVAAGFGPAQPASWDLEPEEQTLPLSHYLWVL
A0A2V9MN96      ----------------------------PYRIGGQ---------------HPLLSYWRIL
E8UZE1          -----------------MKNPGIPDEVAARSSFSA---------------VGLPEIYRLL
A0A2V7V2Z1      RSSSRCPAPTWPPGPSRSERRRGSPAVSPSASSGY---------EGEPQEAHLWEYIYVI
A0A2V7X2F7      -----------------------MASPSQPPPSEP---------AG---EDHLWDYLAVV
A0A2V7V2I1      --------------------------MSTTAPAGQ---------AGVPEETHLWEYLHVV
A0A2V7U3M2      --------------------MEGTSPVTPTPPTSS---------ESEAQETHLWEYIYIV
A0A2V7UHT0      ------------MWPRRTVLSKELSSVTPIPPAGS---------EGEPQEAHLWEYIYVV
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      --------------------------------------------------------MKVF
A0A3E0P0A3      -----------MNLRQRTVAPRESDEAFAGSGDDL---------------KLIAEYGSIL
A0A2V9KBD6      ----------------------MDLSRPEPRLPPKVPSPRVQRVVGAPDEALASTLWRII
A0A2W0AJ66      ----MTRYFELTGEPAPDSAA-QTLVQTPPNLKPGLPNRYTQKVVEALEETFLGNLWRVV
A0A1Q7RBU1      ----MSKYFELMNQLGRDSAAVQ-----LTRAAPNLPNRYPQRLIDAPEQMSTAGLWRII
A0A2V9JPV9      NKDEERRYFELMNQHPRNSLAVQPPSRGVPRSTPNLSNRYPQRVIDAPEQVSAAGLWRII
A0A2V8EXP2      DSLQHRLTMASADAENAGAARAADSGPAAAAPPPTAYGYGSNVVGDDQ--VHLLDYVKVL
A0A2W4RYA1      ---MPDINLDDLDDASRRGAAGDGQPPAGATVPSRAGAQHAHGLDEDHGDVHLRDYVRIL
G8P0Y7          -MSTGRMRGEFAEPVRHDSPRLASLQEMYRPPARE---------------HSISDYWHIL
A0A3D4VGU2      --------MDTLDPQRQSGSAIASADEKTVAPQST---------------INLSDLRKLF
C1F294          --------MDTLDPQRQSGSAIASADEKTVAPQST---------------INLSDLRKLF
A0A3P0X3W6      SSVYNNKPRILPASAPPSQIAHYTGPQAAAEPDEL---------------LPMQHYMWLL
A0A1E3Y9R6      ----------------MAHLPNA-GGRQASAKGGG---------------WHPTDYLRVL
A0A2W4TLP2      ----------------MAHLPPAHGGRAARRGGSS---------------WHPTDYLRVL
A0A3R9WF43      DRSPPKVSITKKEHRSFLAEMQTRAHLAPVNASEY---------------ESLSGLLRVL
A0A317HKM4      ----MSLDSHRPARSDPDSDDARGTGSPDTWGTDT---------------LQIRDYARIV
A0A2W0C122      MDARELIKSNPAELSAQNTPASQGIHYGWARLVPL---------------NPVQRVVRLL
A0A2W0AUU7      MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPL---------------NPMQVVFRLL
A0A2W0BQL1      MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPL---------------NPMQVVFRLL
A0A3P0XH15      -----------MEGPAVQPERQVAAGPQLAPEQAI---------------ITPSDIRKIL
A0A3M1WQW8      LPAPADTGAMDRNVVTRLYPIGYGHERYGTAVERD---------------VHLLDYWRII
A0A3N1JHC1      AGKLRAIAPAETPGPRLPSAGTLDPFRSSTVYGTP---------------EEQIDYLLLL
A0A2V9KA79      --------------------------MQNGTANTS---------------ASLTNLVAIF
G8P085          --------MRVQTTQPDTEGKLDQRSLTEADSASA---------------LSLGDIAQML
Q1ILD9          ----MSATNLATRKDLLPQNGKGARWQPSESDGQK---------------IDFDGLFRII
Q1IJZ6          ------MDSLFRKSELPPLGVSEQSTTNAGLEDED---------------LSLRQVIRIL
A0A2V8TCE6      ---------------------------MTSPREAE---------------SEIREFWSIL
Q1ITG0          ---------MEKFSQIENVQGASRTSWADVQEDRE---------------ADLLHVLYVL
A0A3N5PCI5      --------------MSDTQQPPSEHDAVTSRAEPQ---------------WQLEDVFAVL
A0A3M1Q0S9      --------------------------MTESSEQRE---------------FNLRDYWQIV
A0A3M1VZ38      -------------------------MIQQDPQNQE---------------FNLRSYWQIL
A0A3M1PY35      -------------------MAASEPYRREPPTGGE---------------WDLDALRRVL
A0A3M1VMP2      -------------------MPAMTVPGVGP--GGD---------------WDLAAVRKVL
                                                                            

A0A2V7YYV7      RHRLW-MIIACPILAALSAGIVSFALPPVYEAHAA--LLV---LPSN-LGT-----SDPN
A0A2V7Z0J5      RHRLW-MIVACPLLAAVTAGVVSFALPPVYEAKVD--LAV---KPAQLLPS-----TDPN
A0A2V7Z3M4      RHRLW-MIVACPLLAAVTAGIVSFAVPPVYEAKVD--LAV---RPAQLLPS-----TDPN
A0A3M2D9H8      KRWAW-LLGVGVLIGLIGGLIYSLVQEPVYQATTK--VMV---LGAPQSNL-------SD
A0A399Y5V2      RRRKW-FIILPTVVILVAAITASLLTTPIYEASAD--VLI---QSNKRSSV----IADVA
Q01X01          YRRKA-TVLWITFFAVIAAALISVAQPRMYESQAS--IQV---QGVNENFLNLRDIFPTA
A0A2V7VMF7      WRSRV-FIVALGLVGLGLGFVVALLQTPQYRAGAM--IQI--------EP-PAPTFMTVT
A0A2V8JK38      VTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQI---ERE--TP-SLVNLRDYY
A0A2V9IXG5      WTGKW-VILACMLVALALAAVNNNFQKVSYRAQAQ--IQI---DAPPFLPSPGADFNAQS
A0A2V9J2P4      WTGKW-VILACMLVAMALAAVNNNFQKVSYRAQAQ--IQI---DAPPFLPSPGADFNAQS
A0A192WQ77      WNGRY-TIAAVFVVVVALAAVKTFLATPVYRAVAV--IEV---QPK--SS-SITPGQDVS
A0A1Q7RLS4      WRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEI---TPQ--SR-KVSPVAEVA
A0A2V2R525      RKHFL-MIIALTALCTLTTAVYMARKPDVYGAAVR--VQI---DVE--SN-PA---SGIN
A0A321LPW6      RKRRW-LIAATVVIVTSIVTVEMFRIKTAYQASAM--IEI---GKD--VQ-A----VQGP
A0A2V9R9V4      RKRRW-LIIGIASIITTLVTIDVFRTKPLYEATTT--IEI---GRD--NG-A----RINS
A0A321LE75      RKRLW-LISLIALIVTTIVTLEMFRTKSMYKASTT--IEI---EKE--NR-T----LVKS
A0A2V8R8U7      LKRKW-LILSLVLVVTSLVTIQAYRQPSIYEGGTT--IRI---ESK--PA-PV---LATG
A0A2V8QMP4      LKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQI---EQK--KG-GV---LQTA
A0A2V8R4S3      LKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQI---EQK--KG-GV---LQTA
A0A2V8NJ55      LKRKW-LILSLVVVVTSLVTIQMYRQPPIYEAETT--IQI---E-Q--KK-NI---LQTK
A0A2V8Q7I0      LKRKW-LILSLCLVVTSLVAVQMFRQPSIFQAETT--IRI---E-R--KQ-NV---LVSK
A0A2V8S6K4      LKRKW-LILSLVTVVTTLVAIQMYRLPSIYEAKTT--IQI---EPK--RN-AL---IKTK
A0A317I2L9      LKRKW-LILSLCLVVTSLVAVQMFRQPSIYEAETT--IRI---EQR--KS-NI---LQSD
A0A2V8LLF9      LKRKW-LIMSLLLVVTSLATIQAYREPSIYQASTM--IRI---EGR--PQ-SV---LSTG
A0A352FRF4      LKRKW-LIMSLVLIITSLATIQAYREPSIYEGATT--IKI---EQK--TP-SI---LQSG
A0A2V8MKV0      LKRKW-LILSVALVITSMAAIQQYRQPSIYDGIAQ--LKI---EEK--PP-NI---LSSS
A0A2V8PYY8      LKRKW-LILGVVLVITSMAAVQQYRQPSIYDGIAQ--LKI---EEK--PP-NI---LSSS
A0A1Q7YKQ8      LKRKW-LILTLMLVVTSLVAIQMYRLPPIYQAEAT--IQI---EPK--HD-SI---LKAG
A0A352F3R7      LKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRI---EQR--PM-SV---LQTK
A0A0B6WXT1      YKRRW-LILSLALAVTSLVAIYMYRQPNVYEAMVT--IDI---EPR--R--SV---LQTK
A0A3B9MEU8      LKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRI---EQK--PM-SV---LQTK
A0A2V8MHG6      RKHLW-LVMGIVVLVSGVTAMYMARQRDIYESLAR--VQV---DSE--TA-NNPAIGALK
A0A2V8P7N1      ----------------------------------K--VQV---DSE--TA-NNPAIGALK
A0A2V8M3M6      RKHFW-LIIAILILVTGITAIYMARQPDVYESLSK--VQV---DSE--TA-NNPAIGALK
A0A1Q7NJH5      RKHVW-LVIGIVVVVTGLTAVYMARQPDVYESASR--VQV---DSE--TA-NNPAIGALK
A0A2V8PJY0      RKHVW-LVIGIVVLLTGLTAVYMARQPDVYESASR--VQV---DSE--TA-NNPAIGALK
A0A1Q7Y6W9      RKRLW-LVISITVLMTTLAAIYMARKPDIYTAQAR--VQV---DLE--N--INPALGTNR
A0A2V8NC68      RKHIW-LVMGIILLITMLATIYMARQPDVFEARAR--VQV---DLE--I--NNPALGSIK
A0A399WK13      RKRLW-LVVGIAVVMTTLATIYIARKPNVYRAKAV--VQV---DNE--QV-NPDL-VTTD
A0A352FLX4      SKHLW-LILGISVLIPTLVAIYVVRKPDIYESQAR--IQV---DLE--NA-NPLLGGMSK
A0A2V8RTL7      RKRLW-LVVGIAVLITTLAAIYMARKPNIYLASSV--VQV---DLE--QT-NPDL-ITND
A0A3E0PCJ6      RKRLW-LVLGITVLLTTVTAIYMARKPNVYMASAT--VQV---DLE--QA-NQDL-VTPD
A0A3M1S4R8      RKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARAR--VQV---DLE--QG-NPQL-QVSD
A0A1Q7YFI6      RKHLW-LIIGIVVLITMIAAVYMARQADIYEAKSR--VQV---DLE--VN-NPGI-GAMK
A0A136KC10      RKRLW-LVAGIAVVMTTLATIYIARKPNVYRAKAV--VQV---DNE--QV-NPDL-VTND
A0A2V8SEX6      RKRLW-LVAGIAVLVTTLVAIYMARKPDIFSATAR--IQV---DLE--QV-NQDL-VTSD
A0A3M2D6Y5      RKRLW-LIVSIAILVTTLTAIYVARKPNIYEAKAR--IQV---DLE--QN-NPQL-QVTD
A0A0B6WWQ6      RRYLW-LVIGLVALAAAATAIYMARQPDLYLARAR--VEI---GSE--ED-SALS-LSPT
A0A3B9MK99      RDR----VISVLVLITTISVIHVARKPDIYQASAR--VQV---GLE--NN-AD---LVGK
A0A352EX26      RKRLW-LVIGIVILITTLAVINAAQKPDIYSANAR--VQV---DLE--NN-GA---LVGK
A0A2V8MM59      RKRLW-LVIGVAALITAMAVIYAARKPDVYEAASQ--VRV---DLE--NN-PM---YEGK
A0A2V8PFE8      RKRLW-LVLGVAALITALSTVYVARKPDVYEAKSQ--VQV---DLE--NN-PM---YAGK
A0A2V8PWS6      RKRLW-LVLGVAALITALSTIYVARKADVYEASSR--AQV---DLE--NN-PM---YAGK
A0A2V8LCT5      RKRLW-LVIGVAALLTTLALVYVARKPDIYEAKSQ--VQV---DLE--NN-PM---YAGK
A0A352FTJ9      RKRLW-LVIGVAVLMTTLAIIYVARKPDIYESSSR--VQV---DLE--NN-PM---YAEK
A0A2V8G155      YRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLI---ETE--NP-NVVNFKAVI
A0A2V8HDM7      YRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLI---ETE--NP-NVVNFKAVI
A0A2V8DRT9      YRRRW-PAGTAFMLVVLVVLVYTFTATPIYKARVQ--LLI---EDE--KS-NVVSFKEVI
A0A2V7VYF3      YKRRW-TAVTTFVLVVLAMMLRTLNGIPVYEARVQ--LLI---DVE--AP-KVLNFKDVF
A0A1F2SVH2      YKRRW-TALTAFLIVVLSVSVYTFTATPVFEARVQ--ILI---EKE--AT-NVVTFKEAY
A0A2V8AJG9      YKRRW-TAITAFLVVFLSVTIYTFTATPIYEAKVQ--ILI---EKE--NT-NVVTFKEAF
A0A2G6PYV5      RKHFF-LTLSLLILGLGLAYLAWLVKPPLYKSSVL--IKM---NHL--SM-DVIGFTEKL
A0A2V8F956      ------MAITTFLLVVGSVTVYTFTATPIFEAKTR--LLI---EAE--NR-NVVSFKAVL
A0A1F2S1W5      YRRRY-VAATAFLVVVLSVALYTFTAVRIYEGTVR--ILI---ERD--DP-NVVSFQEVL
A0A1F2T595      YRRRY-AAITVFLATVVTVALFTFTATRVYEGSVR--ILI---ERD--DP-NVLSFQQVF
A0A2V8JQV5      LNRKG-TVLIAAVLGTAIGLLISFPRTPIYQARTT--LEI---QGL--ND-NLLNTREVN
A0A2V9AC41      KRHRW-LIVMTALAILACAMLYLFTRIPLYTAEAT--VLI---ERK--AP-QILKVQDTR
A0A2V8K4L4      MRHKW-IVVLVAFLGTVAGILFTLPQTPIYQSSTS--LEV---QGL--NE-NFLNLENLN
A0A2V8NCZ3      MRHKW-IVILVAFLGATAGILITLPQTPIYQSTTL--VEV---QGL--NE-NFLNMQNLN
A0A2V9MAM9      RRHSL-LLAVITAATVGAAFLVSIAQPRLYQSVAS--VEV---QGL--NE-NFLNLRDVN
A0A2V9M454      LKHQW-LILVTAFVLTLLVTVYSYKMKPVYRATAR--VDV---EAE--EP-LLQSLNDLF
A0A2V9IVR7      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEI---EAA--TP-EIRTLSDLF
A0A2V9ILE2      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEI---EAA--TP-EIRTLSDLF
A0A2V9LGY4      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEI---EAA--TP-EIRTLSDLF
A0A2V9J4D6      FRWRW--------LSWISVTIYTFKAERVYQATAR--LDI---EAE--TP-MNLSAESLY
A0A2V9L9C5      LRKRWWEVLSVAMVVLISVTIYTFKAERVYQATAR--LDI---EAE--TP-MNLSAESLY
A0A2N9M9N1      -RKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATAR--MEV---QAE--TP-ALQTLNELG
A0A2V9JEC4      -KRRWPTVITVASAVTLLATLISLKMQPVYKATAR--LEV---KGE--MP-QLQTINEID
A0A2V9LPQ3      YRRRWQIVAITVAAVTIMA-IYSFKVNPIYRATAH--VEI---EAE--AP-LTMSVSDRF
A0A348V070      LRWKW-TGLTVAVLIVALTLVYILISPHIYTASGT--IWI---DE---TQ-SVLPFEELS
A0A2Z5G3A3      VRRRA-IIAGVTFAFLAIASLYCLLSTRRYMATGT--IQI---QKD--SS-DALRLESMM
A0A2V7UGP8      KRRRW-VVFTAVVVLVITVTLGSFLIPPSYQAICT--LQI---ERE--QP-NVLTFQQVQ
A0A239MKT6      RRRKI-WIALGIVLGFLSGLAVYLHTPPLYTATAI--VEL---NKD--SS-SGLGLQELS
A0A3E0PCN7      RKYWL-MIVAITLLGSLAAVVYVAQKPDYYTATVR--IQV---NNE--NN-PAVGNDTSS
A0A2V8IYW3      NRRKW-LLICPVLVFGIAAFLITRSLPNLYQSETT--ILV---VPQRVPE-SYIRSTVT-
G2LEI9          LRYKF-TVILCVVLTMTVTGLALSRMQPVYEASSH--IEV--------AP-EKELYSSSG
A0A317J121      RKYLI-LLSLFAVAGAAAGFFSVAFLNPVYQSRAL--LEV--------QA-PTVTLFKNS
A0A2V7YW66      RRHWK-LAAVCCLLGLAGAAVHYAITPKAFQATAT--IQI---ERR-----NLTPLGNGG
A0A2V7Z0V0      RRHWR-LAAVCCALGLAGAGIHYAITPKAYQASTI--IQI---ERR-----NLTPLGN-T
A0A2V8GFD4      YKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILI---ETE--NP-NVVSFQEVV
A0A2V8HSS5      YKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILI---ETE--NP-NVVSFQEVV
A0A2V8KP55      VTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQI---ERE--TP-SLVNLRDYY
A0A399WNU1      KKHWL-LVLSITLIGTFLVIVYEAQKPDFYEASVR--VQV---NNE--SN-PAAGEGTAS
A0A2V9CG11      IRHKK-MLLLVTLAGLIAAILIGLVQTPVYRARTS--LEI---QDF--NE-NFLDLKSVD
A0A2V2R0I6      RKHQW-LILSFMLAVVTIVAIATFRMQPVYTATAR--IEI---DRE--NS-NILPFQGPE
A0A2V8XAR9      RKHQW-LILSFMLAVVTIVTISTFRMQPVYNATAR--IEI---DRE--NA-NILPFPGAD
A0A2V8VZA0      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEI---DRE--NA-NILPFQGTD
A0A1Q7CB82      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEI---DRE--NA-NILPFQGTD
A0A2V8WIU1      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEI---DRE--NA-NILPFQGTD
A0A1Q6Y9F5      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--IEI---DRE--NA-NILPFQGAE
A0A2V9EVV8      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVGTAR--IEI---DRE--NA-NILPFQGAE
A0A2V8YF91      RKHLW-LIVSFMLTVVTIVAIANFRMKPVYVATAR--IEI---DRE--NA-NLLPFQGAD
A0A2V8XZK2      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--VEI---DRE--NA-NILPFQGAD
A0A2V8ZTX6      RKHQW-LILSFMLAVVTIVSIATFRMQPVYVAIAR--IEI---DRE--NA-NILPFPGGE
A0A2V9BT79      RKHQW-LIVSFMLSVVTIVSIATFRMQPVYVATAR--IEI---DKE--NA-NILPFQGAD
A0A1Q8B793      RKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEV---DRE--NA-NFLPFQPAD
A0A2V9BCA0      RKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEV---DRE--NA-NFLPFQPAD
A0A2V9BWU9      RKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEI---DNE--NT-NFLPFK-SD
A0A2V9DKX2      RKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEI---DNE--NT-NFLPFK-SD
A0A2V9JSI3      VKRRW-TVVTVAFVVSTVVAMVNFRMPPVYEARVS--VEV---EGE--AP-EVQSISNFY
A0A2V9WI32      KKRKW-VVISTWLIIAILATVYALHMTPVYDATGR--IAI---NRE--NS-VNLGFKDSD
A0A2V8IVN9      YKRRW-IAGTAFTVVMLLVTVYTFTVTPIYQATTK--LLI---ESD--SP-NVVSFKEVI
A0A1F2TPT3      YKRRW-IAITALLVVLTFAINRNFTAVPVYEASVR--VLL---DAE--RL-NLVNVEDVI
A0A2V8JTQ2      RDRKW-TIAAFALVVVGIVVTASLLMEPQYKAVGR--VVVVFHRDN--DS-GVLGFRGAD
A0A2V8UZY0      QDRKW-TITAFALVVVAIVLTASYYMKPRYEAVGR--VVVVFHREN--DS-GVLGFKGVD
A0A3N5YNR8      LKRKW-LIGLVVGAVLLLVGLQSFTTTPLYRATAR--VQI---DPE--SA-SILPYQPLN
A0A350UEK1      RRRKG-TLIIGAVAGLLIGIASTLPRTPIYQAKTT--LEI---QSF--NQ-NFMNMGNLQ
A0A350UIQ4      RRRKG-TLVIGATVGLLLGIAVTLPQTPIYQAKTT--LEI---QSF--NQ-NFMNMGNLQ
A0A3N6A5T6      LKRKW-LVLTVLVTVVVGTAVQTMTTTKVYRSTAR--VRI---DPE--ST-NILPYEDVY
A0A1F2Q9L4      RRRRL-LLILVAGLVAAISIVLYFMTPRQYRATTV--LQI---ERR--PT-SAAAMQQPM
A0A1H5SQF5      RKKLW-LIVGCVVVGVGLAVLLTSLMQRRFSSTVT--IEV---HKE--GG-TSLSLEDLS
A0A2Z5G448      IKRQF-IILACLATGLILGAVITFFTTPVFESTAR--IDI---NPD--RS-TNLGISDLL
A0A3E0NV31      RVRIF-TVVLVWLLTVVVMVVHVWTQTPLYRSTAT--LEI---EP---KQ-NLLPYQDLS
A0A3N5M5V0      RKRKW-LIVAVVTTVLVLVAVQSFTTTPLYRATAR--IQI---DPE--SE-NILPYKDVY
A0A2V9AEW6      ----M-TLLGFAVVGLLASIMISLVQTPIYRVRTS--LEI---Q----GT-NFQEMKGID
A0A2V8WQK6      IRHRM-TVLRFAVAGLLGAIVVSLVQTPIYRVRTS--LEI---Q----GP-NFPEMKGAN
A0A2V8XIF4      AQHKM-TLLAFGVCGLVAAILFSFIQTPTYRVRTS--LEI---Q----ST-NFVEIKGGD
A0A3N5XQP8      IKYRR-FVLLVLFLVVALVALETFTATPLYRASVR--VEV---DAE--PA-KVLPYQEIY
A0A2Z5G7H4      RRRRR-VMVSCVGGCVALAVLVCVFCTRRYQAFGE--IQV---QKD--SS-DALGLD--S
A0A2V9KCS3      LRRKW-TVLIIGFVGTLSGFLVSLPQTPVYRSRTS--VEI---QAL--ND-NLMNTR---
A0A2U3KC61      RKRKW-AVLATFAIVFALSVIKTLRETRLYQATSK--VAI---FEE--NP-NVLGFK---
A0A2V9Y2R7      RKRKW-AVLVTLIVVWVLSAVATMKQTRLYEAVSQ--LAI---FPE--NL-NALGLK---
A0A372IT17      RRRRR-IVLGMVFALLLLVTLYCLLITPLYQATGE--IEI---QRE--PS-GAFGLDNGV
A0A136JPP4      TKRLP-MIGAIAVVVTAAAAFYSFRQPSIYSASTE--MLI---EPR--KA-APTAKDAIN
A0A399WUJ8      TKRLP-LIGAIAIVVTAAAAFYSFRQPSIYSASTE--MLI---EPR--KA-APT--DAIN
A0A2V9L5B5      LKRRW-TVLVCLLVVFTTVAIGTLKKRPVYEGKVL--LEI---NPE--EP-QVLNFREVS
A0A2V9L7I0      LKRRW-TVLVCLLAVFTTVAIGTLKQRPVYVGKVL--LEI---NPE--EP-QVLSFKEVT
A0A2V9LK56      LKHRW-LLISTLLIVFSIVAVGTLKQKPSFQGSIL--VEI---DPD--PP-SVVNFKEIL
A0A2V9YHT3      VKRKA-VVLITLAVVFALVAFRTYRTTPLYESTGR--VAI---YHE--SQ-TLTGFKDSV
A0A2V9NGH6      IKRKW-VVISSVVMIFVVVAIATLKATPVYDATGS--IAI---NKL--DP-ALISFKDSA
A0A2V9PYE6      ---------------------------------------------M--DP-ALISFKDSP
A0A2V9NL07      IKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAI---NKP--DP-MLQNLRDPG
A0A2V9QD92      IKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAI---NKP--DP-MLQNLRDPG
A0A2V9WPZ6      IKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAV---NKA--DP-GLVNFKDSG
A0A2V9ZLH4      IKRKF-VALSCVVVIFLLVLIATLRMTPIYDAAGS--IAI---NKL--DP-SFINFKDSA
A0A2V9RQF1      IKRKW-IVISSVTVIFGVVAIATLKSIPIYDASGS--IAI---NKS--DP-ALLNIKDSA
A0A2V9YDK8      IKRKW-TIILCFSGIFIAVAIASLKMTPIYEASGS--IAV---NKT--DP-GLVNFKDSG
A0A2V9V8F7      IKRKW-TVLFCLAGIFIMVAISSLKMTPVYEASGS--IAV---NKA--DP-GLVNFKDSG
A0A2V9XGR9      IKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAV---NKA--DP-GLVNFKDSG
A0A2V9V3Q5      LKRKW-IIIACVVGIFAAVAIASLRQTPVFDAVGR--IAI---NKA--DS-NLVTFKDSM
A0A2V9NWS3      IKRKW-VIISCLAIIFGAVSVVTMRSTRIYDATGS--IAI---NKS--DP-ALLNFKDSP
A0A2V9USA9      AKRKW-VIFSCVAAIFAVVAIASLKMTPIYEANGS--IAI---NKP--DS-T-LNFQNSA
A0A2V9XW18      IKRKW-IVIICLVTIFSVVAIATLKTTPVYEAGGT--IAI---NKP--DT-T-LNFQNSA
A0A3M2BZG9      QRRWP-LILIFCALAAAYSLVRYSLTTKMYQATAV--IQI---ERR-----QLATIA---
A0A1Q7N5R7      WRYRW-WILAATALGTIGGAAASRFLPPRYVAQAT--IWI---QTS--GG-NGPERGPIG
A0A3M1SIV3      HKRLP-LIIALVLVITTLTALYMYRQPSIYQATAI--LLI---EPP--KP-KIQSKDTIN
A0A3E0PHB0      YKRLP-LILAATIIVTAAVAFYMFRLSDQYAAAAT--MIV---EPP--KP-KATDSQSVI
A0A3M2D491      YKRLP-MIIALVVIVTSLVAFYMYRQPSIYEARAV--LLI---EPR--RP-KIQSKDTIN
A0A357F267      YKRLP-MILTLAIIVTAATAFYMYRQKSVYQATTE--MLI---EPR--KP-KVTSKDSIN
A0A353C9L6      YKRLP-LIIAIVTIVTAAAAIYMYRQPTVYQATTD--MII---EPR--RP-KVTSKDAIN
A0A2V8RQV0      YKRLP-LILALTILVTAAAAFYMYRQASVYQASTQ--LVI---EPR--KP-KVTSKDSIN
A0A2V8SJH5      KKRLP-IILAITLLATVAAALYMYKQPSLYQATTE--MVI---EPR--KP-KVQSKESIN
A0A2V9QB26      CRHTG-ILAGITLMGALAGVLLSIWQSPVYRARTA--LEI---QNI--NE-DFLNIK---
A0A2V9VYY4      TKRKW-VVLPTFAIVFALSAIATLSETRLYQATSK--VAI---FPE--VP-NVLGFKDAE
A0A2V9KIE8      LKRRW-TVLTALLAVFLTVAIGTFKQKPGYSGTAL--LEI---NPE--PP-NVLNFK--E
A0A352F549      RKRLW-LIIGLALIVGSVTALRQARQPDIYQARAR--VQV---GTQTYSP-ALGASRGES
A0A3B9MLP9      RKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQV---DTETYSP-ALGASRGGS
A0A3D5SQ87      RKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQV---DTETYSP-ALGASRGGS
A0A2V8NW86      CRQKD-ILAWITFLGALAGVLLTIWQSPVYRARTA--LEI---QNI--NE-DFLNIK---
A0A2V8ZHL8      NKRRW-TIATVAFIATLLVAIASFKMTPIYEATAR--LDI---EAD--TA-QIQSFN--D
A0A2V9B240      NKRRW-TIVTVAFIVTLLVAIASFKMVSIYEATAH--LDI---EAD--TP-QIQSLN--D
A0A2V9CBM2      RRRLS-TILAVFFVVFVVIAIATLKQKPTYRAQVV--LEI---QKE--NP-DIPTIQ--E
A0A2V8XN17      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEI---QKE--NP-DIPTIK--E
A0A2V8WX45      HKRLP-TILIVFFILFTTILVVTLKQRSVYRAQVL--LEI---QKE--NP-DIPTIK--E
A0A1Q6YR79      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEI---QKE--NP-DIPTIK--E
A0A1Q7VA32      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEI---QKE--NP-DIPTIK--E
A0A2V9EY85      RKRLP-AILVVFFILFTAILIYTLKQKPVYRAQVL--LEI---QKE--NP-DIPTIK--E
A0A2V9H8K0      RKRLP-TILIVFFILFTAILIATLKQRPVYRAQVL--LEI---QKE--NP-DIPTIK--E
A0A2V9FFE5      RKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEI---QKE--NP-DIPTIK--E
A0A2V9GM43      RKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEI---QKE--NP-DIPTIK--E
A0A1F2RFI7      RKRRW-TVLGLLLLVVVTVMIGTLKQKPVYRAKAV--LQI---DKE--SS-NIFSFK--D
A0A1F2RZS3      QKRRW-TILSILLLVVVTVMIGTLKQRPIYEAKTV--IQI---DRE--SP-NILSFQ--G
A0A1F2USE2      QKRRW-TILTIFFVFLTLVLLWTLKQKPIYGATVL--LEI---EKE--NP-GLATVQ--E
A0A2V9C238      RKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEV---AKE--NP-NILTVQ--E
A0A1F2Q9F5      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEI---ERE--GP-NILTVQ--E
A0A1F2QQH9      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEI---ERE--GP-NILTVQ--E
A0A1F2QXK7      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEI---ERE--GP-NILTVQ--E
A0A2V9DEM9      RKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEV---AKE--NP-NILTVQ--E
A0A2V9CYQ5      RRRLS-TILTVFFVVFVGIAIATLKQKPTYRAQVM--LEI---QKE--NP-DIPTIQ--E
A0A2V9BWU8      RKRFA-TVAIVFFLVFAGSLIATLKEKPVYRAQVL--LEI---QKE--NA-DIPTIK--D
A0A2V8ZG48      RKRLP-TILIVFFLVFTVGLIATLKEKPIYRAQLL--LEI---QKE--NP-DIPTIK--D
A0A2V8Y334      RKRFS-TVLIVFFLVFAVTLIATLKEKPLYRAQVL--LEI---QKE--NP-DIPTIK--D
A0A2V9AY68      RKRFS-TILIVFFLVFAATLIVTLKEKPVYQAQVL--LEI---QKE--NP-DIPTIK--D
A0A257VBK0      WDQRF-WIAGVTAAVVILVALYTFLATPIYSATAT--VYV---QTY--SRQPMSGFN---
A0A2V7XDY0      WKNRI-LLATAAVLGLALGLVIAFAQTPEYRASVM--VQI---DPP--TP-TFMSVQEAL
A0A350UQT3      DEEMW-KIGAFILVVLIATAVISLRLTPVYESTAT--LYV---DRQ--EAKGIVGQES--
A0A2U3JZ71      RRNWW-KMLLFVSCAVAATLMVSARLIPVYESTST--IDI---DRQ--MPSAIIGQESTR
A0A2V8TTB0      RKHGW-TIAGFVVAAVLGTLIVSLRLTPVYESTVT--VDI---DRQ--MPTGVLGPESLQ
A0A1F2TCR2      FKHRR-VAGAAFVIVVMAMMVQTYSTIPLYLATAR--VMI---EDE--RSIAVANLN---
A0A2N9LQU7      WKRRV-AASLFASGIFLAVILYTFLKKPVYESVAQ--IRV---DSS--QQ-GSLGLEDLV
A0A2P6WFK7      FKHKL-LILLTALTVFGIITLRTLTMTPVYESAVR--LQV---DPS--RS-SSLGLDEMI
A0A1F2V330      MRRKL-FVLIPAAVLIVAVGIYTVYQPPLYRAQAL--LGV---EPG--AR---------N
A0A2V8U914      YRRRV-TLLSVTLAGVFIAALLSMAQPRLYRSVAS--LEV---QGV--NE-NFLNLRDID
A0A2V7W309      RKRWK-VAAAIVLVVMIGTFLASYFSKPLYQSWIQ--IEV---EEE--SQ--------NV
A0A2V8TLH7      SRGRW-TILSVFVVIVTLVAIGTFTQKPVYRARAT--VEI---TSQ--AS-KVAPVADVS
A0A1Q7ZJT1      WRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEI---TPQ--SR-KVSPVAEVA
A0A2V8VC99      WRGRW-TILTIFVVVVTLVAIGTLTQKPVYRAQAT--IEI---SPQ--SR-KVSPVADVA
A0A348UZU3      YRRRW-TVISLTLIAVALSLIISFVTRPVYKARGT--VMI---EKE--PN--------IL
Q01XL7          WGHKF-ILLLCIFAGALGGTAYVILKTPEYAAAST--VEL---IGF--NQ--SFMNMSQV
A0A2V8ERZ5      YRYRR-ICAATFVLVSAALIIQGYSTVQMYQAQAR--LLI---EDE--RSTAVPGLQ---
A0A2V8GTX0      IKHWK-ACAAIAVLVIAGMMYQTFTTVPLYRAQAR--IQI---DEE--QTTAQVDFK---
A0A2V8J0X9      FKHRR-LSGTAFVLVVTAMMVQTYSTIPVYEAWSR--VQI---QDE--RTTQVGTLN---
A0A372IRG7      IKRKW-VILFCVLVGVGIAFYHIFTTIPQYEAISR--MSI---DFS--RS-TNIGIEDII
A0A1F2U158      YRYKR-IALSVFLLTALALMIQGYSGEQVFQAKAQ--VLI---EDE--RSTAMPGIA---
A0A2V8F6S9      YRYRR-IAITVFVLTTAALMIQGYSTTPMFEARAQ--IEI---DAE--RATALPGIT---
A0A1I6MH75      RKRKW-VLVACVLLGMVYGSYDAITQPRLYESHSR--IQV---RSG--AS----NEYRVS
E8WVF6          RKRRM-VLIIAVVLGTLFGFYKSVTQIKPYEAYGR--LEV---NTG--AS----NQFKLS
A0A1H5Z7N3      RKRKY-WILAAALIGILLALYQSATQPRLFEAYGN--IEI---RSG--AS----NEYKIG
A0A1G7JVV8      RKRKW-VLIIAAILGILYGVYQAATQPIVYVATGR--IQV---AKP--NG----QASLGV
A0A1H4T6W9      RKRRW-ILIACAIVGILYGYYLASTQPIIFTATGR--IQV---HEA--NS----TAT---
I3ZEU5          RKRKW-ILVACAVIAILYGYYTASTQPIIYTATGR--IQI---HEA--NS----AAT---
A0A428MDU2      RKRRW-ILITSVVLGIAYGVYKAETQPKLFEAFGR--IEV---RSG--SS----NEYRVS
A0A239HDF6      RKRRW-VLIVAFVLGAAFGLYRAFFQPRIFEAYGR--IQV---RTG--SA----DQYKLT
A0A1Q3QQB6      KKRRK-ILILAILLGLGYGIYKAQTQPKLYEAVGR--IQV---RSG--SS----NEYRLS
A0A3N1K1G7      RKRRW-ILIVAVLLGLIYGVYKAETQPKLYEAYGR--IQV---RSG--SS----NEYRVT
A0A2W0BGU4      LRRRW-SILAVVFLATLTATLASLKMKPVYKATAR--IEV---EAD--TP-QTQMLNDRY
A0A2W0BVQ9      LRRRW-SILAVVFLATLTATLASLKMKPIYKATAR--IEV---EAD--TP-QTQMLNDRY
A0A3D1ASD2      RRHKW-KILGFVLACCIATLLVSTRLTPIYAATAT--VDV---DRQ--MPTNVLGQDSGR
A0A2N9MK30      RRHRW-KILSFIGVSAIATLIVSARLTPMYEATVT--VDV---DRK--VPTAVVGQDSTQ
A0A2V9MN96      KKRKW-TIVATFAIILVLAIIATLRMPRLYEAASR--IAI---YPE--NS-NVLGLKDLE
E8UZE1          KRRKW-LVLLIFLVFVAASALYTLRLPKRYEALCK--IDI---DLS--TPKSVLALDSQS
A0A2V7V2Z1      LRRRR-LVLAVFLGVAALATFRSLLTRPVYEASAQ--ILI---ERD--TP-SVLTFKEVA
A0A2V7X2F7      LRHRK-FALAIFLTATAVATIRTLLTRPVYMATAQ--ILI---ERE--KS-NVLSFKDVT
A0A2V7V2I1      LRRRR-LVLAVFLTVAAAATVRTLLTRPVYEADVQ--ILI---ERE--NP-NVLTFKEVA
A0A2V7U3M2      LRRRR-LVLAVFVAVTALATLRALLTRPVYEASAQ--ILI---ERD--TP-NVLTFKEVA
A0A2V7UHT0      LRRRR-LVLAIFLGVAALATLRALLTRPVYEASAQ--ILI---ERD--TP-NVLTFKEVA
A0A2Z5FVL3      ---------------------MCILMTRRYTAVAE--IQV---QKP--NSDSLTLDSNAA
A0A1V6HR88      TARWR-LIALTTLLAIAGGVLAYLVTPKEYRATTT--ILI---ERR--LS-IPVQSA---
A0A3E0P0A3      LRGWK-VLIAFAVLGLALGIARYLSAPVVYSATSQ--IQI---ERR--AP--------NL
A0A2V9KBD6      RPHKW-ITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVF---HRD--ND-SGVLGFKGV
A0A2W0AJ66      RSRKK-IIAAFAVMVVSTVMTASFLMKPRYDAVGR--VLF---FRE--DEGAGVLGFKGP
A0A1Q7RBU1      RNRKW-TIAVFALVVVAIVVTASLLMKPQYEAVGR--VVF---HRE--ND-SGVLGFKSV
A0A2V9JPV9      RNRKW-VIALFALVVVAIVATASFLMKPQYEAVGR--VVF---HRE--ND-SGVLGFKGV
A0A2V8EXP2      HKRRV-AALTAFLLVFVSTAVYTFTAKPIYESKVQ--ILI---EKE--NA-NVVTFKEVF
A0A2W4RYA1      YKRRW-LMASAFLTVMVAVALYTFTATPLYEARTR--LLI---DSD---P-NIVSFEGVV
G8P0Y7          LKRKW-IVIVSVAIVLITTALISLHTTPIYEAVTK--ITI---SPP--TS-NPLNFKDN-
A0A3D4VGU2      LKRKW-IILICVLAGIGVALYHVETATPQYEAVSS--VSI---DMN--KS-TGV----EL
C1F294          LKRKW-IILICVLAGIGVALYHVETATPQYEAVSS--VSI---DMN--KS-TGV----EL
A0A3P0X3W6      RRAWW-KIALFVVTCTALTAVACFLMTPVYEATVR--LAV---DSK--VP-ASVIGQ---
A0A1E3Y9R6      YKRRW-VAIPGFLLVFVSGAIGSIRTVPVYEARTQ--III---EKD--AR-RNTSINTVL
A0A2W4TLP2      YKRRW-VAIPGFLLVFLSGAIGSIRTVPVYEARTQ--LII---EKD--AR-RATSINTVL
A0A3R9WF43      RRRWR-SAVLVAVVIALLGTVAVLLMTPRYSATAT--IEV---NRE--DH-EEASGPRT-
A0A317HKM4      YRRRW-IIFLIVVAGLIGGALYNWTAPRIFEAGAT--LQI---EGD--TN-ILALDRPLV
A0A2W0C122      HKHVW-IILGCTSLSVSVSVLYAMRQPRLYRATTN--IAI---DRD--SN-ATVPLNKAF
A0A2W0AUU7      HKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAI---DRD--SN-AGVSLNKTF
A0A2W0BQL1      HKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAI---DRD--SN-AGVSLNKTF
A0A3P0XH15      IKRKW-LILAGIVVGLAFAAVYILTTIPQYEAIAL--IDI---NEG--QQ-SNIGISELV
A0A3M1WQW8      KKRKW-IVLGVLMMVVTVVAIRMYRARPIYQASGK--VII---NQQ--TP-VPLANR---
A0A3N1JHC1      RRHRF-AVMMIFALCLLGGLLYAFFVPKSYKAQTV--LEI---TGI--NQ-DFM----NT
A0A2V9KA79      KRRLW-LVLATTFVGTLCGGGASVLLPVRYRAQVL--LAA---ESA--PT-R------DY
G8P085          GRHKW-FILACIVIGTVVAVVYVKSVTPIYEATAS--IRI---DPG--RI-GSLGLA-DL
Q1ILD9          VRRRK-LLAAGVLLGILLATAYCILKTRRYEGEAT--VYV---HPE--GS-DVLGSMPDL
Q1IJZ6          RKRKN-LILGAAGACLACALLLSFVMRSYYNSSAT--IEI---QKD--QD-ASLGSALDT
A0A2V8TCE6      VRRQW-AIYTVAGLVLGLTALRLLMVQSTYKAKAL--VEI---QRS--SP-DVLAFR-DI
Q1ITG0          RRHLQ-MIIGVTAFGVLVAILFCLFMKPRYEGMAD--LNV---HPE--ES-AALDMG-AL
A0A3N5PCI5      YKRRW-IALFTFLIAAAGVVTYTMSVTPIYEAHTQ--LLL---QQR--AS-IV-----TF
A0A3M1Q0S9      VRRRW-LIVTCVLVATVAALVSSLLATPVYRATCT--LAI---ERT--GV-RVLRE--TL
A0A3M1VZ38      VRRRW-LIGTCVLVTTVAAAVSSFLATPIYKATTT--ISI---ERR--GV-RLLNT--SL
A0A3M1PY35      WQRRW-LVAAIALEVLLVGAVVTFLRTPLYEASAR--LII---EKT--MP-RVLDSE-DV
A0A3M1VMP2      WQRRW-LVAAIAAEVFLLTALVTFLRTPVYTASAR--LLI---ERT--TP-RVLDTE-DV
                                                                            

A0A2V7YYV7      VIPLTPDQI------------LRTYALLLTQRKLLDEVIADLR---LKT-------RPD-
A0A2V7Z0J5      APSISATTI------------LATYALFMTEPPLLNKVIADLG---LKT-------TSD-
A0A2V7Z3M4      APSVSSATI------------LATYALFMTEPPLLNKVISDLR---LNT-------TSD-
A0A3M2D9H8      ILNQNTELL------------SQTFTELLVTRPVLEAASERLG---YYI-------SSS-
A0A399Y5V2      MPAEDPARE------------LQTQIQVITSRPVAEETAKRLQ---LNV-------PPE-
Q01X01          APSADSAVY------------VQTQAEMLQQDALLERVVKKLR---LED-------RPEY
A0A2V7VMF7      DALAGMGNYWQNADF------YNTQFRVLKSKTLGSRVVERLK---LDD-------RPPF
A0A2V8JK38      QADSDTYVDYM----------LQSYFRILKSRSLARRVVTELH---EEL-------EKEF
A0A2V9IXG5      SYYLNIDRY------------FKTEKQKLTSRRMHLLFAGRLK----QQ-------NPRF
A0A2V9J2P4      SYYLNIDRY------------FKTEKQKLTSRRMHLLFAGRLK----QQ-------NPRF
A0A192WQ77      GLGSAGYGWFAENKY------HNTQVEIMRSHDIAERVVDTLG---LRS-------DPFF
A0A1Q7RLS4      ETGMAQYGWYAEERY------FNTQYEIIKSRDVARRVFDRLD---LYN-------HPLF
A0A2V2R525      GKPVVINNSASAPDY------FETQLEILKGSGLLRRVVKTLD---LEH-------NKAF
A0A321LPW6      SAAAVQDDS--DNFYPLVR--IKTYMIELKSRPLLSDVAARLR---LDQ-------RPEF
A0A2V9R9V4      NGLFIQEED-----YLNVT--MNTSEVILKSLPLLEDVVVQLR---LDQ-------NPAF
A0A321LE75      GDVVISTDESDDAYYTSLV--MKTKIRTLMSRPLLEDVVIHLG---LDH-------NPQF
A0A2V8R8U7      QV--I-INAPADANF------WGTQLKLLQNPQLARQVVLSLE---LQK-------NPSF
A0A2V8QMP4      GAGNL-IIRGSDPNY------WNTQLQKLKTQKLARQVILRLD---LQN-------SPAF
A0A2V8R4S3      GAGNL-IIRGSDPNY------WNTQLQKLKTQKLARQVILRLD---LQN-------SPAF
A0A2V8NJ55      EL--I-LNTGTDPYY------WNTQLKLLENPELARQVAITLD---LQN-------NPTF
A0A2V8Q7I0      DF--V-LNSQPDANF------WGTQITLLQSPALARQVALTLD---LQH-------NPTF
A0A2V8S6K4      DI--V-VNAGADPAY------WGTQLKLLENPSLLRQVIMRLG---LQN-------NPSF
A0A317I2L9      KL--V-IGGQLDPNF------WGTQLKLLESPALARQVALTLD---LQH-------NPNF
A0A2V8LLF9      NLIIS---GQPDPNF------WGTQLRLLQNPLLARQVIVSLD---LQH-------NSRF
A0A352FRF4      NGGGI-VIGQSDPNF------WGTQLNLLHNEALARQVIVRLD---LPH-------NPTF
A0A2V8MKV0      QIVIT----QRDPNF------WGTQIKMLQNPSLARQVILTLD---LPH-------NPNF
A0A2V8PYY8      QLVIV----QRDPNF------WGTQIKMLQNAQLARQVILTLD---LQH-------NPNF
A0A1Q7YKQ8      NNVVINTGGGDDAQY------WNTQIKLLESQQLARQVALTLD---LQN-------NSAF
A0A352F3R7      E--IV-ITGQNDPNF------WGTQLKLLENPALARQVVLTLD---LQH-------NPAF
A0A0B6WXT1      GDVQV-VSVPNDPNY------WSTQIKLLQNPQLARQVALTLD---LPN-------NPAF
A0A3B9MEU8      E--IV-INAQSDPSF------WGTQLKLLENPALARQVVLTLD---LQH-------NPAF
A0A2V8MHG6      GNSIFLNNPSQDPTY------FNTQIQILTSAGLLGRVAKTLD---LEH-------NEGF
A0A2V8P7N1      GNPIFLNNSSQDPTY------FNTQIQILTSAGLLGRVARTLD---LEH-------NQAF
A0A2V8M3M6      GNPIFLNNPSQDPTY------FNTQIQILTSAGLLGRVARTLD---LEH-------NQAF
A0A1Q7NJH5      GNPIFLNYPSQDPTY------FNTQIQILTSAGLLGRVAKTLD---LEH-------NQAF
A0A2V8PJY0      GNPIFLNNPSQDPTY------FNTQIQILTSAGLLGRVAKTLD---LEH-------NQAF
A0A1Q7Y6W9      -NGVNINYRISDPAY------FNTQLQILNSPGLLRRVVKTLD---LEH-------NQAF
A0A2V8NC68      GNSIVLNTPYQDPTY------FNTQLQILSSAGLLSRVVKTLD---LEH-------NQAF
A0A399WK13      RARPISNA---DPSY------FNTQLQLLWSESLLRRVVKEHN---LDA-------NKEF
A0A352FLX4      NSNVILNSETNDPAY------FNTQLQILTGPGLLRSVAKTLD---LEH-------NPDF
A0A2V8RTL7      RQRVLSNP---DPSY------FNTQLQLLNSDTLLRRVVKEHN---LDA-------NKDF
A0A3E0PCJ6      RRMPVMTS---DPAY------FNTQLQLLNSEVLLRRVVKELN---LDT-------NEAF
A0A3M1S4R8      RPTLLPNP---DPAY------FNTQLQLLTSDSLLRRVVKEMN---LET-------NKEF
A0A1Q7YFI6      NTSYILEQQYQDPTY------FNTQIQILSSPGLLSRVVKTLD---LEH-------NQAF
A0A136KC10      RARPISNA---DPSY------FNTQLQLLWSESLLRRVVKEHN---LDA-------NPEF
A0A2V8SEX6      RQRPISNP---DPSY------FNTQLQLLDSENLLRQVVKEHS---LDT-------NKEF
A0A3M2D6Y5      RPALLSNP---DPAY------FNTQLQLLTSDSLLRRVIKEMN---LDT-------NKEF
A0A0B6WWQ6      GGPVVINRS-SDPTY------FSTQLQILTGSQLLRRVVRTLD---LEH-------NPEF
A0A3B9MK99      T-PYYFGPT-NDPVY------FNTQLQILGSPGLMRRVVKTLD---LEH-------NPDF
A0A352EX26      T-PYYMGSM-NDPVY------FNTQLQILGSQALARRVVKTLD---LEH-------NPDF
A0A2V8MM59      TTQLIYSPV-NDPAY------FNTQLQILTSQGLLRRVVKTLD---LEH-------NKGF
A0A2V8PFE8      SVPMIYSPV-NDPAY------FNTQLQILTSPGLLRRVVKTLD---LEH-------NQAF
A0A2V8PWS6      SVPMIYSPV-NDPAY------FNTQLQILTSPGLLRRVVKTLE---LEH-------DQAF
A0A2V8LCT5      TAPMIVSPV-NDPAY------FNTQLQILTSQGLLRRVVKTLD---LEH-------NQAF
A0A352FTJ9      AAPMIVNPI-NDPAY------FNTQLQILTSPGLLRRVVKTLD---LEH-------NQAF
A0A2V8G155      DEDQTKA----------EY--YQTQYNIIQSRAIARRALDELK---LWN-------TPPF
A0A2V8HDM7      DEDQTKA----------EY--YQTQYNIIQSRAIGRRALDELK---LWN-------TPPF
A0A2V8DRT9      EQDKATN----------DY--YQTQYRILQSRSLARRTLDRMG---AW------------
A0A2V7VYF3      DQGHSPY----------DYEFTETQQKLLTSRSLARKTLDALR---MWQ-------HPYF
A0A1F2SVH2      EQNQVTD----------DY--YQTQYKILQSRALARRTLDALK---LWD-------HPQF
A0A2V8AJG9      EQNQIAD----------DY--YQTQYKILQSRALARRTIDGLK---LWE-------HPLL
A0A2G6PYV5      QWNPYRE----------EY--FKTEFRIIKSLPVAEEVARTLGVKYFREQEQEDAQPKNL
A0A2V8F956      DEDQTRA----------DY--YQTQYNLLQSRALALRTIDQLK---LWE-------TPPF
A0A1F2S1W5      EQNEVTD----------DY--YETQYRLLQGRGLARRTIDALN---LWS-------HPQF
A0A1F2T595      EQSDGAD----------DY--YETQYRILQGRGLARRTIDALD---LWR-------HPSL
A0A2V8JQV5      PSAPSVISTAF------EE--IQTQIKILKSDSLIGQAMKRFG---LTHSADPLTRLTRW
A0A2V9AC41      ADSIDSGDYNN------EF--YKTQYEILRSPALAERVIREEG---LQN-------LPLF
A0A2V8K4L4      PTSSPSGYLDPS-----YE--ILTQVKVFQSRSLLQQTTERLL---KEK-------KTGY
A0A2V8NCZ3      PTSVTGGW---G-----YE--IMTQVRVLQSRSLMEKVTERLL---NDK-------KTPY
A0A2V9MAM9      PTATAPTHSED------SY--IETQAEILRQDSLIGRAFNRLP---AER-------RGGL
A0A2V9M454      R--TEQADD--------SF--LASQISILQSDNLAWETIQQLG---LAR-------LPNS
A0A2V9IVR7      E--AMPADD--------MF--LQTQVNVLQSDNLAWQTIEQLR---LGE-------NPAF
A0A2V9ILE2      E--AMPADD--------MF--LQTQVNVLQSDNLAWQTIEQLR---LGE-------NPAF
A0A2V9LGY4      E--AMPADD--------MF--LQTQVNVLQSDNLAWQTIEQLR---LGE-------NPAF
A0A2V9J4D6      RNESTPADE--------TF--LLTQTQVLRSDNLAWETIQQLK---LAD-------DPSF
A0A2V9L9C5      RNESTPADE--------TF--LLTQTQVLRSDNLAWETIQQLK---LAD-------DPSF
A0A2N9M9N1      P--SGATDA--------AF--LQTQVDLLQNNNLSWQTMQELG---LANGNTELGVGGDL
A0A2V9JEC4      R--HAPVDS--------TF--LQTQVDLLQNDSLMWQTIHRLD---LES-------RPEF
A0A2V9LPQ3      R--SMPADE--------AF--LKTQALVIGSDHLAWETIGQLG---LAE-------NGAF
A0A348V070      RLSGG------------IN--SQSHAMLLKSRSLAADVIEKMK---LHS-------HPEF
A0A2Z5G3A3      QGGAADEDALDEN----IT--LQTQTNILQSDSLALRVIEDLH---LDK-------TPDF
A0A2V7UGP8      PVGYDYMSYN-------DF--YQTQYRLLASHNVARKAMLKLD---LRN-------DPVV
A0A239MKT6      GLSDSLSGGMELN----TD--MLTHQRILQNDNTALSVISSLN---LMQ-------EPPY
A0A3E0PCN7      SVILNSGSDP-------AY--FATQLQILEGPGLLRRVVRTLG---LEK-------NPEF
A0A2V8IYW3      -----------------NR--IEDRLRSIREQVLSRSMLEPII-----------------
G2LEI9          RIAFVPYSVDP------DY--LNTQIRKISSPSLLVEVVKTLK---LDR-------DPKF
A0A317J121      GVSGNDEVSQ-------VN--IQTQIQLLRSSSFLRRVMERLQ---LET-------VPPP
A0A2V7YW66      QNPWLENYWNM------EF--YPTQYELLQSRGLAERVVKSLD---LME-------DPAF
A0A2V7Z0V0      QNPWLENYWNM------EF--YPTQYELLQSRGLAERVVKSLD---LME-------DPAF
A0A2V8GFD4      DQNKTTL----------DY--YQTQYRILQSRAIARRSIADPF---LAT-------NAQL
A0A2V8HSS5      DQNKTTL----------DY--YQTQYRILQSRAIARRSIADPF---LAT-------NAQL
A0A2V8KP55      QADSDTYVD--------YM--LQSYFRILKSRSLARRVVTELH---EEL-------EKEF
A0A399WNU1      SIILNPGSDP-------TY--FATQLQIIEGPGLIRRVVKNLD---LEH-------NPTF
A0A2V9CG11      PTVTADDYTTGA-----SY--FETQVKLLQSESLLERVIEKLN---LRE-----------
A0A2V2R0I6      AYDFYSDSE--------SY--IETQSKILTSETLALQTIRNSG---LSA-------RPEF
A0A2V8XAR9      SYDYMMDLE--------NY--IETQSKILTSETLALQTIRNTG---LSA-------RPEF
A0A2V8VZA0      SYDYMMDLE--------NY--IETQSKILTSETLALQTIRNNA---LST-------RPEF
A0A1Q7CB82      SYDYMMDLE--------NY--IETQSKILTSETLALQTIRNNA---LST-------RPEF
A0A2V8WIU1      SYDYMMDLE--------NY--IETQSKILTSETLALQTIRNNA---LST-------RPEF
A0A1Q6Y9F5      SYEYMMDLE--------NY--IETQSKILTSETLALLTIRNNA---LST-------RPEF
A0A2V9EVV8      SYEYMMDLE--------NY--IETQSKILTSETLALLTIRNNA---LST-------RPEF
A0A2V8YF91      PYDYTVDFD--------NY--IETQAKILTSETLALQTIRNGG---LSD-------RPEF
A0A2V8XZK2      SYDYMVDSE--------NY--IETQAKILTSETLVLQTIRDSG---LTA-------RPEF
A0A2V8ZTX6      SFDYMVDSE--------NY--IETQAKILTSETLALQTIRNNG---LAL-------RPEF
A0A2V9BT79      SYDYMMDSD--------NY--IETQSKILTSETLALQTIRNNG---LAL-------RPEF
A0A1Q8B793      PYAYLLDQE--------NY--IETQSKILTSETLALQTIRSVG---LAG-------HPDF
A0A2V9BCA0      PYAYLLDQE--------NY--IETQSKILTSETLALQTIRSVG---LAG-------HPDF
A0A2V9BWU9      SYEMYMDME--------NY--IETQSKILQSETLALQTIQSAG---LVE-------LPEF
A0A2V9DKX2      SYEMYMDME--------NY--IETQSKILQSETLALQTIQSAG---LVE-------LPEF
A0A2V9JSI3      RGTPSDE----------AF--LRTQVKVLESDSLAWQTIQQLG---IDQ-------SAEF
A0A2V9WI32      QGTIGADYEDYN-----IA--LETQIRILQSDALAFQVIKNLK---LDN-------NPAF
A0A2V8IVN9      NEEQTKA----------DY--YQTQYNILQSRSLARRTLETLK---LWE-------SGEF
A0A1F2TPT3      DQR--------------RP--LDTELAILRSRWLAAKTVASLG---LIQ-------NEPV
A0A2V8JTQ2      TSLLDDPEDR-------TA--IDTQIRILQTDALAMQVIKNLQ---LDK-------NPKF
A0A2V8UZY0      TSLLEDPEDR-------AA--IDTQIGILQTDALAMQVIKDLH---LNK-------NPKF
A0A3N5YNR8      ESAERYLSSE-------IY--LQTQLEILQSRALARRVVDRLN---LAN-------DPRF
A0A350UEK1      EVTEGSGPAGNM-----VD--LQTQIKILQSDTLVDRVTAQLSNG---T-------TPAE
A0A350UIQ4      EVTEGAGPSGST-----ID--IQTQIKILQSDTLLERVHSLMNPGEEVA-------APAE
A0A3N6A5T6      QAADQGIAME-------TY--LQTQFKILQGRTLAERIVKQLQ---LHE-------NPSF
A0A1F2Q9L4      QIDDWFDAQ--------SF--YPTQYRLLQSRGLAERVVKNLR---LAD-------DPVF
A0A1H5SQF5      GAGQQLIGGDQLS----VD--LLTQQAVIGNENIAMKVLEDLG---LTN-------SQPF
A0A2Z5G448      NSKAGGNDES-------TR--LLTEARILQSDSVIFAVIESEN---LFA-------KKPF
A0A3E0NV31      ARGGDQ-----------SN--IETQITLLRSGNLLAKVVERLE---LTT-------RPEF
A0A3N5M5V0      EGPERYLSSE-------VY--LQTQLEILQSRALARRVVDRLN---LAN-------DPRF
A0A2V9AEW6      ---SNGNYVSQE-----SY--VETQVKLLQSESLIEHVIDKMK---LHK-------EQPT
A0A2V8WQK6      --DSNGSYASPE-----SY--VETQVKILQSESVIEHVIDKLK---LQK-------ERPR
A0A2V8XIF4      PSGSTASIASPE-----SY--VETQVRRLQSESLLERVIDKLK---LRK-------ERPA
A0A3N5XQP8      QVAMDPRSME-------SD--LRTQYSILQSRTMARGVIKRLN---LTN-------ERLL
A0A2Z5G7H4      MMGGAEDASDALDAN--IT--LQTQADLLESDTLALQVIEALE---LET-------TRDY
A0A2V9KCS3      ---QIDPTPGTNDMYVQTD--ILTQIKILQSDSLMERVVTKLK---LDK-------KPAA
A0A2U3KC61      ---DVENNLP--DFDYQAT--LETQAAILRSDVLALKVIKAMH---LDP-------NPQ-
A0A2V9Y2R7      ---DGDGGSPGEDWDYNVT--LETQTAILRSDALALKVIETMH---LDK-------DPRF
A0A372IT17      LGDTSHEASDALENS--MS--IETQAGILESDTLALHVIRALD---LES-------TQNF
A0A136JPP4      INFGLDET---------TY--YNTQLQLLQNPDLMKKAVVALG---LQR-------EPDL
A0A399WUJ8      INLGGDET---------TY--YNTQLQLLQNPDLMKKVVLALG---LQR-------DPDL
A0A2V9L5B5      QE-APTVDVD-------SY--RETQYKILRSRTLAEKVVNDLH---LYQ-------SPEF
A0A2V9L7I0      QA-APTVDVD-------SY--RETQYKVLQSRTLAEKVVNDLR---LYL-------SPEF
A0A2V9LK56      QV-A-SADVE-------SY--RETQYRVLESRSLAESVVKDLE---LYR-------LPEF
A0A2V9YHT3      PIDADDWDYT-------VA--METQVRIMQSDSLALKVAHDLG-----------------
A0A2V9NGH6      NA-GPDYYDP-------SD--LDTEVGILKSDLLAFQVIKQLN---LDK-------RPEF
A0A2V9PYE6      SV-GPDYYDP-------SD--LDTEVGILKSDLLTFQVIKQLN---LDK-------RPDF
A0A2V9NL07      NS-GMDYYDP-------TD--LDTEVRILHSDLLALQVIKQLN---LDQ-------MPEF
A0A2V9QD92      NS-GMDYYDP-------TD--LDTEVRILHSDLLALQVIKQLN---LDQ-------MPEF
A0A2V9WPZ6      SM-SIDYYDP-------AD--LDTEVKILQSDLLALQVIKQLN---LDK-------RTEF
A0A2V9ZLH4      SA-S-DYYDP-------AD--LDTEVKILKSDLLALQVIKQLN---LDR-------RVEF
A0A2V9RQF1      NA-PIEYYDP-------AD--LDTEVRILKSDLLALQVIRQLN---LDK-------RPEF
A0A2V9YDK8      SV-SVDYFDP-------AD--LDTEVKILQSDLLALQVIKQLN---LDK-------RSEL
A0A2V9V8F7      SM-SIDYYDP-------AD--LDTEVKILQSDLLALQVIKQLN---LDK-------RTEF
A0A2V9XGR9      SM-SIDYYDP-------AD--LDTEVKILQSDLLALQVIKQLN---LDK-------RTEF
A0A2V9V3Q5      PV--MDYYDP-------TD--LDTETRILQSDILALQVIRQLN---LDK-------RPEY
A0A2V9NWS3      SA-AVDYSDP-------TE--LDTEVRILKSDLLALQVIRQLD---LDK-------RAEF
A0A2V9USA9      TF-SLDYYDP-------TE--LDTEVKILQSDLLALQVIKELN---LDH-------SGGP
A0A2V9XW18      TF-SLDYFDP-------TE--LDTEVKILQSDLLAMQVIRELN---LDR-------RPEI
A0A3M2BZG9      ---MGGATNWLEEWWNLEY--YPTQYRLLRSRGMAERVIQNLH---LLQ-------DPTF
A0A1Q7N5R7      ANQLLVASAW-------TD--LLKSYVVLDAVARERRLYLQARPRDMAV-------MATF
A0A3M1SIV3      INFGYDL----------NY--YNTQEKLLESPELMKEVVVKLG---LYR-------TPDL
A0A3E0PHB0      LNFGYDQ----------NY--YNTQLQLMRSEDVMRDVVVKMK---LYE-------KDSL
A0A3M2D491      INFGYDM----------NY--YNTQEKLLESPELIKEAVIKLG---LYR-------NPEL
A0A357F267      INFGNDA----------NY--YATQLQLLQNADLMRRVVVDLG---LYR-------EPDL
A0A353C9L6      INFGQDA----------NY--YQTQLMLLRNRDLVKQVVIDLG---LYR-------EPNL
A0A2V8RQV0      INFGNDA----------NY--YNTQLELLKNPELMKKVVISLG---LYR-------NKTL
A0A2V8SJH5      INFGNDA----------NY--YNTQLELLQSHDLMKEVVIRLG---LYK-------EADV
A0A2V9QB26      ---QVTPVSEGNSSTALTE--IATQVRLLQSESLIKRVLTKLK----DR-------FPED
A0A2V9VYY4      NI-APDYEYE-------AT--LETQVAILRSDALALKVIEGMR---LYQ-------DPRF
A0A2V9KIE8      VLQISNQDVD-------SY--RETQFRVLESRTLAERVVRDLA---LYR-------SPEF
A0A352F549      FYPENGYMEP-------EY--FNTQVQILTSPTLLRRVAKNLD---LEH-------NRTF
A0A3B9MLP9      YYVDNTYMDP-------EY--FNTQVQIISSPTLLRRVAKTLD---LEH-------NRTF
A0A3D5SQ87      YYVDNTYMDP-------EY--FNTQVQIISSPTLLRRVAKTLD---LEH-------NRTF
A0A2V8NW86      ---QVNPVSEGDSSTVLTE--IATQVRLLQSESLIKRVLTKLR---DRF-------AEDP
A0A2V8ZHL8      LY-RQVPTDE-------AF--IGTQIQVLESDNLAQRTIEQLG---LA------------
A0A2V9B240      LY-RQVPTDD-------AF--IGTQIQVLESDNLAQRTIEQLG---LA------------
A0A2V9CBM2      LY-QLETVSD-------DY--LRTQYDILASDSLARRVIDQLR---LDT-------VSEF
A0A2V8XN17      MY-ELDAVSD-------AY--LRTQYSILASESLARQVIDQLQ---LEA-------LPEF
A0A2V8WX45      LY-ELEAVSD-------AY--LRTQYNILASESLSRRVIEQLR---LDT-------LPEF
A0A1Q6YR79      MY-ELDAVSD-------AY--LRTQYSILASESLARRVIDQLQ---LET-------LPEF
A0A1Q7VA32      MY-ELDAVSD-------AY--LRTQYSILASESLARRVIDQLQ---LET-------LPEF
A0A2V9EY85      LY-ELDAVSD-------AY--LRTQYSILASESLARRVIDQLQ---LET-------LPEF
A0A2V9H8K0      LY-ELDAVSD-------AY--LRTQYSILASDSLARHAIGQLG---LET-------LPEF
A0A2V9FFE5      LY-ELDAVSD-------AY--LRTQYSILASESLARRAIDQLR---LET-------LREF
A0A2V9GM43      LY-ELDAVSD-------AY--LRTQYSILASESLARRAIDQLH---LET-------LREF
A0A1F2RFI7      FVADIDPFDE-------SY--LETAYKVLQSRTLARRVIDKLQ---LDK-------LPEY
A0A1F2RZS3      FVAEMNPYDD-------SY--LETAYKVLQSRSLAYRVINKLN---LAH-------SPEF
A0A1F2USE2      LF-ELDAVSD-------TY--LETQYKILGSESLARRVINQLR---LDQ-------RAEF
A0A2V9C238      LF-ALDTVSD-------TY--LETQFKILQSDTLARRVIEGLR---LDK-------LEEF
A0A1F2Q9F5      LF-QIESASD-------TY--LETQYRILESESLARRVVDQLR---LDQ-------LAEF
A0A1F2QQH9      LF-QIESASD-------TY--LETQYRILESESLARRVVDQLR---LDQ-------LAEF
A0A1F2QXK7      LF-QIESASD-------TY--LETQYRILESESLARRVVDQLR---LDQ-------LAEF
A0A2V9DEM9      LF-ALDTVSD-------TY--LETQFKILQSDTLARRVIEGLR---LDM-------LEEF
A0A2V9CYQ5      LY-QLETVSD-------DY--LRTQYDILASDSLARRVIDQLR---LDT-------VSEF
A0A2V9BWU8      LY-ELESVSD-------SY--LKTQYTILASDSIARRVIDQLH---LDS-------LPEF
A0A2V8ZG48      LY-ELESVSD-------SY--LKTQYSILASESVARQVIDQLH---LDT-------LPEF
A0A2V8Y334      LY-ELESVSD-------SY--LKTQYSILASESVVRRVIDQLH---IDA-------LPEF
A0A2V9AY68      LY-ELESVSD-------SY--LKTQYSILASESVARRVIDQLH---LDS-------LPEF
A0A257VBK0      --PTGASSWMEEQKF------YNSQQQIMTSSVVMQDVVDKLK---LQS-------HEAF
A0A2V7XDY0      -----GGGYWQNADF------YNTQFRVLRSSALGEKVLDRLK---LK------------
A0A350UQT3      --QANVPSALDAESF------LASQIRLLQSDSVVRPVAQRFR---LLE-------S---
A0A2U3JZ71      ------TVANDSDQF------LATQAKLIQSDSVLRPVAQQYR---LLD-------TEA-
A0A2V8TTB0      ------NATNDADQF------LATQMKLIQSDSVLRPVVDKFR---LRE-------VEK-
A0A1F2TCR2      --ANDPMFWQDSTQY------YNTQYSILKSRVLGQRVVRRLH---LQD-------NPAF
A0A2N9LQU7      --SQKLADSDSEGGR------LQTELTILQCPPVSMQVIKNLD---LGH-------REEF
A0A2P6WFK7      --SQKLGGSDDINSV------LQTEVKVIQSDTVAMRVIDSLE---LAK-------RPAF
A0A1F2V330      YVQTMDGSVARVQDQ------LLTIREVLFSRPVLEPVMRNFH---LLP-------MP--
A0A2V8U914      --PAATPNASSNDVY------VKTQSEILQQDALIEQASDKLN---LAE-------RPEF
A0A2V7W309      TIEDLFGIASSDQEF------LQTQYELLKSRGLAMRVIEDHK---LLN-------DRDF
A0A2V8TLH7      QLGTSNFGWSAEERY------FNTQNEIIKSRDVAQRVFDKLD---LYH-------HPMF
A0A1Q7ZJT1      ETGMAQYGWYAEERY------FNTQYEIIKSRDVARRVFDRLD---LYN-------HPLF
A0A2V8VC99      EMGASQYGWFAEERY------FNTQYEIIKSRDVARRVFDRLD---LYN-------HPLF
A0A348UZU3      SFEDIFQIETFRDDY------FQTQYKLLQSRSLAERTIERLK---LWE-------KKEF
Q01XL7          DPQAGTDMTTASASN------IQTQTRILTSRSMLARVAERMS---LEM-------TPIA
A0A2V8ERZ5      --NDANQYYEDPEPY------YQTQYKILKGRDLTRRVVRKLR---LDT-------VPEF
A0A2V8GTX0      --QPELVY-SDPEPY------YQTQYKILQGRDLALRAVKRVK---LED-------VPEF
A0A2V8J0X9      --ASDPAFWQESGPY------YQTQYSILQSRGLGRRVVRKLD---LQN-------SPLF
A0A372IRG7      --ESKLSGGEESDQK------LQTELRIMQSDSVVMDVINSLD---LYH-------RKPF
A0A1F2U158      --AAD--YYQDPIPY------YNTQYRILRGRDLARRVVKRID---LQN-------VAEF
A0A2V8F6S9      --TPDNTYYEDPEPY------YKTQYRIIKGRELTRRVVKKLN---LQD-------RAEF
A0A1I6MH75      AVPGM-GQDTQTK--------MNTEIAIMQSDTLLLTVARELN---LPN-------NSDF
E8WVF6          PFSGL-GDDPQQK--------MMSEIAIITSDTLLTTVAKEMN---LAN-------NPTF
A0A1H5Z7N3      AATGGSGIESSSA-H------LPTQVSILKSDTLLLTVARDLD---LAN-------NPWF
A0A1G7JVV8      ATGNLTGSLQSED--------LETEVLIISSESLMLSVAQEMN---LAN-------NPDF
A0A1H4T6W9      ---QMMGSSLSQETN------LENELGIIMSDSLLLNVARNMN---LVN-------NPDF
I3ZEU5          ---QLMGSVGSQETN------LENELGIITSDSLLLNVARNMN---LIN-------NPDF
A0A428MDU2      AVQGYASDTAASK--------MLTEVAILQSDSLMLTVAREMD---LSN-------NPEF
A0A239HDF6      SPVGL-GQDTMTQ--------MMTETAILQSDTLLLTVAKDLD---LCN-------NPAF
A0A1Q3QQB6      AVQALGGTDTASK--------MLTEIAILRSDSLMLTVARDMN---LAN-------NPDF
A0A3N1K1G7      AVQGYAGDAQSSR--------MLTEIAILQSDSLMLTVARELN---LSN-------NSEF
A0A2W0BGU4      ------QQLQTDQDF------LRTQIQVLQSDNLAWRTIEELR---LAD-------NRMF
A0A2W0BVQ9      ------QQLQTDQDF------LRTQVQVLQSDNLAWRTIEQLG---LAD-------NRMF
A0A3D1ASD2      ------APVNDADEY------LATQINLIKADSVVRPVVQKLR---LRE-------VDGN
A0A2N9MK30      ------TGLNDADQF------LATQIKLIQSDAVLRPVADQYH---LRD-------L---
A0A2V9MN96      --NGGMSEDWDYNVS------LETQLSILRSDALALKVVEALH---LDS-------NPRF
E8UZE1          ------TASVATEQK------MATQLSILESQSIAWKVIEELK---LDA-------NPVF
A0A2V7V2Z1      ------QVDAARDDY------YQTQYKLLQSRALVRRVIESMS---LLQ-------DPEF
A0A2V7X2F7      ------EVDAAKDDY------YQTQYRLLQSRSLARRVVESLN---LLQ-------DPEF
A0A2V7V2I1      ------RVDSERDDY------YQTQYKLLQSRALVRKVIEEMD---LFQ-------DPEF
A0A2V7U3M2      ------QVDAARDDY------YQTQYKLLQSRLLARRVIETMN---LLQ-------DPEF
A0A2V7UHT0      ------QVDAARDDY------YQTQYKLLQSRALARRVIESMN---LLQ-------DAEY
A0A2Z5FVL3      SPAGGDTDPNSASMN------LETQATVLESPALAMKVIEDLH---LED-------TSAF
A0A1V6HR88      --VEAAWENYYSMEF------YPTQYRLLQSRGLAERTVQNLR---LDQ-------DPAF
A0A3E0P0A3      LGGQMFAQPWWNPEF------FPTQEQLLKGRGLAEAVTRDLA---LWN-------HRYF
A0A2V9KBD6      --DTSLLEDPEDRAA------IDTQISILQTDALALKVIQDLR---LDQ-------NPMF
A0A2W0AJ66      --GSSLPEDADERAA------INTQIGILESDGLASQVIHDLH---LE--------NGKF
A0A1Q7RBU1      --HPSLLEDPEDRAA------IDTQIGILQTDALAMQVINDLH---LDK-------NPKF
A0A2V9JPV9      --DTSLLEDPEDRAA------IDTQIGILETDTLAMQVINDLH---LDT-------NPNF
A0A2V8EXP2      ------EQNQVADDY------YQTQYKILQGRALARRTLDALR---LWD-------HPQF
A0A2W4RYA1      ------DQEQAQPDY------YTTQINLLRSRLLARRTIEALD---AWN-------HPLL
G8P0Y7          --NSSSSALEDPQAG------INTQVKILQSDTMAELVIHRMN---LDT-------RADF
A0A3D4VGU2      TSLASSSGGLQSQDR------VETQLHIMQSNTIAWNVIKTLK---LYN-------KPPY
C1F294          TSLASSSGGLQSQDR------VETQLHIMQSNTIAWNVIKTLK---LYN-------KPPY
A0A3P0X3W6      --DSATPNISDVEEF------LTTEIDLLQSDAVLRPVAKAYH---LL------------
A0A1E3Y9R6      ----EERESWYQDDF------YPTQYRVLQSRTLAQRTARVLA---REP-------AERV
A0A2W4TLP2      ----EDRDSWYQDDF------YPTQYRILQSRTLASRTAAAIE---GGL-------PERV
A0A3R9WF43      --DTPSDSADDLKAE------VQTDTSILQSDGLVLRVIKDLD---LAK-------KRPF
A0A317HKM4      ------DQRDWMSTF------LPTQVGILMSADLARTAHDELT---SS------------
A0A2W0C122      --ASALGDADDYSVS------LETQIRVLASRSLAEVVVRKLD---LAH-------NAEF
A0A2W0AUU7      --ASPLGDADDYSVS------LETQIHVIASRSLALAVVRKLD---LTH-------NAEF
A0A2W0BQL1      --ASPLGDADDYSVS------LETQIHVIASRSLALAVVRKLD---LTH-------NAEF
A0A3P0XH15      --QQEQGGIEADLTR------TATEIAIMQSDTVSLDVINSLD---LYH-------KQPF
A0A3M1WQW8      --QEALPYSSNDTQY------LRTQINVLQSRTLARRVIEELS---LDR-------QPEF
A0A3N1JHC1      RDADPYANGVTQDSY------LETQIMLLKNEVVADRVAMVMA---PR------------
A0A2V9KA79      LRLGGYGDAIHIQDQ------LRIIKEHLYKPALLERIIREFG---LYP-------VTRG
G8P085          -----TGTQADSAEL------IATEMAIIKSDAVAIDTMHSLS---DEE-------FREY
Q1ILD9          ----GLSSGMDWNSQ------LATQIKILQSDALAWDVVKRLR---LDQ-------KPPF
Q1IJZ6          LASTVGGGSGDTKTE------VQTQVAILQSDDLAIETIERTG---FEK-----------
A0A2V8TCE6      --IRTDPSYQGYSAF------YETQYRILQSRAVARRAAERLD---LP------------
Q1ITG0          GDLATGAGGLDWSSK------LETQARILKSDTLAWDVISQLR---L-------------
A0A3N5PCI5      --EGAADPQANERGY------LETQHRLLRSRSLARRVIDALN---LWD-------LGRA
A0A3M1Q0S9      --SSAEPSWLDYQNW------YNTQYQIMQSDEVLRRAVDLLD---LMN-------TGLP
A0A3M1VZ38      --TATEPSWLDYQNW------YNTQYRIISSDAVLRYAVKQLD---LEN---------RP
A0A3M1PY35      --VSAPVGFFDTERF------YQTQYLLMRDPAVLERALDNDG---LRE-------LLLA
A0A3M1VMP2      --VPMVWNEYEIQRF------YQTQYLLLRDPAVLRDALDRYG---VRE-------ALAP
                                            :                               

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A399Y5V2      -------------AIQA-------------------------------------------
Q01X01          QRSSSLWDRLRPGTSQA-------------------------------------------
A0A2V7VMF7      ------------------------------------------------------------
A0A2V8JK38      AAPQRGF------------------------LAAQAGNLKKISSVEKTEQASDDEG----
A0A2V9IXG5      QN----------------------------------------------------------
A0A2V9J2P4      QN----------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      FRPQM-G-------------QRTTWQRLLDMVGMGRDSGDSSQPV---DDGVLMTSSVAP
A0A321LPW6      LAAED---------------RRGVWSAIKSIGGRSALREAGESPPEQ------ASDAADT
A0A2V9R9V4      L-ASQ---------------KKSVWESLHEIAGKIQRDDASAPPAVF------TATAMKS
A0A321LE75      MEVTR---------------KKSLVEAVQTIGSKFKQEVTSELPVLE------PGVQIEG
A0A2V8R8U7      LGGQA---------------QSSVFASLKRIFSGERIATPPAQNPA--AEQTVTMDEMKD
A0A2V8QMP4      FGTNR---------------GTGVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAELSA
A0A2V8R4S3      FGTNR---------------GTGVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAELSA
A0A2V8NJ55      FEGQA---------------SSGFFASIRRIFFGDKPAPAHVD-----KVPVVVNPTIKN
A0A2V8Q7I0      FGGQS---------------QGGIFASIKRMFAGDKAKPKISAPGPT-GLDVVRAAQLRD
A0A2V8S6K4      LGGQS---------------RPSIFTTLRRAFSRNKAQTNEQPQPADGGLTVANEAAPGD
A0A317I2L9      FGGGS---------------QGGFFASLRRILSGDQRRTKAKPAEPT-KLELVGESQLRD
A0A2V8LLF9      LSGQA---------------QTSIVASLKRIFSRENAPAS-SPSTNA-TVEPISEEDLRS
A0A352FRF4      FGPQG---------------QSTIFASLKRIFSRDSVPKT-SPTPAA-GSVPLNEEALNN
A0A2V8MKV0      LGGRA---------------NSGLFNSLKYLFSRTKIAPAPAPAASS-GEQTITQDELID
A0A2V8PYY8      LGGRA---------------NGGLFNSLKYLFSRTKNAPSPAPATGS-SETTMSEDELKN
A0A1Q7YKQ8      LGNQS---------------QHGLFTALRRIFSSERTTNA-SPATRT-NLPVISPERVTE
A0A352F3R7      FGGQT---------------QGGVFSSLRRIFSKPKKATV-APAAPA-GLVVVGESEVTG
A0A0B6WXT1      LSGQA---------------GPSLTSSLRRILSRRKKEEN-E---QG-KLQVVTDSEVDA
A0A3B9MEU8      FGGQS---------------QGGVFASLRRIFAKPKKASE-SPAVSS-GLTVVGESEVTN
A0A2V8MHG6      LHPQSAT-------------RPSVWESLKGLVGLSKSQSKPREPE-G------YVLRPSS
A0A2V8P7N1      LHPQSAQ-------------DLSFGESLKGLIGLRKSQSKTKEQE-G------YVLRPNS
A0A2V8M3M6      LHPQSAQ-------------DLSFGESLKGLIGLRKSQSKTKEQE-G------YVLRPNS
A0A1Q7NJH5      LHPQSAQ-------------NLSFWESLKGLIGFKKSQSKTKEQE-E------YVLRPNS
A0A2V8PJY0      LHPQSAQ-------------NLSFWESLKGLIGFKKSQSKTKEQE-E------YVLRPNS
A0A1Q7Y6W9      VHPQSQS-------------NRSTWQSILQMIGLSRSSTQEQNQQ-A-SQDIPLTTNVAS
A0A2V8NC68      LNPQSFN-------------KRSTWDSIKRMFGLSDKKEREQEQK-L--DDAPLVDRIAP
A0A399WK13      QAAAKAS-------------SGSMLGRLLRSVGLASGDKQKQEES----VPIDPNSTLA-
A0A352FLX4      LRETSSK-------------NKSTWLDIRGMLGLKAKTPPQSSTP----DVLPQSSSSSS
A0A2V8RTL7      QAAKNAH-------------GTSAWRSMMKAVGLASDKSSNSPDANT-QKSEETNSSLV-
A0A3E0PCJ6      RKDSAEG-------------SGSALRGMLTALGLASDDSKKEDVVE--EVPLASNTELA-
A0A3M1S4R8      QEERNRQ-------------QASTWRAILRSIGLAREETKKTRDLE--EV--LAGMNLA-
A0A1Q7YFI6      LNPQAAQ-------------SRSTWENLKRMFGFGRPANNQQSVP-Q-NMMPLVDSSLAP
A0A136KC10      QALARTD-------------STSTFGRILRSVGLASGETQKSEQLA----AIDPNSTLA-
A0A2V8SEX6      LTARSEG--------------TGILRAMLRAVGLA-SDPKKDTAPND-EFAASANSSLI-
A0A3M2D6Y5      QEEKNQQ-------------RASAWRAFLRSIGLVREERRKEDTKID-EITPGMN--LA-
A0A0B6WWQ6      LRPRAVR-------------DLSPWLNLRRMLMLGTGQEKSAGQRGT-RGQMPLPSEIAP
A0A3B9MK99      FK-GTIQ-------------KRSTWQTIKRMAGFASADPPDVTAK-P-KDELQLRPAVAA
A0A352EX26      FK--GTQ-------------KRTTWQTVKMMAGFDNNVPKPDQSK-P-NDVLQLRTTVAP
A0A2V8MM59      LSPQSSQ-------------PHSTWQTIMQMSGFANPDPK-AGKQ-S-KE-LPLTTSFAP
A0A2V8PFE8      LRPQSLR-------------QPSTWKTILQMWGVSGPEKKDPSTQ-P-KE-LPLTSTVAA
A0A2V8PWS6      LRPQTLR-------------QRSTWKTILQMWGVSGPEKKDPSTQ-P-KE-LPLTSTVAA
A0A2V8LCT5      LRPQTAQ-------------PHSTWKTILQMLGVGGREKKETKQQ-N-NV-LPLTTSVAP
A0A352FTJ9      LRPTAAQ-------------PHSTWKTIVKMLGAGA-EKKDTVPA-P-NV-LPLTSAMAP
A0A2V8G155      GGTAP--------------ADSPFSLRRVIALVHTTNAGPPPPPPDET------------
A0A2V8HDM7      GGTAP--------------ADSPFSLRRVIALVHTTNAGPPPPPPDET------------
A0A2V8DRT9      -----DTFDSAKAPKKMSIRTAVASVVAPVFHLFVARKAIEPEQTGET------------
A0A2V7VYF3      GGPTPNTTSSSSTRGAIGFTNGILALVRGAFQSKAETIGREKRAPAES------------
A0A1F2SVH2      NPKPDDSLTMRK------IALAPVVLVAGWFKPAQPL---EPPLPDES------------
A0A2V8AJG9      KPN-DDNLTVGK------IAAAPAAFVSSWFRTAAPV---GMPGSDES------------
A0A2G6PYV5      -----------------------------------LDLGTVNEPREKTQKTKEDQA----
A0A2V8F956      RNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGGSAARTTESANPGPDET--
A0A1F2S1W5      -----------------------------------TQPARPTVRSVIMMPVNAVARWFEP
A0A1F2T595      -------------------NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAET----
A0A2V8JQV5      -------------------------------------------RIALGIAKTSAA-----
A0A2V9AC41      GGKADKADSQKGLVANLKDGLKERVKGFVPDKPKVNAPPPDPA-----------------
A0A2V8K4L4      -----------------------------------GTSTDRLAAWRKVLHIAPKQA----
A0A2V8NCZ3      -----------------------------------GTSSDRLAAWRKVFHLSSKPA----
A0A2V9MAM9      -----------------------------------VLPGWSERLLPVFAPRSPGG-----
A0A2V9M454      ---------------------------------------GQTSPADGRVLGTPPA-----
A0A2V9IVR7      ---------------------------------------APPLKGASPQRGESAE-----
A0A2V9ILE2      ---------------------------------------APPLKGASPQRGESAE-----
A0A2V9LGY4      ---------------------------------------APPLKGASPQRGESAE-----
A0A2V9J4D6      ---------------------------------------TKGPQKQRKESIDSAD-----
A0A2V9L9C5      ---------------------------------------TKGPQKQRKESIDSAD-----
A0A2N9M9N1      ---------------------------------------WPVSTSRSTVA----------
A0A2V9JEC4      ---------------------------------------NPRRTASSKSQLESLPP----
A0A2V9LPQ3      ---------------------------------------IPQTPKDASGQRAPEPR----
A0A348V070      -----------------------------------IAPKLPVKLQKEGVQPDNP------
A0A2Z5G3A3      ----------------------ESKFNPIDMVLGIFSPGGASDPPGASLQQSP-------
A0A2V7UGP8      -----------------------------NRLVNRVRHKGPFTRLAEIVRHSPLDEIPE-
A0A239MKT6      -----------------------------NEIPKGKLHDVYERERSLPLKDAP-------
A0A3E0PCN7      LQPNQGEQSTVWQNVLKMFGFYQTKSMTPVEFA--DKETEDALQLSLDSNEQPSEP----
A0A2V8IYW3      --------------------------------------------LEFDLYPEQRKQ----
G2LEI9          LATGPTT--------------LSAALLDLIRSPRGPRKPPQSETKSAELPEASPTPATTE
A0A317J121      -----------------------------------PVQNDIFSRLRRRLTTNTQDPM---
A0A2V7YW66      ------------------------------------NPGAAARKDGGRGPTAEDDD----
A0A2V7Z0V0      ------------------------------------NPGAA--REGAKGGTAEADE----
A0A2V8GFD4      SGGG-----------------RQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDET----
A0A2V8HSS5      SGGG-----------------RQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDET----
A0A2V8KP55      ---------------------------------------AAPQRGFLAAQAGNLKKISSV
A0A399WNU1      FRPGKDQ-------DTTVWQNVARMFGLYSQPVRNQAESAPPAKNTLDLKTDTDADLDSQ
A0A2V9CG11      -----------------------------------ARKSHSIVRRMLRLSNSQH------
A0A2V2R0I6      -----------------------------------STPTGPSEAVAIGTL----AN----
A0A2V8XAR9      -----------------------------------SSPNGPSEAMASGSL----AN----
A0A2V8VZA0      -----------------------------------SSPNGPSEAVASGSL----AN----
A0A1Q7CB82      -----------------------------------SSPNGPSEAVASGSL----AN----
A0A2V8WIU1      -----------------------------------SSPNGPSEAVASGSL----AN----
A0A1Q6Y9F5      -----------------------------------SSPNGPSEAVASGSL----AN----
A0A2V9EVV8      -----------------------------------SSPNGPSEAVASGSL----AN----
A0A2V8YF91      -----------------------------------SGPGGPSEAVASGSL----TN----
A0A2V8XZK2      -----------------------------------SVGGGPSEAVASGSL----AN----
A0A2V8ZTX6      -----------------------------------AASGGPSEAVASGNL----AN----
A0A2V9BT79      -----------------------------------AESGGISEAVANGNL----AN----
A0A1Q8B793      -----------------------------------SEGGKPSEAVTTGSL----AN----
A0A2V9BCA0      -----------------------------------SEGGKPSEAVTTGSL----AN----
A0A2V9BWU9      -------------------------------------GGQPGKASKPASVPVNAAN----
A0A2V9DKX2      -------------------------------------GGQPGKASKPASVPVNAAN----
A0A2V9JSI3      ----------------------------------------SPPRGGKPVSPA--------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ---------------------VTNKRGIVQTLAGGVASLFGKKAPEPGIPDAGET-----
A0A1F2TPT3      AGRGAGNGVGKRDGQAGKSGPDGWWSAASLFVSRAFGGFPPPPRAAEPLAGER-------
A0A2V8JTQ2      TARGGRA-----------------------------------------------------
A0A2V8UZY0      TGRVEQP-----------------------------------------------------
A0A3N5YNR8      SVPVREG--------------VVTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGR----
A0A350UEK1      PAA---------------------------------PGRLAAWRQALNLPEEAAT-----
A0A350UIQ4      PAS--------------------------------TPSRISAWRRALNLPDVPEN-----
A0A3N6A5T6      -NAETSG--------------GLLTDSLAGLIGGTIALLKGRQPETPDSAENRLDK----
A0A1F2Q9L4      -----------------------------------NPGRSRLPGGSGGAVTASDDA----
A0A1H5SQF5      L----------------------------------ALRPANATASGQSLLETDP------
A0A2Z5G448      ---------------------------------------SKVFEKQPYVLGKPLTP----
A0A3E0NV31      ---------------------------------------VRSVDRGFFLDAAEAGLDLIK
A0A3N5M5V0      EVPVREG--------------LVTSQLGSVKKAMSGLFSKSDSGAAAANRESMPGM----
A0A2V9AEW6      T----------------------------------AWGIFASRVHRLFAFSRTGRL----
A0A2V8WQK6      T----------------------------------GWRGLASRVQRIFAFSKASNL----
A0A2V8XIF4      T----------------------------------GWRAFESRVQRFFDLSKTPHL----
A0A3N5XQP8      Q----------------------------------LREKSGVISETLRQVMRAVRGVIDR
A0A2Z5G7H4      QPRYDAL--------------GSIFRLL--------SPSGPADPLNASLENSP-------
A0A2V9KCS3      -----------------------------------LEQPTKLSAWRKALGLPQPAA----
A0A2U3KC61      --A--------------------------------EDAMQPDPARE--------------
A0A2V9Y2R7      VGS--------------------------------TAASQPNPGAQGLSELKPNND----
A0A372IT17      FPAKKRG--------------LTIPGWI-------FFWRSPLEPRSVPLEEAP-------
A0A136JPP4      FGS--SN--------------RGFFASIKSLFVSPKSPETPKGALPVLTGTENADP----
A0A399WUJ8      LGQ--SD--------------RGFFATIKSLFSGPAKAQAPQGTLPVLTGTENADP----
A0A2V9L5B5      ----YRN--------------RGLFGLYESDPEKIPS-SDPGPPDTLT------------
A0A2V9L7I0      ----YRN--------------QMFFGLFESDPEKIPSISQPGLPDTSS------------
A0A2V9LK56      ----YRS--------------RRLFGLFESDPARIPSPTED--LDPSS------------
A0A2V9YHT3      -----------------------------------WDKAFAPANAGAIPLDSKLTP----
A0A2V9NGH6      -----------------------------------GGSGQ-AQSTSLELTTDILQP----
A0A2V9PYE6      -----------------------------------GGSGP-AQSTSLGLTTDILQP----
A0A2V9NL07      -----------------------------------GGHGA-PPASSLALTTDAFEA----
A0A2V9QD92      -----------------------------------GGHGA-PPASSLALTTDAFEA----
A0A2V9WPZ6      -----------------------------------GGKPD--SASSLNLAPDPLQT----
A0A2V9ZLH4      -----------------------------------GGKGDMPSPNALGITTDELQI----
A0A2V9RQF1      -----------------------------------GGKGE-SSGNSLALTTDALQP----
A0A2V9YDK8      -----------------------------------GRKPD--DASSLNLAPDPLPT----
A0A2V9V8F7      -----------------------------------GGKPD--SASSLNLAPDPLQT----
A0A2V9XGR9      -----------------------------------GGKPD--SASSLNLAPDPLQT----
A0A2V9V3Q5      -----------------------------------GGQSA----PQPNLVADPLQN----
A0A2V9NWS3      -----------------------------------GGNGQVPSPNSVQLTTDSLQV----
A0A2V9USA9      -----------------------------------NGRAP----SSLELTPDPLQV----
A0A2V9XW18      -----------------------------------AGQAPPIPSPSLDLT-DPLQI----
A0A3M2BZG9      TGR--------------------------------SADLLPGAADATTVDD---------
A0A1Q7N5R7      AVADQYR--------------PGR-----------YHLKVDRTGQHFSLQDEDGTELERG
A0A3M1SIV3      IIR--RN--------------SGITALFKSIFESEKDK---QEQIVLPVINESDFQKSLD
A0A3E0PHB0      YGG--KS--------------RGIFETLGAMFTGGPKN--SEEAGALPVVDSVD---GET
A0A3M2D491      FKG--QG--------------RGVIASIKSLFSGGSDE--PSKTQSLPVLSENN-DEGFS
A0A357F267      FGD--GD--------------RGFFAAVTSIFSSTKEEEKEKEADSLPIVSDTA-ESPSP
A0A353C9L6      FGA--SE--------------RGILASLRSIFTGSGQN--AEVPSALPVVSEPE-LLGEE
A0A2V8RQV0      FGG--QN--------------AGILAGIKSLFSRSKAQ--TEEANALPVISDTE-QLNSK
A0A2V8SJH5      FGE--ED--------------RGLLSGVRSMFSSRKAN--SGPDNSLPVVSELP-AGTDA
A0A2V9QB26      PKVRTSR--------------FSLWRKA-------------------SLPETKPSD----
A0A2V9VYY4      TAVKQSS--------------PES-----------------------AMGEPSMQP----
A0A2V9KIE8      -----YR--------------KSILF---------GLMETTPANVPSPTDNAPPDV----
A0A352F549      LDGRVEN--------------RSTWRSLLTMFGFSQKQAEAPKNQN-VLPDVNSSPAFAS
A0A3B9MLP9      LDSHVDN--------------RSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP-LTT
A0A3D5SQ87      LDSHVDN--------------RSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP-LTT
A0A2V8NW86      KVKTSRF--------------SLW--------------------RKAVLPELKLSD----
A0A2V8ZHL8      -----RE--------------PGWVLAA-------GSGNDGLPAQP--------------
A0A2V9B240      -----RD--------------PAWALAV-------GLGNDVPPVQL--------------
A0A2V9CBM2      -----NA--------------PQLFS-W-------KWKKKAPTSQTFTVGPIPA------
A0A2V8XN17      -----NS--------------PRWWQFW-------PSKKKSPPPQTFTIGPVSEAR----
A0A2V8WX45      -----NS--------------PRWWQIW-------PKTKKPSTAQTFAIGPVPAGG----
A0A1Q6YR79      -----NS--------------PKWWQFW-------PRNKKSPAPQTFAIGPVPETR----
A0A1Q7VA32      -----NS--------------PKWWQFW-------PRNKKSPAPQTFAIGPVPETR----
A0A2V9EY85      -----NS--------------AKWWQLW-------PRKKKSPAPQTLAIGPVPEAP----
A0A2V9H8K0      -----NS--------------PRWWRFW-------QERRKPSTTQTLATGPVPEVR----
A0A2V9FFE5      -----NS--------------RKWWQLW-------PETRKPSTTQTFTVGPLPQVR----
A0A2V9GM43      -----NT--------------RKWWQLW-------PETRKPSTTQTFAVGPVPQVR----
A0A1F2RFI7      ----DEK--------------PSW---F-------AKLLSKSRSESQQLPAEDLAL----
A0A1F2RZS3      AKEQESS--------------PSW---L-------GTLWPGGAEQPEGPLSPEEQL----
A0A1F2USE2      -----NP--------------PQPWWSW-------GGKETAAAAPTLVVGTSEPEQ----
A0A2V9C238      -----NP--------------RASQLGD-------AKPQNAAAAQSFTAGDT--ER----
A0A1F2Q9F5      -----SR--------------PGFRLRG-------GKRETPASPQTFAVGAAGVAR----
A0A1F2QQH9      -----SR--------------PGFRLRG-------GKRETPASPQTFAVGAAGVAR----
A0A1F2QXK7      -----SR--------------PGFRLRG-------GKRETPASPQTFAVGAAGVAR----
A0A2V9DEM9      -----NP--------------RASQLGD-------AKPQNAAAPQSFTAGDT--ER----
A0A2V9CYQ5      -----NA--------------PPL-LSW-------KWKKKAPRSQTFTVAPIPA------
A0A2V9BWU8      -----NA--------------PKW-WSL-------KRFARAPQKQAFALGPAPVAH----
A0A2V8ZG48      -----NR--------------PKW-WQF-------GKRLSLPRKQTFALDPVRPGQ----
A0A2V8Y334      -----NS--------------PKW-WQF-------RKKAFKPRNQTFALDQESSAR----
A0A2V9AY68      -----NK--------------PKW-WQL-------QERFFTPHKQTLALDPAGRAR----
A0A257VBK0      KDVKDP------------------------------------------------------
A0A2V7XDY0      ---------------------------------------------DP-------------
A0A350UQT3      --------------------------------------EQQLAKEGD-------------
A0A2U3JZ71      --------------------------------------EGSDATLSR-------------
A0A2V8TTB0      --------------------------------------DALEQPSER-------------
A0A1F2TCR2      NGQAPPRRGPLIAVRNARASLGKAIRRLITRPIQTPA-VEPAAPDEN-------------
A0A2N9LQU7      AGKTLMASVT----------------------------AIDPVKMDP-------------
A0A2P6WFK7      AGK-YAASAK----------------------------LTNPSAMPP-------------
A0A1F2V330      ---------------------------------------------DG-------------
A0A2V8U914      QPHSGFWERL----------------------------REASPRAAQ-------------
A0A2V7W309      YGPGV---------------------------------EGKTKAEID-------------
A0A2V8TLH7      RKSSDP------------------------------------------------------
A0A1Q7ZJT1      KKSVDS------------------------------------------------------
A0A2V8VC99      KETTDP------------------------------------------------------
A0A348UZU3      SGGKN---------------------------------VTGEDLKNP-------------
Q01XL7          STPTTFFTKLRAH-------------------------IPFAQKEPL-------------
A0A2V8ERZ5      NGTKPAPPTASTLLQEAKDKIIGIAKP------NAP--AEAPKVDET-------------
A0A2V8GTX0      NGKGAKPPLLTQVISDLKAKIAAPFRG------QTA--APPPRPAGP-------------
A0A2V8J0X9      NGSAPPPRDPLSLARQGRAAASAWLRGLIVKPPPAA--AAPPAPDEP-------------
A0A372IRG7      SDMFAK--------------------------------QPYTGHLTP-------------
A0A1F2U158      NGTAKPAETPVTKARDAGDRLLRFLARTPTPI------AEVPKPDET-------------
A0A2V8F6S9      NGTERPRPTPFSMLREAEQRIVRLVRPAKEEP------TEAPKVDEA-------------
A0A1I6MH75      LEIKGK--------------------------------APHASLDSP-------------
E8WVF6          LSVKGP--------------------------------IPHSSMEDP-------------
A0A1H5Z7N3      LGTQKSKQA-----------------------------QPHRNIDDP-------------
A0A1G7JVV8      MG--SG---------------------------------PYRNINDP-------------
A0A1H4T6W9      MGGKAA---------------------------------RFRDINDP-------------
I3ZEU5          MGIRVG---------------------------------KVRDINDP-------------
A0A428MDU2      LEVK-G--P-----------------------------VSHTTLDDA-------------
A0A239HDF6      LGRKTA--P-----------------------------EPRRDLNDP-------------
A0A1Q3QQB6      IGKD-A---------------------------------PHGNIDDP-------------
A0A3N1K1G7      LEVK-G--P-----------------------------LPHTNLDDA-------------
A0A2W0BGU4      A-------------------------------------DESRVTESQ-------------
A0A2W0BVQ9      A-------------------------------------DESRVIDAQ-------------
A0A3D1ASD2      D-------------------------------------LMENTSEAR-------------
A0A2N9MK30      --------------------------------------ERKARAGSD-------------
A0A2V9MN96      TGFVPVANDASRSI------------------------GSANLGPDS-------------
E8UZE1          SGITSSAT------------------------------PKPLNSLTD-------------
A0A2V7V2Z1      GGPRSAEEIEA---------------------------VKAASPGAS-------------
A0A2V7X2F7      GGPRSPEEVKG---------------------------ALAAPPGSS-------------
A0A2V7V2I1      GGPQPAEQRAA---------------------------LKASAPGSS-------------
A0A2V7U3M2      GGPRSPEEMEA---------------------------VKAAAPGAS-------------
A0A2V7UHT0      GGPRSPEEIEA---------------------------VKAAAPGAS-------------
A0A2Z5FVL3      KPHFTFTGWVNSLFSPPPPADP----------------AGVALSAAP-------------
A0A1V6HR88      NPARASLAGSD---------------------------EGGSAAADQ-------------
A0A3E0P0A3      GGAVDRSSYVRPG-------------------------EPVTADDDA-------------
A0A2V9KBD6      IG----------------------------------------GA-KA-------------
A0A2W0AJ66      DG----------------------------------------GKIEP-------------
A0A1Q7RBU1      AG----------------------------------------RAEQP-------------
A0A2V9JPV9      AD----------------------------------------RAAHS-------------
A0A2V8EXP2      NPKGEAAFSLGALVTAPLRWLSAW--ATPPPAI-E---PGGVSAGET-------------
A0A2W4RYA1      VPERGALAVVREGVASVMRWFRSPEGGVPDPAVGQ---AGGQEPPET-------------
G8P0Y7          AGRAQTQSNGGIA-------------------------VSQSPAEES-------------
A0A3D4VGU2      SGVFKK--------------------------------AGYHGTVTP-------------
C1F294          SGVFKK--------------------------------AGYHGTVTP-------------
A0A3P0X3W6      -----------------------------------------PRDKKG-------------
A0A1E3Y9R6      PAASTWSFSPSAVVGTTIAAVRHWFGPAPVLPAASDG-ADPAPGAVS-------------
A0A2W4TLP2      PPASSLSFSLSSLLGGAVSAVADMFGPGPV---PAAG-GEEPAAVES-------------
A0A3R9WF43      LGAIVRGE------------------------------ADKPLEDAP-------------
A0A317HKM4      --------------------------------------EAALPPNER-------------
A0A2W0C122      MRDANRQ-------------------------------FASLREIAP-------------
A0A2W0AUU7      MRDANRQ-------------------------------FASLREAAP-------------
A0A2W0BQL1      MRDANRQ-------------------------------FASLQEAAP-------------
A0A3P0XH15      AQVFVR--------------------------------QPYNGKLTP-------------
A0A3M1WQW8      AG-------------------------------------LARIRDAT-------------
A0A3N1JHC1      --------------------------------------VPPSLASND-------------
A0A2V9KA79      AATSRQ------------------------------------------------------
G8P085          AGPNAKQLA-----------------------------IPLGAISLS-------------
Q1ILD9          AGDKLYTEGSGTWYSHHGLRSLP---------------NEPLSNIGN-------------
Q1IJZ6          ---------------------HIGSYWHLFPSGRVTSEQGLPLRNAP-------------
A0A2V8TCE6      ---RHPLLPRKSPGLLQRTLAALRRALP----------RGEAHAAPA-------------
Q1ITG0          -------DQNEAFATKSLFGRSLQTPVG-----------KDVSSVDE-------------
A0A3N5PCI5      PA-DGNAQPAGTFAFLGQWRSWLGRAVGAATGATSSQEKEPGSVRET-------------
A0A3M1Q0S9      G--QDDSRENRFFSAIRKLRTTVVRTLS----------RTQVPIEED-------------
A0A3M1VZ38      TLLGEQADEEPSPFSLGGLRAKILSVIG----------RGAPETGEV-------------
A0A3M1PY35      SLRPEDEEDLAAW--------------------------EPPDDGDL-------------
A0A3M1VMP2      EL-TEPGEDGEEP--------------------------KPPTDDQI-------------
                                                                            

A0A2V7YYV7      -----------------------------------------DLAKRIKATPQ--------
A0A2V7Z0J5      -----------------------------------------ELVKQVKVTPDA-------
A0A2V7Z3M4      -----------------------------------------DLARQIKVTPD--------
A0A3M2D9H8      ---------------------------------------------QVRVQQV--------
A0A399Y5V2      ---------------------------------RVTAQVLGQ------------------
Q01X01          ---------------------------------PVTRTAVDEVRKNLQIISS--------
A0A2V7VMF7      ---------------------------------KDNPEAGALFVTHVGVEPI--------
A0A2V8JK38      ---------------------------------DQLRSLIDQYLDRITVKPL--------
A0A2V9IXG5      ---------------------------------QSSDGIAGELGGGISLAPV--------
A0A2V9J2P4      ---------------------------------QSSDGIAGELGGGISLAPV--------
A0A192WQ77      ---------------------------------EAAHNPVQTFRSMIRVDPR--------
A0A1Q7RLS4      ---------------------------------KKSVDSIGAFSEMIVVAPV--------
A0A2V2R525      AT-DKEDLAEI----------------------KRLNPFVGAIQSGLEVEQV--------
A0A321LPW6      DKQ-PGPGADA----------------------NDLAALIRALDKNLSVEPI--------
A0A2V9R9V4      KIEGNRSPEEV----------------------ERLAPYVGMLEESLRVRPI--------
A0A321LE75      GID--RSPEES----------------------ARLAPFVAVLSGNLSPEPL--------
A0A2V8R8U7      --R-QLTPEEL----------------------ATLEPYEDAIIANETIEPI--------
A0A2V8QMP4      --D-QIAPEQA----------------------QALEPYEDAMRAGLNIDAV--------
A0A2V8R4S3      --D-QIAPEQA----------------------QALEPYEDAMRAGLNIDAV--------
A0A2V8NJ55      --E-QLSPEQL----------------------ERLEPYEDALRASLTVEPV--------
A0A2V8Q7I0      --Q-PLSPEEL----------------------AALEPYEDTIIANEDIDGI--------
A0A2V8S6K4      --ELKLTPEQL----------------------KQLEPYEDALAGNLTVDPV--------
A0A317I2L9      --Q-PLSPEEL----------------------AALEPYEDAIIGNEQVDGI--------
A0A2V8LLF9      --R-QFTAEEL----------------------TQLEPYEDAIAAGETVEAV--------
A0A352FRF4      --Q-EFTPEQL----------------------AALEPYEDTITANEIIEPQ--------
A0A2V8MKV0      KVN-NLTPEEV----------------------VRLEPYEDAITANEEVDTV--------
A0A2V8PYY8      KIS-NLTPEEL----------------------VRLEPYEDAIIANEDVGIV--------
A0A1Q7YKQ8      --Q-QLTPEQL----------------------TRLEPYEDALAGNLTVEPV--------
A0A352F3R7      --D-SLTPEQL----------------------AELEPYEDGIIAGEAVEAV--------
A0A0B6WXT1      --E-NLTPEQL----------------------AKLEPYEEAILAGITVEPV--------
A0A3B9MEU8      --G-SLTPEQL----------------------AELEPYEDAIIAGETIEPV--------
A0A2V8MHG6      AL-SNDDIAQT----------------------NHLQPYVEMLQSQLSVKQL--------
A0A2V8P7N1      AL-SNDDIAEA----------------------NHLQPYVEMLQSQVSVKQL--------
A0A2V8M3M6      AL-SNDDIAEA----------------------NHLQPYVEMLQSQVSVKQL--------
A0A1Q7NJH5      AL-SNDDIAEA----------------------NHLQPYVEMLQSQVSVKPL--------
A0A2V8PJY0      AL-SNDDIAEA----------------------NHLQPYVEMLQSQVSVKPL--------
A0A1Q7Y6W9      AV-ASEDLAEA----------------------KRLQPYVSMLQGGLKVDPVKETRLLI-
A0A2V8NC68      AT-AREDLKEV----------------------NQLAPYIESLQGGLSVKEV--------
A0A399WK13      ---SADEIAEA----------------------VRLTPFVEVIRRNLSVDPVRESRATV-
A0A352FLX4      ST-AAQEQAEA----------------------ERLSDYVDDLQETLKVEPVKETRLTV-
A0A2V8RTL7      ---SADEIAEA----------------------LRLSPYVDLIKEDLIVEPVRESRATV-
A0A3E0PCJ6      ---TVEEMNEA----------------------VRLAPFVDAVQRDLIVDPVRESRATV-
A0A3M1S4R8      ---TAEEINEA----------------------VRLAPFVEILKKNLRVDPVRVSQATF-
A0A1Q7YFI6      AT-IEGDIAEV----------------------NRLAPYVGMLQGGLSIKEI--------
A0A136KC10      ---SADEIAEA----------------------VRLTPFVEVIRRSLSVDPVRESRATV-
A0A2V8SEX6      ---SSDEIAEA----------------------VRLAPYVEIIRKNMSVEPVRESRATV-
A0A3M2D6Y5      ---SVEEMNEA----------------------IRLAPYVEIIKKKLQVEPVRESRATF-
A0A0B6WWQ6      ATESQDDFDVA----------------------MRLDPYVRTIASSLKVDPVKEVRLPV-
A0A3B9MK99      AT-SQEDLVEA----------------------KRLAPYVGAVLGGLRVEPVKESR-GLF
A0A352EX26      TT-SQEDLVEA----------------------KRLSPYVGAILGGLRVDPVKESR-GLY
A0A2V8MM59      AT-SSEDLVEA----------------------KRLAPFVGALQGGLKVEPVRESRAGYY
A0A2V8PFE8      AT-SNDDLAEA----------------------KRLAPYVGALQGGLKVEPVRESRAGYY
A0A2V8PWS6      MT-SNDDLAEA----------------------KRLAPFVGALQGGLKVEPVRESRAGYY
A0A2V8LCT5      AT-SSEDLVEA----------------------KRLAPYVGMLLGGLRVDPVRENRAGYY
A0A352FTJ9      AV-SSDDLVEA----------------------KRLAPYVSALAAGLRVEPVRENRAGYN
A0A2V8G155      ---------------------------------ALQSRAVDAFLARLDVTPV--------
A0A2V8HDM7      ---------------------------------ALQSRAVDAFLARLDVTPV--------
A0A2V8DRT9      ---------------------------------TTQSRILNDFLSNLTISPI--------
A0A2V7VYF3      ---------------------------------AAESQAIDAFLGGLVINPV--------
A0A1F2SVH2      ---------------------------------KVQSNTIDRFLRALTVAPV--------
A0A2V8AJG9      ---------------------------------KQQSRVIDRFLKDLTVSPI--------
A0A2G6PYV5      ---------------------------------KEITKIASNLIGGVEIKEV--------
A0A2V8F956      ---------------------------------ASQSDAIDAFENALTIAPV--------
A0A1F2S1W5      PRPVEPPDAAET---------------------RVQSRVINRFLAALDVSAV--------
A0A1F2T595      ---------------------------------RTQTVVINRFLANLGVSAV--------
A0A2V8JQV5      ---------------------------------SAREAAISLAAATLQVEAL--------
A0A2V9AC41      ---------------------------------TAGKRLAGSYLSKLHISPV--------
A0A2V8K4L4      ---------------------------------LDRNNAIAAAAGGINVKAS--------
A0A2V8NCZ3      ---------------------------------IDRDRAIRMAGEDIKVKGS--------
A0A2V9MAM9      ---------------------------------NDDREAILRVKDRLRIEPS--------
A0A2V9M454      ----------------------------------MKNAAVAAFKARLKVERP--------
A0A2V9IVR7      ----------------------------------AESPLVGIFKGGLRVEIM--------
A0A2V9ILE2      ----------------------------------AESPLVGIFKGGLRVEIM--------
A0A2V9LGY4      ----------------------------------AESPLVGIFKGGLRVEIM--------
A0A2V9J4D6      ----------------------------------VRGRLVKLFDSYLGVNLH--------
A0A2V9L9C5      ----------------------------------VRGRLVKLFDSYLGVNLH--------
A0A2N9M9N1      ----------------------------------TPANLIRSFKKHLHIELL--------
A0A2V9JEC4      ----------------------------------LQDRLIRAFKKHLHVALM--------
A0A2V9LPQ3      ---------------------------------MLRDRLVREFQRSTTVRLM--------
A0A348V070      ---------------------------------VFKERLIDEFIESLNVSPL--------
A0A2Z5G3A3      ---------------------------------GRMSHALKVFSKNLTVTPV--------
A0A2V7UGP8      ---------------------------------DPDKPYIQFVLSGLDINPL--------
A0A239MKT6      ---------------------------------YTRDRVLAIFHKGLQVEVL--------
A0A3E0PCN7      ---------------------------------EKLAPFVNSIRGNLSVNPV--------
A0A2V8IYW3      ---------------------------------VPMEDVVARMRTEVDVDPP--------
G2LEI9          DEL------------------------------QRYAPQIGRLASGLQAYNV--------
A0A317J121      ---------------------------------ALMTSGLNVALATFDARPI--------
A0A2V7YW66      ---------------------------------AVLGSLAEQVRGGLSVAPV--------
A0A2V7Z0V0      ---------------------------------AVLGALADQLRGGLAVDPV--------
A0A2V8GFD4      ---------------------------------PLERRRVDAFLGALSIVPV--------
A0A2V8HSS5      ---------------------------------PLERRRVDAFLGALSIVPV--------
A0A2V8KP55      EKTEQASDDEG----------------------DQLRSLIDQYLDRITVKPL--------
A0A399WNU1      A--------------------------------EQLAPYVGFIKRNLEVSPV--------
A0A2V9CG11      ---------------------------------VPEDELVHQAERNLTVRAA--------
A0A2V2R0I6      ---------------------------------QKRPPELGEFLGSLSVKRV--------
A0A2V8XAR9      ---------------------------------QKRPPELGEFLGSLSVKRV--------
A0A2V8VZA0      ---------------------------------QKRPPELAEFLGSLSVKRV--------
A0A1Q7CB82      ---------------------------------QKRPPELAEFLGSLSVKRV--------
A0A2V8WIU1      ---------------------------------QKRPPELAEFLGSLSVKRV--------
A0A1Q6Y9F5      ---------------------------------QKRPPELAEFLGSLSVKRV--------
A0A2V9EVV8      ---------------------------------QKRPPELAEFLGSLSVKRV--------
A0A2V8YF91      ---------------------------------QIRPQELGQFLGSLSVKRV--------
A0A2V8XZK2      ---------------------------------RTRPPELAEFLGSLSVRRV--------
A0A2V8ZTX6      ---------------------------------QTRPPELAEFLGNLSVKRV--------
A0A2V9BT79      ---------------------------------QTRPPELAAFLGNLSVRRV--------
A0A1Q8B793      ---------------------------------QNRPPELAAFLGSLTVKRV--------
A0A2V9BCA0      ---------------------------------QNRPPELAAFLGSLTVKRV--------
A0A2V9BWU9      ---------------------------------QARPPALGGFLGSLRVKRV--------
A0A2V9DKX2      ---------------------------------QARPPALGGFLGSLRVKRV--------
A0A2V9JSI3      ---------------------------------IVQISLINAFRDHLRVEWV--------
A0A2V9WI32      ----------------------------------AESSLLDRFRRGLKLNVV--------
A0A2V8IVN9      ---------------------------------SSQSRAVDAFLKRLTVSPV--------
A0A1F2TPT3      ---------------------------------PAEAPQISAFLGGLSLAPT--------
A0A2V8JTQ2      ---------------------------------ANQDALLQSFHKGLEISKV--------
A0A2V8UZY0      ---------------------------------DNEDRLVKSFHKSLRISKV--------
A0A3N5YNR8      ---------------------------------DKNRDVLDTFRDRLEVAQV--------
A0A350UEK1      ---------------------------------GAKARAVEMAADTLKVRAS--------
A0A350UIQ4      ---------------------------------DARQHAIAMAADSLKVRAS--------
A0A3N6A5T6      ---------DE----------------------ADLSADVDRFLGSLQVQPI--------
A0A1F2Q9L4      ---------------------------------ATLAGLAYGVLGGLEVNPI--------
A0A1H5SQF5      ---------------------------------TYRDSAVNLFQSRLKITLV--------
A0A2Z5G448      ---------------------------------AQRIPLIRLLRSNLQVVVI--------
A0A3E0NV31      NGFRPRRRGEA----------------------LSEAGALRRLQENLSIAPV--------
A0A3N5M5V0      ---------------------------------AENRAVIEKVLSRLEVTQV--------
A0A2V9AEW6      ---------------------------------SEREQMIRQVERNLTVQSS--------
A0A2V8WQK6      ---------------------------------PEREELIRQIKRNLTVRTS--------
A0A2V8XIF4      ---------------------------------PEKEELIRQIQRNLTVRES--------
A0A3N5XQP8      LIDEGGPGGQN----------------------DPTEYMIDRLLSDLQINPV--------
A0A2Z5G7H4      ---------------------------------RRRTRALKIFDANLNVKVV--------
A0A2V9KCS3      ---------------------------------PSREQAAGMAAASVSVRSV--------
A0A2U3KC61      ------------------------------------AGLLGAFRGGLSVQII--------
A0A2V9Y2R7      ---------------------------------EETTALLAAFHSGLSVRVI--------
A0A372IT17      ---------------------------------NRRYVALRIFARHLTVQPV--------
A0A136JPP4      -AAVQLSPEEA----------------------ARAGQYAGILSGGLHVEQT--------
A0A399WUJ8      -TAAQLSPEES----------------------ARANQYAAALSGGLRVDQT--------
A0A2V9L5B5      ---------------------------------DAYRNSVTHFLASVDVNPV--------
A0A2V9L7I0      ---------------------------------DAYVNAIAHFRKSVDVSPV--------
A0A2V9LK56      ---------------------------------EAFNNSIANFMNSMSVGPV--------
A0A2V9YHT3      ---------------------------------PQESALIGRLRGSLQVSSI--------
A0A2V9NGH6      ---------DS----------------------VKASAVLASFKSDLKVLLK--------
A0A2V9PYE6      ---------DS----------------------VRTSEILAHFKSDLKVSLK--------
A0A2V9NL07      ---------DS----------------------ARANALLGAFKGGLHVVLE--------
A0A2V9QD92      ---------DS----------------------ARANALLGAFKGGLHVVLE--------
A0A2V9WPZ6      ---------DS----------------------TRTSALLSAVKGSLRVSLV--------
A0A2V9ZLH4      ---------NS----------------------SRVTNLLGAFKGNLKVTLQ--------
A0A2V9RQF1      ---------DS----------------------EQTTALLSAFKGNLRVALQ--------
A0A2V9YDK8      ---------DS----------------------ARTSALLAGFKGNLRVSLL--------
A0A2V9V8F7      ---------DS----------------------TRTSALLSAVKGSLRVSLV--------
A0A2V9XGR9      ---------DS----------------------TRTSALLSAVKGSLRVSLV--------
A0A2V9V3Q5      ---------DS----------------------KRTTALLGGFKGNLKVSLI--------
A0A2V9NWS3      ---------DS----------------------QRTTDLLSAFKGKLRVALE--------
A0A2V9USA9      ---------DS----------------------AHLSSVIGGFKGSLRVALS--------
A0A2V9XW18      ---------DP----------------------GRASSMIGGFKGNLRVTLS--------
A0A3M2BZG9      ---------DA----------------------AELARQAMRLQSGLVVNPI--------
A0A1Q7N5R7      DVGAAIGRTDSLGFRWTPAAADLAPGAEIVFGVTTLRDASRGLSDGLRVSPD--------
A0A3M1SIV3      NLEAKLSPEEK----------------------EAVEKVTASLLPGVDVVQE--------
A0A3E0PHB0      VDQINLTPEQS----------------------QRADKYTAALVNSLVVEKV--------
A0A3M2D491      SEEIKLSPEER----------------------LRVERITASLAGSVDAIQE--------
A0A357F267      SSALELTPEEE----------------------KRVQIYAAMLRGGLSVEQR--------
A0A353C9L6      RPRTILSPDEE----------------------KRADQYAGILFSGLTVDQV--------
A0A2V8RQV0      GELAKLSPEEE----------------------ALANQHVGNLIGRLQIVPQ--------
A0A2V8SJH5      SDNIQLTPEER----------------------ARVENYAAMLAGRVTVQPK--------
A0A2V9QB26      ---------ES----------------------GAAQAAARSLNARVS------------
A0A2V9VYY4      ---------DP----------------------VQAAGLLGAFRGGLSVQPV--------
A0A2V9KIE8      ---------NS----------------------EAFTNAVKHFLDAVEISPV--------
A0A352F549      AGFNADDPAEV----------------------ERLTPYAESLQGLVDVEQV--------
A0A3B9MLP9      SGLSLEDPAEV----------------------ERLAPYVDSLQGMLDVAQL--------
A0A3D5SQ87      SGLSLEDPAEV----------------------ERLAPYVDSLQGMLDVAQL--------
A0A2V8NW86      ---------ES----------------------GAVQAAAESLKARAS------------
A0A2V8ZHL8      ----------Q----------------------NSEDKLLRLFKSRLHVQRV--------
A0A2V9B240      ----------Q----------------------VWEDRLLGPFKRRLHVQRV--------
A0A2V9CBM2      ---------DR----------------------ELYQRVLERFRDHLTIAPI--------
A0A2V8XN17      ---------DR----------------------ELSQRVLERFQDRLTIDPV--------
A0A2V8WX45      ---------DR----------------------ELSQRVLERFQDQLTVDPV--------
A0A1Q6YR79      ---------DR----------------------ELSQRVLERFQDRLTIDPV--------
A0A1Q7VA32      ---------DR----------------------ELSQRVLERFQDRLTIDPV--------
A0A2V9EY85      ---------DR----------------------ELSQRVLERFQDRLTIDPV--------
A0A2V9H8K0      ---------DR----------------------ELSQRVLERFLDRLTIDPV--------
A0A2V9FFE5      ---------DR----------------------ELSERVLERFLDRLTIDPV--------
A0A2V9GM43      ---------DR----------------------ELSERVLERFLDRLTIDPV--------
A0A1F2RFI7      ---------DP----------------------K-YYNVLDNFQDRLTVNPV--------
A0A1F2RZS3      ---------DP----------------------K-YSAVIDNFLGRLQIVPI--------
A0A1F2USE2      ---------DP----------------------AAYQGVLRRFQDRLAVAPV--------
A0A2V9C238      ---------DP----------------------WAYQTALKRFRDRLSVDPI--------
A0A1F2Q9F5      ---------DP----------------------VAYQNALETFSRRLAVAPI--------
A0A1F2QQH9      ---------DP----------------------VAYQNALETFSRRLAVAPI--------
A0A1F2QXK7      ---------DP----------------------VAYQNALETFSRRLAVAPI--------
A0A2V9DEM9      ---------DP----------------------RAYQTALKRFRDRLSVDPI--------
A0A2V9CYQ5      ---------DR----------------------ELYQHVLERFRNHLTIAPI--------
A0A2V9BWU8      ---------DS----------------------AVYQRVLERFQDRLSIEPV--------
A0A2V8ZG48      ---------DP----------------------EVYQRVLERFQGRLTVDPV--------
A0A2V8Y334      ---------DP----------------------EVYQRVLERFQDRLTVDPV--------
A0A2V9AY68      ---------DP----------------------EVYQRALGRFQDRLTVEPV--------
A0A257VBK0      ---------------------------------------AAMLRGMTKVDNI--------
A0A2V7XDY0      ---------------------------------AEHRDAGGEFMSHVNVEPI--------
A0A350UQT3      ---------------------------------QARAQDAPIVLRNLKVARP--------
A0A2U3JZ71      ---------------------------------VPGAEDAPVLLKNLKVSRP--------
A0A2V8TTB0      ---------------------------------WQGSDEAPVILKYLKITRP--------
A0A1F2TCR2      ---------------------------------AAEAGIISQFIGSINIIPE--------
A0A2N9LQU7      ---------------------------------LSREKLLLKFHDAEKLEVL--------
A0A2P6WFK7      ---------------------------------ADRQRLVSAFKQSLSVRVL--------
A0A1F2V330      ---------------------------------KISDTDLDRMRESIKIT-V--------
A0A2V8U914      ---------------------------------NAAQYAADVARKHLKIEPA--------
A0A2V7W309      ---------------------------------QITQAMAGGLLGGVNIAPK--------
A0A2V8TLH7      ---------------------------------------VGVFSSMVQVELI--------
A0A1Q7ZJT1      ---------------------------------------IGEFSQMIVVAPV--------
A0A2V8VC99      ---------------------------------------IGTFSSAIEVEPI--------
A0A348UZU3      ---------------------------------VFRQKLVDKFLGRLEVKPI--------
Q01XL7          ---------------------------------EQMKEAVRTAAFTVSARGV--------
A0A2V8ERZ5      ---------------------------------ADESGLVSAFIGRVSVDPV--------
A0A2V8GTX0      ---------------------------------VNENQQADAFLGRVQVVPV--------
A0A2V8J0X9      ---------------------------------AHEAGLISAFLGGLSIRPE--------
A0A372IRG7      ---------------------------------LQRYQLIRAFQSSEKVIVE--------
A0A1F2U158      ---------------------------------ADESALVSRFLGRVQVVPV--------
A0A2V8F6S9      ---------------------------------PDESGLVSGFISRVTVAPI--------
A0A1I6MH75      ---------------------------------AVQAGTIRRLNGHLKVSLI--------
E8WVF6          ---------------------------------RVRQTIVGILQKNLKVTLV--------
A0A1H5Z7N3      ---------------------------------VVRQMVLYTLRADVNVSVI--------
A0A1G7JVV8      ---------------------------------IVRAAVIGKLSNAFKVASI--------
A0A1H4T6W9      ---------------------------------VVRTEVLRRLGGAVVATVI--------
I3ZEU5          ---------------------------------AVRTDVLQRLGNSVNASII--------
A0A428MDU2      ---------------------------------GVRQSTVHRLQSNLHITLV--------
A0A239HDF6      ---------------------------------QVRQGTLLVLSSNLKIAMQ--------
A0A1Q3QQB6      ---------------------------------AVRQATVHALQSGLRIVLV--------
A0A3N1K1G7      ---------------------------------AVRQSTVHRLQSNLHITLV--------
A0A2W0BGU4      ---------------------------------AHKMKLIETFKRQLSVELV--------
A0A2W0BVQ9      ---------------------------------AHKMKLIETFKRQLSVELV--------
A0A3D1ASD2      ---------------------------------SAAAEDAPVRLKRLEVIRP--------
A0A2N9MK30      ---------------------------------QGLLIDAPVLLKQLKVTRP--------
A0A2V9MN96      ---------------------------------QQIASMLSIFRSGLTVQVM--------
E8UZE1          ---------------------------------QERYSLIRRFQSGLGVQLE--------
A0A2V7V2Z1      ---------------------------------AVMERAIDEFLGKLKVVPI--------
A0A2V7X2F7      ---------------------------------PVMEGAIDGVLGRLRINAG--------
A0A2V7V2I1      ---------------------------------RVMEAAIDQFLSRVKVQPV--------
A0A2V7U3M2      ---------------------------------PVMERAIDSFLRKLRVLPV--------
A0A2V7UHT0      ---------------------------------QLMEGAIDAFLRRLRVLPV--------
A0A2Z5FVL3      ---------------------------------LRRDRLLKQFQENLEVKII--------
A0A1V6HR88      ---------------------------------SALARLAGRLLGGLEVKPV--------
A0A3E0P0A3      ---------------------------------VVVARLASRVRSGLSVQQV--------
A0A2V9KBD6      ---------------------------------VNEDRLVKLFHKSLDISKV--------
A0A2W0AJ66      ---------------------------------GNEDSLVRAFHKNLAISNV--------
A0A1Q7RBU1      ---------------------------------VNEDRLVESFHKNLTISKV--------
A0A2V9JPV9      ---------------------------------GNEDRLVKSFHKNLTISKV--------
A0A2V8EXP2      ---------------------------------SAQARAIDRLLGGLTVTPI--------
A0A2W4RYA1      ---------------------------------PEQTAVIDAFLRRVSVSPV--------
G8P0Y7          ---------------------------------FRLESLIRKLQGNLTIQQI--------
A0A3D4VGU2      ---------------------------------SQKLALLNTFKGATQVVLV--------
C1F294          ---------------------------------SQKLALLNTFKGATQVVLV--------
A0A3P0X3W6      ---------------------------------KEFLPAGSVTLPGLTITHP--------
A0A1E3Y9R6      ---------------------------------PQEAALTSRVQAGVSVVPV--------
A0A2W4TLP2      ---------------------------------AARAALTSRIQGGIVVVPI--------
A0A3R9WF43      ---------------------------------RTRERMVKLFRKNLKVDSP--------
A0A317HKM4      ---------------------------------LSQVPTVAEIAAARSIGGV--------
A0A2W0C122      ---------------------------------APESIAVQALLSGLSVKTI--------
A0A2W0AUU7      ---------------------------------DPTDIAGEAVVSGLSVKTI--------
A0A2W0BQL1      ---------------------------------DPTDIAGEAVVSGLSVKTI--------
A0A3P0XH15      ---------------------------------NQRIEMLSIFKGSTKIATK--------
A0A3M1WQW8      ---------------------------------LRDKLMVDRFLSGLRVELI--------
A0A3N1JHC1      ---------------------------------AGREGVVRNMVMDAKAKEE--------
A0A2V9KA79      ---------------------------------------IDEMRARIQIT-V--------
G8P085          ---------------------------------PAQEEMLSHFKSQINVLQV--------
Q1ILD9          ---------------------------------ARRQQLLARFQLGLDVTEV--------
Q1IJZ6          ---------------------------------RQREAMLKKFGKALTVTPI--------
A0A2V8TCE6      ---------------------------------EPMGPFIDLVLAGLSIEPV--------
Q1ITG0          ---------------------------------ARKSKLLTRFSKALRVEAV--------
A0A3N5PCI5      ---------------------------------VAESIAIDRLLANLRILPV--------
A0A3M1Q0S9      ---------------------------------DPYAPYVKTLRGGLSVEPI--------
A0A3M1VZ38      ---------------------------------DPLRPYIKQLRAGLSVDPV--------
A0A3M1PY35      ---------------------------------------VEMLGAGLDVAPL--------
A0A3M1VMP2      ---------------------------------------AAYIRDNLDTEQL--------
                                                                            

A0A2V7YYV7      PN-------TTILDIAVDDTNPALARNIANDLVDKL------------------------
A0A2V7Z0J5      TT-------ALVLHINVQDTNRARSRDVANTLVSEF------------------------
A0A2V7Z3M4      TL-------ALVLHINVQDTNRARARDVANTLVAEF------------------------
A0A3M2D9H8      RG-------AQLIQIVVEDSDPQKAAEIANTLVTVF----LEQNAKIQSNRFSASEESLQ
A0A399Y5V2      ---------TSIIRVRARDASASLARDIANGVSATY----IDLRRKSALDSFAQQANDLQ
Q01X01          RG-------TSIIRIVAEAREPQLAADLANTLAQTFIEQSIEARQRSAQQTFASLSGDLK
A0A2V7VMF7      PE-------SRLVTVAVTHQDAKEAALWANTLAEVYVEQTLASRVEAAKKAYDWLQERLG
A0A2V8JK38      RQ-------SWLVEVTFQAKDPKLAAQVINAHGRHFVEQNIENRFQTTQQVSELLSQQIV
A0A2V9IXG5      ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEENDRQQGEAVKQSRDVLKRQLY
A0A2V9J2P4      ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEENDRQQGEAVKQSRDVLKRQLY
A0A192WQ77      RE-------TGLIEVSIEGKDPEQITAWVNEVARAYVERNLEVAQESVSFAVDQLTGQVK
A0A1Q7RLS4      KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNLDQVVEATSKAVKALLSEIA
A0A2V2R525      GK-------TRLVEIRYTHRDPHVAAKVVNAIADTFVQANLEKMTETNSGAGAFLKKRIY
A0A321LPW6      RD-------TRVIKVVFTHTDPKLAAEVVNAVTQSFIARSFSTKAEKYNNAASWLDRSTR
A0A2V9R9V4      LD-------TRAMTLTFKHTDPVIAAGVANAIAQRFVETSFDKKIEKFTSASEWLDRSTR
A0A321LE75      ED-------TRLLVINYSHTDPKLAATISNTVAAAFINRSFSNKTEKFTKTSDWLNTMVR
A0A2V8R8U7      IG-------TSLVTIRYQHTDPALAQRIANTLADVFVQNNRERLDIGTSKAVESLAQEIA
A0A2V8QMP4      EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDIQEETTGSQKAEDVLANEII
A0A2V8R4S3      EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDIQEETTGSQKAEDVLANEII
A0A2V8NJ55      EK-------TNLVTIRFRHSNPVIAMKVADTFAQVFIYNDLQRTTSGTQTATEKLANQIA
A0A2V8Q7I0      VH-------TNLFTIKYKHHDPEMAQKIANTLAEVFASNNIDSQTVNSKDAGDLLEREIS
A0A2V8S6K4      ER-------TSLVDIHFKHTDPELARQVADTLAAVFIENDRARESKGTEDMKVATARQIT
A0A317I2L9      VN-------TNLFVIKYKHHDPDIAQKVANTLAEVFANNNLERSTTNSSKQETMLAKEIG
A0A2V8LLF9      EK-------TSLVTIHFQHTDPELAQKIANTLADVFVQNNLDRITAGTSKAEIDLTNQIA
A0A352FRF4      PQ-------TNLVIIRYRHTDPALAQKIADTLAEVFVANNLNLQESGTSKQSQDLGQEIA
A0A2V8MKV0      EK-------TNLVSIRYHHSDPALAQKVANTLVDVFANNNKESLESGTRKSAAQLGSQIG
A0A2V8PYY8      EK-------TNLVTITYHHNDPALAQKVANTLVDVFANNNLERLESGTKKSAEQLANQIA
A0A1Q7YKQ8      MT-------TNLVMLKFTHSDPVLAQKIVNTFADTFAYNNFERETQGTAKATELLAQKIA
A0A352F3R7      TN-------TNLVKIRFVHSDPELAQKIANTLAEVFVNNNLQRATAGSSKAEDVLAKEIA
A0A0B6WXT1      EK-------TNLVNIKFQHSDPEMAAKVANTIADVFIYNNLERETQGAQRASVLLAKQIA
A0A3B9MEU8      PT-------TNLVKIKFMHSDPELAQKIANTLAEVFRNNNLERSTAGSSKAEDQLAKEIA
A0A2V8MHG6      SD-------TRIIEIRFKHQDPEIAEKINNTIADTFVVSNLERKTETTNSAGDFLQRRIA
A0A2V8P7N1      SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNLERKTETTNSAGDFLQRRID
A0A2V8M3M6      SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNLERKTETTNSAGDFLQRRID
A0A1Q7NJH5      SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNLERKNETTNNAGDFLQRRIA
A0A2V8PJY0      SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNLERKNETTNNAGDFLQRRIA
A0A1Q7Y6W9      KE-------TRLIDISFTHQDPQVAAKIINALADTFVLSNQEKRNESNNTTGGYLQRRIA
A0A2V8NC68      NE-------TRIIELRYRHLDPEVATKIVNTIADTFIQSNLEKKTETSSSAGDFLQKRIA
A0A399WK13      KD-------TRLIEISYSDTDPDLAAFVANAIAETFTNQNQEKRTGTSRKTNDFLQERIA
A0A352FLX4      RE-------TRLIDISYRHSDPHLAAKIVNTVAQIFIDQNREKKTETSGSTGTYLLKRIA
A0A2V8RTL7      KD-------TRLIEISYRNTNPELAAFVVNAIGETFVNANQEKRSGTSRKTSDFLQKRIN
A0A3E0PCJ6      KD-------TRLISISYRNQDPNVAAFVVNGIAEVFTRVNDEKRTGVNSKTNEFLKKRIG
A0A3M1S4R8      KD-------TRLIEISFQHTNPELAALIVNGIAEVFVKQNQEKRTGTNKRTNDFLAERIA
A0A1Q7YFI6      TD-------TRLIEIHYTHPDPQVAAKIVNSIADTYIISNLEQKTKNTNSAADFLQRRIA
A0A136KC10      KD-------TRLIEISFNSTDPALAAFVANAIAETFVNQNQEKRTGTSRKTNDFLQERIA
A0A2V8SEX6      KD-------TRLIEISFRHTNPQLAAFVVNSIGETFVTANQNKRSGTNRKTSDFLQRRIT
A0A3M2D6Y5      KD-------TRLIEVRFQHTNPELAALVVNGIAEIFAKQNQEKRTGTSKRTNDFLSERIA
A0A0B6WWQ6      KE-------TRLIDISFRHPDPYVAATVVNTIAETYKLSNLEKRTSARATTSQFLQRRIA
A0A3B9MK99      KE-------TRLIDLSYTHIDPEVASKVVNAIAETYVYNNLEKKSDTNMGTADFLQKRIA
A0A352EX26      KE-------TRLIDIGYTHTDPEVASKVCNAIADTYVFNNLEKKTESNASTGDVLQKRIA
A0A2V8MM59      KE-------TRLIDITYQHGDPEVAARVANCVAETFVHSNLEKTNQTNTSTSEFLSKRVA
A0A2V8PFE8      KE-------TRLIDIVFQHGDPEVSAKITNAVADTFVRANLEKKNETNTSTGEFLSKRVA
A0A2V8PWS6      KE-------TRLIDIAFQHGDPEIAARITNAVAETFVRANLEKKNETNTSTGEFLSKRVA
A0A2V8LCT5      KE-------TRLIDIDYQHGDPEIAAKVVNCVAETFVRSNLEKKNETNTSTSEFLSKRVT
A0A352FTJ9      KE-------TRLIDIDYQHGDPEVAARVVNAVAQTFVRSNLEKKNETNTTTSEFLSKRVE
A0A2V8G155      RN-------SRLVDIKYRLGDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLEERLA
A0A2V8HDM7      RN-------SRLVDIKYRLDDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLEERLA
A0A2V8DRT9      RN-------SRLVEIEFASPYPYVAANVANSLSKAYIELNLEYKFTASRDASDWLGERMG
A0A2V7VYF3      KN-------SRLVDVVYRSPDPVFATTIVNELAHQYIQQNVELRFHASKDASDWLGQQLA
A0A1F2SVH2      RN-------SRLVDVRFDSPDAAFSATVANALARAYIEQHLEFKFLSSKEASDWLGERLA
A0A2V8AJG9      RN-------SRLVDVKFESPSAALSAQVANGLAKAYIEQNLEFKFMSSKEASDWLGERLS
A0A2G6PYV5      KD-------TNLVRISYTDTNPERAMILANTWVKAYIAHSLNMTYDKNLEAYNFLEEKSN
A0A2V8F956      RN-------SRLVDLKFDLPDGALAATIVNALAKNYISQSLEFKFMASKDASDWLGQQLL
A0A1F2S1W5      RY-------SRLVDVSFRSNDPALAARVSNALADQYIKQSVELRSNTTKEASEFLVQQLA
A0A1F2T595      RY-------SRLVDVSFRSADPGLAAKVANEHSKQYIEQSLEFRTTTTREASDFLTQQLA
A0A2V8JQV5      QQ-------AHIIQITADSTDPKIAAEFLNTLTDEFINQKLRSRLQTNERTAEWLQLQLQ
A0A2V9AC41      GG-------TSLVKVRFTTPDPALSARLANAHANSYVRYGVDLRSQTNEEASEFLKQRLT
A0A2V8K4L4      GT-------TRIIEITSDSTDPQLAADFANTLVDEFIQKNLDDRWKTTERTGEWLTKQLD
A0A2V8NCZ3      NT-------TRIIEITADSADPRLAADFANTLVDEFIEKNLDDRWKTTERTGEWLTKQMD
A0A2V9MAM9      KQ-------GRIIRILCDATDPQLAADFANALAQVFIEQSVEARWNGASQIREWLNPQLE
A0A2V9M454      KD-------TRMALVSFESTDPREAAAVVNGLVTNYIEHNFKSKYDATRQATGWMEQRLD
A0A2V9IVR7      RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLD
A0A2V9ILE2      RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLD
A0A2V9LGY4      RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWMEQQLD
A0A2V9J4D6      RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWMEQQLD
A0A2V9L9C5      RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWMEQQLD
A0A2N9M9N1      TE-------SRLVEVSFESVDSNLAARVANTLVKNYVEANFRSKYETTRQASAWMEQQLD
A0A2V9JEC4      GN-------SRLITVSFESTDPELAANAANTLATNFVEANFQGAYDTTREATKWMEQQLD
A0A2V9LPQ3      PN-------SHMMEVSFESTDPDLSAKVANTLINHYIEYNFRKRYDATRQASGFMEQQLE
A0A348V070      TG-------TKLIQVSFNHRNPELAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQIS
A0A2Z5G3A3      VG-------TRLIQISYVSSDRKLAESVVNALAQDLTNFSFETRYKATAQTSQWLTSQMA
A0A2V7UGP8      KN-------THLVEISFVSVDPELSSRIANAVANSYMEFNQSARYDTSAQASEFIGTQTT
A0A239MKT6      KS-------TRLLAVSYTDTDRNRASKIANYVVQAYLQDNTENRYQATSMASTWLTTQLE
A0A3E0PCN7      RDNRTAAQETRLIEVQFTHFRPEVAAKIVNTLGETYVRQNLEQKVQTNASAGEFIQKRVA
A0A2V8IYW3      VK-------DDTFKISYVSGDPVVAMKVVARLASMFIDGNVRDRRVVAEGTNQFLESQLE
G2LEI9          PR-------TRLVRITFQHHDPETTKAVVNTVAEVFARRNVSDRLQQGSSQKEFLSSTAA
A0A317J121      NG-------TRIIEITCDSTSPDIAANFVNTLANEYIEQNSQGRAQNLQQTSQWLSGQLE
A0A2V7YW66      RS-------TQLVQLAYTAASPEFAAKAANAFSEAFIDMGVEDRYATAGKASTFLGTQIE
A0A2V7Z0V0      RN-------TQLVQLSFRASSPEFAAKAANAFAESYIDMGVEDRFATAGKASTFLSSQIE
A0A2V8GFD4      RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNLEYRFTASKEASDWLAARMA
A0A2V8HSS5      RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNLEYRFTASKEASDWLAARMA
A0A2V8KP55      RQ-------SWLVEVTFQAKDPKLAAQVINVHGRQFVEQNIENRFQTTQQVSELLSQQIV
A0A399WNU1      KDSRTATKETRLIRIEYRHYDPVIATKLVNAIADTYVLQNLEQKVQSNASASDFLQKRVA
A0A2V9CG11      GN-------TRVLEVLYESPDPKLAADFANTLASEFIEETQGMRLKAFQRTAEHLTVKLD
A0A2V2R0I6      PN-------SRLMDVSFESTDPQLGARIVNAHINNFIEQNFRSRFEATSQASSWLTDQLS
A0A2V8XAR9      PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLS
A0A2V8VZA0      PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLG
A0A1Q7CB82      PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLG
A0A2V8WIU1      PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLADQLG
A0A1Q6Y9F5      PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLG
A0A2V9EVV8      PN-------SRLMDVSFESTDPRLAARIVNAHIASYIEQNFRSKYEATTQASTWLADQLG
A0A2V8YF91      PN-------SRLMDVSFESTDPRLAARIANAHIATYVEQNYRSKYESTTQASNWLADQLS
A0A2V8XZK2      PN-------SRLMDVSFESTNPQLAARIVNAHIATYVEQNFRSKYESTTHASDWLADQLN
A0A2V8ZTX6      PN-------SRLMDVSFESTDPRLAARTVNAHIATYVEQNYRSKYEATSQASDWLADQLR
A0A2V9BT79      PN-------SRLMDVSFESTDPRLAARTVNAHIATYIEQNYRSKYEATSQASDWLADQLR
A0A1Q8B793      PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLAGQLN
A0A2V9BCA0      PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLADQLN
A0A2V9BWU9      PN-------SRLLDVTFEAGDPKLAARVVNVHLENYIEQNFRSKYLATTTASNWLKDQLN
A0A2V9DKX2      LN-------SRLLDVTFEAGDAKLAARVVNAHLENYIEQNFRSKYLATTTASNWLKDQLR
A0A2V9JSI3      RN-------SRMLEVSFEARDPRLAAAVANALVSNYAEYNFRKRYDATRQASGWMEQQLD
A0A2V9WI32      PR-------TRIVEIHYSHPDARLAAQIANILINTFIEQNFKTKFESTMQTSAWLSVQLS
A0A2V8IVN9      RN-------SRIVDVKFEAKDPDVAERVVNALAKGYIDQNLEFKFMSTKEASDWLGERLG
A0A1F2TPT3      AN-------G-VLDIKYRSSDPVLAARFANAHAQEYINENLEMRVAAVREVTGWLTARLA
A0A2V8JTQ2      KG-------TRLIEIQFRSTDPQLAADVVNGLAKEYVDQYYRSQFQVSTQFSDFLANQLK
A0A2V8UZY0      KG-------TRLIEIKFRSTDPRLSADVVNSLAKEYVDHYYRSQFQVNAQISSFLANQLK
A0A3N5YNR8      PN-------SRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNLQTKFEANTRATEFLKKQLQ
A0A350UEK1      GQ-------TRIVEVLVDSTDPAVAASFANRLTAEYVEQSMEARWQSSQRTGEWLTRQMD
A0A350UIQ4      GQ-------TRIVEVLVDSTDPAIAAQFANLLTSEYVDQSMEARWQSSQRTGEWLTKQLD
A0A3N6A5T6      RG-------SRLVEVSYASHDARLAATIVNTLADQFIEMNFESRYQATTKATEFLQKQMH
A0A1F2Q9L4      RN-------TRLVEVSYVATTPELAARIANGVADTYIDWGVETRFATVGKASTFLTSQIE
A0A1H5SQF5      KG-------TRLVNVTYTDADPKQAARVANAVVEAYLISSTQQRYDATSKTSAWLTNQLS
A0A2Z5G448      PN-------TDLVEIHYRDPDPNQASRIAQAVVDQYLELDLRSRYEGTLRISNWLSGQLT
A0A3E0NV31      GN-------TQLVRVSYSSPDPDLSTDVAGAIALTFIETTLQTRYDATRRAVKFLEDQLA
A0A3N5M5V0      PN-------SRLVEVGWVSPDPSLASAVSDTLAEEFIEQNLQTKFEANTRATAFLKKQLQ
A0A2V9AEW6      GS-------SRLLEVLYESPDPKQAADFANTLVSEFTELSQEAHWKSAQGTAEWLTNHLD
A0A2V8WQK6      GN-------SRLLEVLYESPDPQRAADFANTLVSQYVELSQEERWRSAQGTAEWLTSHLG
A0A2V8XIF4      GN-------SRLLEILYESPDPKLAADFTNTLVSEFVELSQEERWKSAQGTAEFLTNHLD
A0A3N5XQP8      LE-------SRLMDVSFSSPSPKFAAMVANAWVEEYIEQNFQSKLKTTEMATKFLAEELK
A0A2Z5G7H4      SG-------TRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNFQTRFTATNQASEWLTGQLS
A0A2V9KCS3      NE-------TRIVEILCDSTDPKFAADFANTLVSEYMEQSLESRWKNAQRTGDWLTRQLE
A0A2U3KC61      PN-------SRLVQISYTHPNPRLAEAIVNKLVDTFKEENTNAKYESVNETSEWLKAKLD
A0A2V9Y2R7      PR-------TRLLELRYIHQDPVLARDIVNKLAKTYIEENFRKRYESTTQTSEWLSGQLA
A0A372IT17      TG-------TRLIEIRYSDPDPALAARVVNRLVQALADYTFQSRLAQTSESSSWLAGQMS
A0A136JPP4      ER-------TSLFTLTINSTNPQIAANVANKVGEVFIEEDAKRELETTQSAYDELTKSIA
A0A399WUJ8      ER-------TSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDAKRELEGTQSAYDELTKSIA
A0A2V9L5B5      RR-------SNLVEVTFDSYSRTVAALAANKLADDYVEQNLEVKWDAAEKASQWLQGKNA
A0A2V9L7I0      RR-------SNLVELTFDSYSPEVAAQAANKLARDYIEQNLEVKWDAAAEASKWLEGKIV
A0A2V9LK56      RR-------SNLVEISFYSNDPKLAARIANRLADDYIEQNLQVKWDAALKASEWLSGRLD
A0A2V9YHT3      PN-------TRMIELRFSDPAPRETARVLNVFMDDYIQENIRAKYDSTMQATDWLTRQLS
A0A2V9NGH6      PN-------TRIIEIRYRSTDKDSAARVVNTLINTYIEQNFKTKFESTMQASDWLSKQLI
A0A2V9PYE6      TN-------TRIIEIRYRSTDKGLAARVVNALINTYIEQNFKTKFESTMQASDWLSKQLI
A0A2V9NL07      PN-------TRIIDIHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASDWLSRQLV
A0A2V9QD92      PN-------TRIIDLHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASDWLSRQLV
A0A2V9WPZ6      PN-------SRIIELHYRSPNQELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLV
A0A2V9ZLH4      PN-------TRIIEIHYTSPNKELAATIVNTLVNTYIEQNFKTKFESTMQASDWLSKQLV
A0A2V9RQF1      PD-------SRVVDIHFRSPDRQLAAHVVNALTSTYIEQNFKTRFESTMQASDWLSKQLV
A0A2V9YDK8      PN-------SRIIELHYRSPDKNLAANIVNTLAATYVEQNFKTKFESTMQAADWLSKQLV
A0A2V9V8F7      PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLV
A0A2V9XGR9      PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLSKQLV
A0A2V9V3Q5      PN-------TRIIEIHYRSTDPTLAASVVNTLAATYVEQNFKTKFESTMQASDWLSKQLV
A0A2V9NWS3      PN-------TRIVDIHFRSPDRELAAHVVNTLISTYIEQNFKTRFESTMQTSDWLSKQLV
A0A2V9USA9      PN-------TRIIEVHYRSGDPQMAANVVNTLMQTYVENNFKSRFESTMQASDWLNKQLV
A0A2V9XW18      PN-------TRIIEVHYRSADPQMAANVVNTLMQTYVENNFKARFESTMQASDWLSKQLV
A0A3M2BZG9      RD-------TQLVELTYRSDKPELAARIANGYAQAFIDWGIETRTSTVSRASTLLTSQIE
A0A1Q7N5R7      LS-------GNFLRIALTGPSATGVTGVVNAVADRFVAVATDLKRAKLTELGRLLREQLQ
A0A3M1SIV3      ER-------TNLFSINVANSNPELAAILANTIAEVYIERTIRRETEGMQKSLEDITKSID
A0A3E0PHB0      EG-------TNLVKLTMNGSDPELIRRVADTLTEVYKDRSIMLATKTQVEAHKELQNSIE
A0A3M2D491      ER-------TNLFSVKVVHTNPELAARLANAIVGVYIDRAARREVEGTRKSLEDLTKSIE
A0A357F267      ER-------TNLVNVSIRSTNPDLAARVADKVAEVFRDQDAERETQGAKNASEDLGRSID
A0A353C9L6      ER-------TNLVNVRVKSTNQALAPKVADKIAEVFKLRDAERETQGAKNSAADLAKSIE
A0A2V8RQV0      ER-------TNLVNVTIQNEDPALAGKVTDEIAAIFIEEDKERETQGERKAIEDLTKSIE
A0A2V8SJH5      ER-------TNLVNVSVTTPKAELSARVADKVEEVFIDKDAQRETEGSRRTYEDISKSIE
A0A2V9QB26      GL-------TRVVEASYDSTDPRFAAAFLNTLVQEFMDSNMEARLKSSEYTSQWLSRQLE
A0A2V9VYY4      PS-------TRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSEWLGKELA
A0A2V9KIE8      RR-------SNLVEVSFGSHDPRVAAQVANRLAQDYIDSNLQVKWDETIKASDWLQGQLV
A0A352F549      KK-------TYLIDLRATHTDPVVATKVVNAMADAFALWNMEVKTKTNTVAGSYLQKRIA
A0A3B9MLP9      KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQKRIG
A0A3D5SQ87      KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQKRIG
A0A2V8NW86      GL-------TRVVEASYDSTDPRFAAAFLNTLVQELMESNMEARMKSSEYTSQWLSRQLE
A0A2V8ZHL8      RD-------SHVVNISFEGPDSSLSAKIANSLASNFIEYNFRQKYDATRQASGWMEQQLD
A0A2V9B240      RD-------SHVVNISFESPDPGLSAKIANSLANNYIEYNFRQKYDATRQASGWLEQQLD
A0A2V9CBM2      NR-------SRLVAVRFDSHNPDLAARVANNLAADYVEQGLDERWAAAQRASDWLSRQLL
A0A2V8XN17      NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLSQQLV
A0A2V8WX45      NR-------SRLVTVRFDSRDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLTQQLV
A0A1Q6YR79      NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLSQQLV
A0A1Q7VA32      NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLSQQLV
A0A2V9EY85      NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLSQQLV
A0A2V9H8K0      NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQNLEARWQATQKAAEWLSQQLV
A0A2V9FFE5      NR-------SRLVAIRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLSQQLV
A0A2V9GM43      NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLSQQLV
A0A1F2RFI7      RR-------SRLVEISFDSYDPALSARTANALAANFIDQNLEAKWDATQKASDWLSQQLV
A0A1F2RZS3      RR-------SQLVEITYESYEPSQSARVTNTIAANYIDMNLEAKWDATQKASEWLSQQLV
A0A1F2USE2      KY-------SRLVEVHFESEDPALAAQATNTLAANYIEQNLEARWEASQKASEWLSQQLT
A0A2V9C238      KR-------SRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLSQQLL
A0A1F2Q9F5      KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLL
A0A1F2QQH9      KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLL
A0A1F2QXK7      KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLSEQLL
A0A2V9DEM9      KR-------SRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLSQQLL
A0A2V9CYQ5      NR-------SRLVAVRFDSQNPDLAARVANALAADYVEQGLDERWAAAQRASDWLSRQLL
A0A2V9BWU8      SR-------SRLVTVRFDSGNAQLSARIANALAEDYIDQSLEARWLATQKATDWLSQQLV
A0A2V8ZG48      SR-------SRLVNVRFDSNDAQLSARIVNTLAEDYIDQNLDSRWKATQKATDWLSQQLV
A0A2V8Y334      SR-------SRLVTVRFDSNSAELSARIVNTLAEDYIDKNLEARWKATQKAADWLSQQLV
A0A2V9AY68      SR-------SRLVTVSFDSNNARLSASIVNTLAEDYIDENLEARWMATQKATDWLSQQLV
A0A257VBK0      RD-------SALFRITVMAPYKADVAIWANAIAEAYQDRMLKDALDFIAKANEVMLAEAK
A0A2V7XDY0      PE-------SRLVLIHVTHRYPKEAALWANTLADVYIEDTISTRVEAARKAYEWLQERLG
A0A350UQT3      PN-------TYLLQVSYRSPDPQLAADVANQVAQSYIEHTYNIRIRSSQSLSRFMERQIE
A0A2U3JZ71      PN-------TYLLLISYRSTDPRLAADVANGVARSYLEHTYNIRFKSSASLSAFMEKQLE
A0A2V8TTB0      PN-------TYLLLISYRSPNRQLAADVANAIALSYLAHTYRIRYKATAGLSEFMERQLE
A0A1F2TCR2      QT-------TRLVSIQYRSPDPRFAALAANTIAEEYATQNLDLHLDNVLGKLAWLDDELK
A0A2N9LQU7      PK-------TRVIEIRFQNVNPKLASDVVNGIVDAYLQRNFDVKYQGAVQVSEWLSKQME
A0A2P6WFK7      PN-------TQIVEVLFRCTDPKLATDVANAVVEKYMQHTLQTRYEGTVQVSNWLSKQMD
A0A1F2V330      EG-------SDSFHLAFEGRGRTQVMNVTNDLSERFIRRLANMREQQVNEGAGLLNAELE
A0A2V8U914      RD-------SQIIRVAFDAHDPQLAADFANTLARTFIEQSVNGRRRAAQEIQEWLGPRIQ
A0A2V7W309      HG-------TNLIVITYTGSSPKLAQKIAEAWGDSFMRMTIAKKLDSVRQATEFLSQQIA
A0A2V8TLH7      KD-------TGIMQITLDGPEPKEVQTWVNSVAEAYVDRNLDLSIEATGRAVKALLSEIA
A0A1Q7ZJT1      KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNLDQVVEATSRAVKALLSEIA
A0A2V8VC99      KD-------TGIVVIGLEGLNPEEVAAWANAIAEVYVDRNRDQAVEATAKAVRALLSEIA
A0A348UZU3      RM-------TRLVEVAFKAHDPALASDCVNALFDSFVDMNIEARYETTEQATEFLSEQIA
Q01XL7          GA-------TRLIELRCQSPSPEVAANFLNTLAAEHISQNLAIRSSATQRTSQWMDSQME
A0A2V8ERZ5      RG-------SHLVDVSFVSEDPKFAAEAVNALIEEYVNQNLELKLQSTQGMLDWLDKELD
A0A2V8GTX0      RG-------SRLVDVYFVSADPEFAARAVNVLAEEYVNENLDFRLQNTDKTLQWLTEEVA
A0A2V8J0X9      PN-------SRLVKIVYSHSDPKFAALAANTVADEYTQQNIDLRLQNTEKTLQWLGEELK
A0A372IRG7      TG-------TQIVEIHFQNPDPEVAAKVVNAIVQAYMERDLRSRFEGTTRVSNWLSQQLS
A0A1F2U158      AE-------SKLVDVYFTSADPQFAATAANALADEYVASNLEVKMQGTQSMLDWLEKEVA
A0A2V8F6S9      TG-------SKLVDVTFQSSEPKFAATAANALVDEYVDSNLEIKQAGTQNMIEWLDKELA
A0A1I6MH75      PK-------TEIIAISYTSLNAKLSADIANKVVSDYIQRSFETRFQSQQRVSAWLQNQLD
E8WVF6          PK-------TDIIRIAYSSLDPKLSADVVNKVIADYQQRSYETRFDSTKRVSQWLSGQLD
A0A1H5Z7N3      AK-------TDLIHISCQTFSADLSAEIVNKLIREYIFRSLESSAEAQKRVSDFLSTQLG
A0A1G7JVV8      PR-------TQMIRITVTANKAQLAADLVNHLINAYQQRSFESRFASTQRVSQWLQGQLD
A0A1H4T6W9      PR-------TAMVRITCTASKPQLAADIVNQVINAYQQRSFETRFESTKRISQWLSGQLD
I3ZEU5          PR-------TAMIKITCTASRPQLAADIVNQVINAYQQRSFETRFESTKRVSQWLSGQLD
A0A428MDU2      PK-------TDIIRISYTCLSAKLSADIVNTVIATYVHRSYQTRFDSTQRVSQWLSGQLD
A0A239HDF6      PR-------TNILRLSYSSLDGKLSAEIVNTVISEYIQRSYETRFASTQRVSKWLSKQLE
A0A1Q3QQB6      PK-------TEIINISYSSLNPKLAADIVNKVISAYIQRSYETRFASTQRVSRWLSSQLD
A0A3N1K1G7      PK-------TDIIRISYSSRSPKLSADVVNKVISTYIQRSFETRFASTQRVSQWLQGQLD
A0A2W0BGU4      PG-------SRVVLVGFESRDPELAARIANTQVENYSDYNFRQKYDATRQAAGKMEEQLD
A0A2W0BVQ9      PG-------SRVVLVGFESRDPELAARIANTQVENYSDRNFRQKYDATRQAAGKMEEQLD
A0A3D1ASD2      PN-------TYLLQITYQSANPRLAAEVANGVANSFLQHSFEIRFKSSESVSQFMTKELE
A0A2N9MK30      VN-------TYLLLISYRSPDRRLAADVANAIARSFVEHTYDIRFRSSASLSTFMEKQLE
A0A2V9MN96      PR-------TRVIEITYIHPDPQLAAEVTNALVKTFVEENFRTKYESTSQTADWLSKELS
E8UZE1          RG-------TEIVQIRYKSTNPALAATIANTVAAKYIQRNFETKYNTTHETSAWLQDQLE
A0A2V7V2Z1      KS-------SRLVMVSYESFRPEMAAAAANGLSKLYIEQTLEFRYQTSSEAAQWLGQQIE
A0A2V7X2F7      KG-------TRLVGVGSEAFRPDLAMNVANKLSQLYIEQTLEYRYQTSSEAGVWLGGQID
A0A2V7V2I1      RN-------SRLVLVGFEAYRPELAAQAANKLSQLYIQQTMEFRYQTSADAGLWLGSQIE
A0A2V7U3M2      KN-------SRLVLVAYESYVPEMAAAAANWLSQLYIKQTLEFRYETSSEAAQWLGQQIE
A0A2V7UHT0      RN-------SRLVTVTYESYRPDMAAAAANRLSQLYIQQTLEFRYQTSSEAAQWLGQQIE
A0A2Z5FVL3      PG-------TRVIEVAFSSSDPNLAARVVNQLVASLVNYSFQSRRTVDTEASKFLESQLA
A0A1V6HR88      GQ-------TQMVDISYRSTDPALAARIANGVAETYIDWGIESRSNLAGKTSVFLGAQIE
A0A3E0P0A3      SG-------TQLFNLTYSTGDPEIAMMLANGYAEAFIETGKASSRADAAQASSDIQAEIS
A0A2V9KBD6      KG-------TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYYQSQFQVSEQISAFLTNQLK
A0A2W0AJ66      RG-------TRLIEIKFRATDPRLAADVVNYVTKAYVDRNYSSQLYASNQLSQFLLNQLT
A0A1Q7RBU1      KG-------TRLIEIQFRNTDPRLAADVVNELARAYVDQYYKSLFQVSTQISEFLANQLK
A0A2V9JPV9      KG-------TRLLEIKFRNTDPRLAADVVNQLTKAYVDRYYRNQFEASTQMSEFLASQLK
A0A2V8EXP2      RN-------SRLVDVKFSSLSPMLSSQVANALARAYIDQNLEFKFLSSKEASDWLGERLA
A0A2W4RYA1      RN-------SRLVDVSFESPSAAFSMRVANALAKAYVQETLDYRLSASRDANDWLMARLA
G8P0Y7          PD-------TTLVQVGYSDPSPALAAEIANGITAAYIEQNVKSRYDSTMQAADWLSKQLA
A0A3D4VGU2      PE-------TDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLSQQII
C1F294          PE-------TDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLSQQII
A0A3P0X3W6      AS-------SLLLKITYRSKDPRKAADVANAVAHSYIDEAMDMRLHSSMNLSGFMAKQLD
A0A1E3Y9R6      RN-------SRLVDLRFRSPDPEFAARVVNQHAAQYIEQSLEFRLAATTQTNAWLTSQLE
A0A2W4TLP2      RN-------SRLVEIKFQSPDPEFAARVVNAHAEQYIEQSLQFRLEATSQTNAWLNTQLE
A0A3R9WF43      PD-------TRLINVTFENPDPTVAALAANSLAKTFIDDYLERRHRSTSQASYWLQKELD
A0A317HKM4      KD-------TRLVNVGFRSTDPEIAARVANALARAYVRWNVEYRSKMTGEASAWLSRQVE
A0A2W0C122      KN-------TRVVEVSFTGRYRDLNARIVNTLVDVFIDDNIRSRYEAANRAAKFLSAQLT
A0A2W0AUU7      KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLSTQLN
A0A2W0BQL1      KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLSTQLN
A0A3P0XH15      PG-------TQLVEVRFRNQSPAVAASVSNAIVDRYMDRSRRARYEGTTRISEWLAKQLE
A0A3M1WQW8      RD-------TRIVKVTYESPDPQLAAQIVNALMDQLIEYTLMARFESTRQAREWLNKRLT
A0A3N1JHC1      GM-------SNLIRITLIGPDPHLAADTANELTNQYIQQGQNARLAAASETGVFLTQQLE
A0A2V9KA79      EG-------NDAFYVSFEGTGAAQVRDVANRLAEEFIHEVSAADESRVEEAAGLVGARVE
G8P085          PS-------TQLVTISFRNPNPQVAALLANRLIEAYLRQTFDSRYGSVTQVTKWLSSEMD
Q1ILD9          PR-------TGIVQLRFRSSDPELAAAVVNELAEAYTEHNFQVAYESTIKASDWLAKQLV
Q1IJZ6          PD-------TRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVLTRRNASTTQASEWMSAQIK
A0A2V8TCE6      KD-------SNLVEVVYLSPDPRFCAQLANAVADAYIEFALSSQFDTTEQASDFLSRRVG
Q1ITG0          PK-------TQVIEIRFRSTDPALAAKVVNTLTSSYMHHNFMTRFEATMQASAWLQQRLT
A0A3N5PCI5      RD-------TRIIEVRYESPDPELAARVVNTLATTYITHNLEVQSQASKEATTWLAEQLA
A0A3M1Q0S9      RD-------SQLVTISFVHPDRVFAARVANALAEAYIRFSLAAKLDIAAQSEAFLVDQVR
A0A3M1VZ38      RD-------SHLVEISFVHPDPRIAAEVANAIAYGYLRFTLDRKTRIAKQSKDWFVERVA
A0A3M1PY35      EK-------SNVVRVSYRHRDPEIAARIVNAVVRAYRDFFVESGTDARRGASEFLDRRIE
A0A3M1VMP2      EY-------SSVVRVSFTHPSPEIAANVVNAVVDAYRDFFVRTGVDARRGAADFLERAIQ
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      AQIQQVEA----------------------------------------------------
A0A399Y5V2      QKVDEATA----------------------------------------------------
Q01X01          EIRNRA------------------------------------------------------
A0A2V7VMF7      ETQKGMREAQDKLAKTYQGQDGFV------------------------PEGSGGS-----
A0A2V8JK38      NLKGGLEKAEERLQKYGQDN--DILFT---------------------EDGRN-------
A0A2V9IXG5      EIKSMLASQQTQMNQYAESS--NLPVT--------------------------------P
A0A2V9J2P4      EIKSMLASQQTQMNQYAESS--NLPVT--------------------------------P
A0A192WQ77      IMEQKLIEAEEARREAQSEA--GISDL--------------------------------D
A0A1Q7RLS4      PLKEKLEDTQRTSFEFAEKA--NLYVP---------------------ENQQK-------
A0A2V2R525      ELQEQIKNGEERLINYAKDN--QI-IS-------------LE------PS----Q----N
A0A321LPW6      ELQAKVQKAEQSVADYTRDH--NI-YS-------------TE------GK----E----T
A0A2V9R9V4      ELKSKIERSEQALADYTKTN--NI-YS-------------TD------GK----A----T
A0A321LE75      ERRAEVQKAEEELANYTREH--NL-FS-------------TD------GK----E----A
A0A2V8R8U7      KYQDKVNKEQDARFAFAKAK--DLPLG-------------PE------SG----P----N
A0A2V8QMP4      DLQARIQANEQKRINYRKEN--DLPLG-------------TK------QG----Q----D
A0A2V8R4S3      DLQARIQANEQKRINYRKEN--DLPLG-------------TK------QG----Q----D
A0A2V8NJ55      ELQLKIKADEEKLLNYKEKN--DIPIS-------------TA------QG----V----D
A0A2V8Q7I0      EMQGKVRTKTERLFNYAREY--SLPLT-------------ED------VM----L----N
A0A2V8S6K4      DLQAQIAE-----LEKKRTD--ALVQS-------------GSAVNPEAKG----A----N
A0A317I2L9      ELQFKVKHDQEVLFNYAREN--NLNPT-------------GN------QN----L----D
A0A2V8LLF9      KVQDKIKKEEQDRFSFAKAH--NLPID-------------NT------PG----T----N
A0A352FRF4      KYQGQVKQKQADVFNYAKQY--ELPLT-------------DA------PA----S----N
A0A2V8MKV0      TYDELVKKERDDRIAYAKQY--GLPLT-------------PT------EN---------N
A0A2V8PYY8      TYERKVKEERDARVAYAKQY--NLPLT-------------PT------EN---------N
A0A1Q7YKQ8      ELQLEIRRQDEERVNYIKLK--NLPPS-------------KS------PG----A----D
A0A352F3R7      SYQTKIKQEQEAQFNYAKNH--NLPLT-------------ID------AS----S----N
A0A0B6WXT1      ELQLKIRQGEEARINYLRSH--NLPLG-------------QA------KG----Q----N
A0A3B9MEU8      KLQTQIKHDQEAQFNYAKNH--NLPLT-------------AE------AG----G----N
A0A2V8MHG6      DLQSEIRSDEEQLINYAKNH--QI-LS-------------LD------AS----Q----N
A0A2V8P7N1      DLQSEIRSDEEQLINYAKNH--QI-LS-------------LD------AS----Q----N
A0A2V8M3M6      DLQSEIRSDEEQLINYAKNH--QI-LS-------------LD------AS----Q----N
A0A1Q7NJH5      DLQSEIRSDEEQLINYAKNH--QI-LS-------------LD------AS----Q----N
A0A2V8PJY0      DLQSEIRSDEEQLINYAKNH--QI-LS-------------LD------AS----Q----N
A0A1Q7Y6W9      DLQGEIRSDEERLINYANQH--QI-LS-------------LD------PG----Q----N
A0A2V8NC68      DLQSEIRSGEEQLINYAKNH--QI-LS-------------LD------AS----Q----N
A0A399WK13      SLQSDIRRDEEKLVEMTQNA--GI-LK-------------TS------DD----S----T
A0A352FLX4      ELQSNIRGKEEELINYGKNH--QI-LS-------------LD------AN----Q----N
A0A2V8RTL7      DLQTDIRGDEIKLVELKQSE--GI-LK-------------TD------GD----Q----T
A0A3E0PCJ6      ELQSEIRQGEERLVDLKKNA--GI-LK-------------TD------EN----T----T
A0A3M1S4R8      TLQSEIKRDEMRLAELKNNA--GI-LK-------------KD------EG----Q----T
A0A1Q7YFI6      EIQSEIRNGEERLINYAKNN--QI-LS-------------LD------GS----Q----N
A0A136KC10      SLQSDIRRDEEKLVEMTQNA--GI-LK-------------TS------DD----S----T
A0A2V8SEX6      DLQSEIRSDELELAELQKNI--GI-LK-------------TD------GE----Q----T
A0A3M2D6Y5      SLQAEIKRDEMRLAELKNSA--GI-LK-------------KD------EG----Q----T
A0A0B6WWQ6      ELQAQIRAGEAQLLAYSKSH--QI-LS-------------LD------PS----Q----N
A0A3B9MK99      ELQQQIRSDEERLVNYARNN--KI-IS-------------LD------AN----Q----N
A0A352EX26      ELQQAIRSDEERLVNYAKNN--QI-IS-------------LD------AN----Q----N
A0A2V8MM59      ELQDKIRSDEEKLVSYAKSN--QI-LS-------------LD------AN----Q----N
A0A2V8PFE8      ELQQQIRADEEKLVSYAKNN--QI-LS-------------LD------AS----Q----N
A0A2V8PWS6      ELQQQIRADEEKLVSYAKSN--QI-LS-------------LD------AS----Q----N
A0A2V8LCT5      ELQSQIRSDEEKLVVYAKSN--QI-LS-------------LD------AS----Q----N
A0A352FTJ9      ELQAQIRAAEEKLMAYAKSN--QM-LS-------------LD------AN----Q----N
A0A2V8G155      EQRKVVEQAEARLQAYREEH--DAIVP-------------AE------DR----Q----N
A0A2V8HDM7      EQRKVVEQAEARLQAYREEH--DAIVP-------------AE------DR----Q----N
A0A2V8DRT9      EQRKTVDASERALQVYREQH--DA-VS-------------LE------ER----Q----N
A0A2V7VYF3      EQRKKVEVSELAIQRFREDN--DA-VS-------------LE------DR----Q----N
A0A1F2SVH2      EQRKQVEASEQAVQRYREQT--DS-VS-------------LE------EK----Q----N
A0A2V8AJG9      EQRKQVEASEQALQRYREQT--DS-VS-------------LE------DK----Q----N
A0A2G6PYV5      EYRQRIMELYSQLGEQQKNS--ED-LI-------------VG------RAKS-------A
A0A2V8F956      EQRKQVEGAEKKLQQYREQN--DS-IS-------------MK------DR----E----N
A0A1F2S1W5      EQRNKVEASEQALQAYRERT--GS-VS-------------FE------ER----Q----N
A0A1F2T595      EQRKKVEASERALQEYRERT--DS-VS-------------LE------ER----Q----N
A0A2V8JQV5      ELKVNLEKSEQELQDFGRAT--GL-MF-------------TS------EKDS-------S
A0A2V9AC41      ELKERVEQSETALNSYRKDK--GI-IS-------------VD------EK----E----N
A0A2V8K4L4      DLKIKLERSEDTLQSYALAV--GL-QF----------TASSK------GKDGDQE----N
A0A2V8NCZ3      DLKIRLEKSEDTLQSYAVAV--GL-QF----------TGAA-------SKDGEQE----N
A0A2V9MAM9      ELKGKLVKSEGELQAYLRSS--GL-IF-------------GA------GQ----E----T
A0A2V9M454      ELKLKVEKSEEAMVTYERQN--NI-AN-------------IG------DK----Q----T
A0A2V9IVR7      ELKAKVERSQQALVDYERDN--KI-IN-------------IS------DK----E----N
A0A2V9ILE2      ELKAKVERSQQALVDYERDN--KI-IN-------------IS------DK----E----N
A0A2V9LGY4      ELKAKVERSQQALVDYERDN--KI-IN-------------IS------DK----E----N
A0A2V9J4D6      ELKAKVEKSQEALVNYERAN--SI-VN-------------VN------DK----Q----S
A0A2V9L9C5      ELKAKVEKSQEALVNYERAN--SI-VN-------------VN------DK----Q----S
A0A2N9M9N1      ELKAKVEKAQQALVDYEREY--SI-TN-------------LG------DK----E----N
A0A2V9JEC4      ELKTKVERSQQALVDYEKAN--DI-AS-------------IG------DK----E----N
A0A2V9LPQ3      ELKAKVEKSQEALVGYERQN--SI-VN-------------VS------DR----Q----N
A0A348V070      ALRKDIEEAEKKLAELGTAQ--GI-LP-------------LS------SA----E----A
A0A2Z5G3A3      DLRKQSEALQAKVADLQKEA--GV-YT-------------VG------DGGPDGKTQAYS
A0A2V7UGP8      ELKKQVSDLEAKLNQYGKEN--EI-IG-------------LD------DK----E----N
A0A239MKT6      DLKRKIEENHRQVAAFQQKS--GI-VSEGMSAPAPSAGGGAR------GNIGAMAPSVDS
A0A3E0PCN7      ELQSKIRAGEQNLLSYSRNN--EI-LS-------------LD------PD----Q----N
A0A2V8IYW3      DAKLRLIDREKKLEEYRRR-----------------------------------------
G2LEI9          RLQQEILEEERKLTEYLRTR--KI-VS-------------LK------PE----D----N
A0A317J121      ETRNKLQEAQQHLQEFVQSS--GN-LF-------------VL------QD----N----T
A0A2V7YW66      TLKKEVQDKETQLQAFSRRT--DI-VT-------------LD------PA----T----N
A0A2V7Z0V0      KLKEEIQDKETQLQAFSRRS--DI-VT-------------MD------PA----A----N
A0A2V8GFD4      EQRSAVEASERALQQYREQY--DA-IS-------------LE------DR----Q----N
A0A2V8HSS5      EQRSAVEASERALQQYREQY--DA-IS-------------LE------DR----Q----N
A0A2V8KP55      NLKGGLEKAEERLQKYGQDN--DI-LF-------------TE------DG----R----N
A0A399WNU1      ELQAKIRTGEESLINYAKSN--QI-LS-------------LD------AN----Q----N
A0A2V9CG11      EMKAKLEQSEAQLQDYARTS--GL-TF-------------TS------EK----D----N
A0A2V2R0I6      ELKVKVQKSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V8XAR9      ELKIKVQKSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V8VZA0      ELKIRVQRSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A1Q7CB82      ELKIRVQRSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V8WIU1      ELKIRVQRSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A1Q6Y9F5      ELKIRVQKSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V9EVV8      ELKIRVQKSEDTRIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V8YF91      ELKVKVQKSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V8XZK2      DFKIKVQRSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V8ZTX6      DFKIKVQKSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A2V9BT79      DFKIKVQKSEDARIAYERQN--QI-WT-------------LD------DK----Q----N
A0A1Q8B793      ELKIRVEKSEDARIAYERQN--QI-WT-------------ID------DK----Q----S
A0A2V9BCA0      ELKIRVEKSEDARIAYERQN--QI-WT-------------ID------DK----Q----S
A0A2V9BWU9      ELQFKVEKSEDARIAYERQN--QI-WN-------------ID------EK----Q----N
A0A2V9DKX2      ELQFKVEKSEDARIAYERQN--QI-WN-------------ID------EK----Q----N
A0A2V9JSI3      ELKAKVEKSQQAMVDYERQN--AI-VN-------------IN------DK----Q----S
A0A2V9WI32      DLQMKVETSQEKLVRYQKEH--DI-LG-------------ID------EK----Q----N
A0A2V8IVN9      EERKQVEAAEARLQQYREQN--DA-IS-------------LK------DR----E----N
A0A1F2TPT3      EQKEKLDASEQALEHFREQN--QL-IT-------------AE------GS---------P
A0A2V8JTQ2      ELQARVEDSQRKLVDYQKEN--GL-FG-------------LD------DK----Q----N
A0A2V8UZY0      ELQSKVEESQQRLLAYQKQS--GL-FG-------------LD------NK----Q----N
A0A3N5YNR8      DMKGKVEKSEQELVQYAREN--NI-VN-------------IG------PDRG-------S
A0A350UEK1      DLRIKLERSEDALQSYAQRN--KL-VF-------------TG------KD----T----N
A0A350UIQ4      DMRIKLERSEDALQNYAQRN--NL-LF-------------TG------ND----T----N
A0A3N6A5T6      ELKVKVEKSEEQLVAYARAH--NI-LS-------------LA------GSSSKEGDRSQN
A0A1F2Q9L4      ALKQEIQDKEAQLQAYSRRS--DI-VA-------------LD------PS----S----N
A0A1H5SQF5      DLKNKVAESQRRVDDFRQKV--GI-IG-------------AP------TMSSAGSPQVGS
A0A2Z5G448      ELKAHAADAQRKIAQFQRAN--NL-IG-------------MD------AE---GG----N
A0A3E0NV31      ELENEIEDSQDQLLAFARSR--DL-DV-------------DG------ES----------
A0A3N5M5V0      DMKGNVEKSEGDLYRYAREN--NI-LN-------------IN------DR----G----S
A0A2V9AEW6      EMKTQLEASEAQLQDYARIT--GL-SF-------------TS------EK----E----S
A0A2V8WQK6      KMKGELEASEAQLQDYARAS--GL-SL-------------TS------EK----E----N
A0A2V8XIF4      QMKAQLEASETQLQEYARTS--GL-SI-------------TA------EK----E----N
A0A3N5XQP8      ELRVKVEQSERDLNDYARTK--GI-FT-------------TE------GS----Q----N
A0A2Z5G7H4      DLKKQAEALQARVIALQRQS--GV-VS-------------LG------VQDAQGR----D
A0A2V9KCS3      DQRINLEKSEDRLQGYARSS--GL-MF-------------TA------EK----D----N
A0A2U3KC61      DLRRKVQTSEEILVRYQKDH--SI-LG-------------VD------EK----Q----N
A0A2V9Y2R7      DLQLKVETSEGKLVRYQKEH--SI-LG-------------ID------EK----Q----N
A0A372IT17      GLKKQAEALQTKAIGLQSEA--GM-YG-------------DN------GS----H----D
A0A136JPP4      DLKVTIADQENKLTEYMRSS--NL-PL-------------QE------KG----S----D
A0A399WUJ8      DLKVTIADQENKLTEYMRSS--NL-PL-------------QE------KG----A----D
A0A2V9L5B5      EIKAKLEKAEDELQAYAQAN--SI-VY-------------IT------EK----Q----N
A0A2V9L7I0      EIKAKLEKAEDALQAYAEAN--SI-VY-------------IT------EK----Q----N
A0A2V9LK56      ELKGKLEKSDNALQEYAKKN--SI-LF-------------VD------DR----K----N
A0A2V9YHT3      ELRMKVESSQEKLVKYEKDN--DI-LG-------------ID------EK----Q----N
A0A2V9NGH6      DLQIKVETSQEKLVRYQKQH--QI-LG-------------ID------EK----Q----N
A0A2V9PYE6      DLQMKVETSQEKLVRYQKQH--QI-LG-------------ID------EK----Q----N
A0A2V9NL07      DLQMKVETSQEKLVKYQKDH--QI-LG-------------ID------EK----Q----N
A0A2V9QD92      DLQMKVETSQEKLVKYQKDH--QI-LG-------------ID------EK----Q----N
A0A2V9WPZ6      DLQMKVETSQEKLVKYQKQH--EI-LG-------------ID------EK----Q----N
A0A2V9ZLH4      DLQMKVETSQQKLVKYQKEH--SI-LG-------------ID------EK----Q----N
A0A2V9RQF1      DLQLKVETSQEKLVKYQKEH--GI-LG-------------ID------EK----Q----N
A0A2V9YDK8      DLQMKVETSQEKLVKYQKQH--EI-LG-------------ID------EK----Q----N
A0A2V9V8F7      DLQMKVETSQEKLVKYQKQH--EI-LG-------------ID------EK----Q----N
A0A2V9XGR9      DLQMKVETSQEKLVKYQKQH--EI-LG-------------ID------EK----Q----N
A0A2V9V3Q5      DLQMKVETSQEKLVRYQKEH--EI-LG-------------ID------EK----Q----N
A0A2V9NWS3      DLQMKVETSQEKLVKYQKEH--EI-LG-------------ID------EK----Q----N
A0A2V9USA9      DLQMKVETSQEKLVRYQKEH--EI-LG-------------MD------EK----Q----N
A0A2V9XW18      DLQMKVETSQEKLVRYQKEH--EI-LG-------------AD------EK----Q----N
A0A3M2BZG9      ELSREIEKLRTKLASSAAEA--NL-VL-------------DP------DG---------E
A0A1Q7N5R7      AAEAGMHRAESALEAFRVRT-----IT-------------LP------GDPGVAA----A
A0A3M1SIV3      QLQENIAELENQRIAQMRES--GL-PL-------------AE-------K---GQ----E
A0A3E0PHB0      KLKKTIEDGEQNYIGALRES--NL-PV-------------GD------GK---GA----E
A0A3M2D491      ELKENIAQLEQQRIEEMKSS--GL-PL-------------AE-------K---GQ----E
A0A357F267      ELRETIAQQEIELIEYMRSS--GL-PL-------------QE-------K---GQ----D
A0A353C9L6      ELQNTIAQQEIDLIAEMRSS--GL-PL-------------QE-------R---GQ----D
A0A2V8RQV0      ELKLTIQDQESQLMAQMRES--DL-PL-------------LE-------K---GQ----D
A0A2V8SJH5      ELGKTISEQEADLISYMRSS--GL-PL-------------QE-------K---GQ----D
A0A2V9QB26      DMRIKLEHSEDALQSYARST--GL-IF-------------TS------EK----T----K
A0A2V9VYY4      DLQLKVQTSEEKLVRYQKDH--GI-LG-------------VD------EK----Q----N
A0A2V9KIE8      GLKAKLEKSDDQLQAYAQEH--SI-LF-------------IT------EK----Q----N
A0A352F549      ELQSQIRSGEEQLVNYAQSH--EI-LS-------------LD------AS----Q----N
A0A3B9MLP9      ELQSQIRNGEEQLVNYAQSH--EI-LS-------------LD------AS----Q----N
A0A3D5SQ87      ELQSQIRNGEEQLVNYAQSH--EI-LS-------------LD------AS----Q----N
A0A2V8NW86      DMRIKLEHSEDALQSYARST--GL-IF-------------TS------EK----T----N
A0A2V8ZHL8      ELKAKVEKSQQALVDYERQN--AI-VN-------------IS------DK----E----S
A0A2V9B240      ELKAKVEKSQQALVDYERQN--LI-VN-------------IS------DK----E----S
A0A2V9CBM2      SVKAKLEKSEDQLQAYARHN--GL-VF-------------LQ------TDNGTTQ----N
A0A2V8XN17      GVKAKLEKSEDELQSYARRN--GL-VF-------------LE------TDKGASQ----N
A0A2V8WX45      GVKAKLEKSEDELQTYARRN--GL-VF-------------LE------TDKGASQ----N
A0A1Q6YR79      GVKAKLEKSEDDLQSYARRN--GL-VF-------------LE------TDKGASQ----N
A0A1Q7VA32      GVKAKLEKSEDDLQSYARRN--GL-VF-------------LE------TDKGASQ----N
A0A2V9EY85      GVKAKLEKSEDELQGYARRN--GL-VF-------------LE------TDKGASQ----N
A0A2V9H8K0      GVKAKLEKSEDELQSYARHN--GL-VF-------------LE------TDKGASQ----S
A0A2V9FFE5      GVKAKLEKSEDALQGYARHN--GL-VF-------------LE------TDKGASQ----N
A0A2V9GM43      GVKAKLEKSEDALQSYARRN--GL-VF-------------LE------TDKGASQ----N
A0A1F2RFI7      GLKGRLEKSEEDMQRYAKDN--AI-LF-------------LD------EK----Q----S
A0A1F2RZS3      GLKGKLEKSEEDLQRYAKEN--SI-LF-------------LD------EK----Q----S
A0A1F2USE2      GLKAKLEQSEEELQTYAHEQ--GL-LF-------------LQ------NQRGENE----N
A0A2V9C238      ELKARLEKSENEMQSYAREN--GL-LF-------------LE------KEKG-AE----N
A0A1F2Q9F5      EIKANLEKSEEQLQAYARQN--GL-LF-------------LE------NEAGQPE----N
A0A1F2QQH9      EIKANLEKSEEQLQAYARQN--GL-LF-------------LE------NEAGQPE----N
A0A1F2QXK7      EIKANLEKSEEQLQAYARQN--GL-LF-------------LE------NEAGQPE----N
A0A2V9DEM9      ELKARLEKSENELQSYAREN--GL-LF-------------LE------REKGVPE----N
A0A2V9CYQ5      SEKAKLEKSEDQLQAYAHRN--GL-VF-------------LQ------TDNGTTQ----N
A0A2V9BWU8      GVKAKLEKSEEQLQDYARHN--GL-VF-------------LE------NDKGASQ----N
A0A2V8ZG48      GVKAKLEKSEEQLQDYAQRN--GL-VF-------------LE------TDKGTSE----N
A0A2V8Y334      GVKAKLEKSEEQLQDYARHN--GL-VF-------------LE------TDKGASE----N
A0A2V9AY68      GVKAKLEKSEEQLQDYARHN--GL-VF-------------LE------SDKGVSE----N
A0A257VBK0      KMQDQYARQQTTMTTSLAAS--GS----------------Y-----FPQNQKE-------
A0A2V7XDY0      ATQKSMREAQDRLFKSYQSQ--DL----------------F-----VPEGSTS-------
A0A350UQT3      ELRVKMEDSSGRLAQMEREL--NV----------------I-----NPEEKTN-------
A0A2U3JZ71      ELKAKMERSSGALVQFEREL--NV----------------I-----SPEEKTS-------
A0A2V8TTB0      ELRAKMEKSSAALAQFEREL--NV----------------I-----NPEEKTS-------
A0A1F2TCR2      KQQQKVTDSEAAMMQYREQK--DA----------------L-----SLDSSQN-------
A0A2N9LQU7      ELKLNAARAEQRLAEFQKQN--NI----------------L-----GTDENNN-------
A0A2P6WFK7      DLQTRATQSQQRLSEFQMKN--NM----------------I-----GADENDN-------
A0A1F2V330      TLRSQLNEQEERLKIYKESA------------------------VNELPDRLA-------
A0A2V8U914      ELRSKLQTSEAALDEYTRES--GL----------------V-----LAPGDDT-------
A0A2V7W309      TVQANLEESRQDLLSYGKSK--GI----------------I-----SVDEGSN-------
A0A2V8TLH7      PMREKLQDTQRSSFELAEKE--NL----------------Y-----VPENQQK-------
A0A1Q7ZJT1      PLKEKLEDTQRTSFEFAEKA--NL----------------Y-----VPENQQK-------
A0A2V8VC99      PLREKLKDSQQSTFEFAERA--NL----------------Y-----VPENQQK-------
A0A348UZU3      ELKKEISQKEQELQNYGQEK--DI----------------V-----ILSDKET-------
Q01XL7          EAKSRLQTAGEKLRDFVRQS--GM----------------D-----FFPEQST-------
A0A2V8ERZ5      NQQKRVEGSEKGLAEYREKE--NA----------------L-----SLDDKQN-------
A0A2V8GTX0      KQQSVVQASERMLAEYRENQ--NA----------------I-----SLEDRQN-------
A0A2V8J0X9      RQEQQLAASEGALTEYRERN--NA----------------L-----SLEDRQN-------
A0A372IRG7      TLKSQVQSSQQELSDYQKKN--NL----------------V-----GLGPTGTS------
A0A1F2U158      TQQSKVEQSERDLAEYRDRE--NA----------------M-----SLDEKNN-------
A0A2V8F6S9      KQLQKVQESERAMANYRERQ--NA----------------L-----SLDDKQN-------
A0A1I6MH75      GLKQEVETSQEQMMDLQKRL--GT----------------LGF-----DPKDN-------
E8WVF6          DLKRQVETSQEQVLDLGKKL--GT----------------LGF-----DSTHN-------
A0A1H5Z7N3      DLKQQVETSQEQMIDLQKKI--GI----------------LGF-----DPTHN-------
A0A1G7JVV8      DLKQQVEASQEQLMDLQKKI--GV----------------LGLGADASKPVTT-------
A0A1H4T6W9      DLRQQVETSQEQLIDLQKRL--GV----------------LGLGFDATKPPTT-------
I3ZEU5          DLRQQVETSQEQLIDLQKRL--GV----------------LGLGFDATKPPTT-------
A0A428MDU2      DLKQQVQTSQERMMDLQRRL--GM----------------LGF-----DPSHN-------
A0A239HDF6      DLKADVEASQEKMINLQRRL--GI----------------LGF-----DPTHN-------
A0A1Q3QQB6      DLKQQVETSQEQMMDLQRKL--GI----------------VGF-----DPNHN-------
A0A3N1K1G7      DLKQSVETSQEQMMELQKRL--GI----------------LGF-----DPSHN-------
A0A2W0BGU4      ELKAKVEKSQRALVEYERQN--AI----------------L-----SIGEKQN-------
A0A2W0BVQ9      ELKAKVEKSQRALVEYERQN--AI----------------L-----SIGEKQN-------
A0A3D1ASD2      ELKAKMERSSDALAKFQRDL--SV----------------V-----NPEEKTS-------
A0A2N9MK30      ELRAKMERSDTALAQFEKEL--NV----------------I-----NPEEKTN-------
A0A2V9MN96      DLQLKVQASEEKLVRYEKQK--GI----------------V-----GIDEKQN-------
E8UZE1          TLRHQVDADQKNFEEFQERT--GL----------------L-----QTGEGHN-------
A0A2V7V2Z1      EQKGKVEQAERALQQVKEQE--GI----------------V-----NIEERRT-------
A0A2V7X2F7      QQRQKVEQATQELQKLKERE--GI----------------V-----NIEERRT-------
A0A2V7V2I1      EQRHKVEQAELALQKLKEKD--GI----------------V-----NIEERRT-------
A0A2V7U3M2      EQKAKVEAADLALQKVKEQE--GI----------------V-----NIEERRT-------
A0A2V7UHT0      EQKTKVEEADRALQKVKEQE--GI----------------V-----NIEERRT-------
A0A2Z5FVL3      EMKADSDALEQKAVKLQKQT--GV----------------VQVAGSGDGDGQGQAYS---
A0A1V6HR88      TLKQEIQDKENQALAYSKRA--DI----------------V-----TLDTGGN-------
A0A3E0P0A3      SLEAEIQELEADLVSYTQSS--DI----------------V-----APNEETN-------
A0A2V9KBD6      ELQARVEDSQQKLMEYQKQN--GI----------------L-----GLDNQQN-------
A0A2W0AJ66      DLKAKVEESQQKLVDYQNRN--GI----------------F-----GLDDKQN-------
A0A1Q7RBU1      ELQAKVEESQQKLVDYQKEN--GI----------------F-----GLDDKQN-------
A0A2V9JPV9      ELQAKVEESQQKVVDYTKEI--GI----------------F-----GLGDKQN-------
A0A2V8EXP2      EQRQKVEVSEQAVQRYREQT--ES----------------V-----AFEDRQN-------
A0A2W4RYA1      EQRKAVEEAEAALQRYREQN--NA----------------L-----SLQDSQN-------
G8P0Y7          DMQIKMETAQAKLVQYQKEH--AI----------------V-----GTDDKQN-------
A0A3D4VGU2      SLRESVNKSQNDLVQYQREH--NL----------------L-----SVGQQGSS------
C1F294          SLRESVNKSQNDLVQYQREH--NL----------------L-----SVGQQGSS------
A0A3P0X3W6      DLKANMDKSAEALTTYQRQL--GV----------------I-----DPEQQTS-------
A0A1E3Y9R6      EQRRLVEESERRLQDYKEQN--NA----------------T-----SVDDKQN-------
A0A2W4TLP2      EQRRLVEESERKLQQYKEQH--NT----------------V-----SVDDKQN-------
A0A3R9WF43      DLKKQVRDSEQRLADYERTT--GL----------------AGVQV-SGSTSGDGTSSVSV
A0A317HKM4      EQRKLLEASETALQAYRRDHGADA----------------LVRTNQLGEERQN-------
A0A2W0C122      ELRATVEESQQKLVAYEREH--NI----------------L-----MVDDKQN-------
A0A2W0AUU7      ELRAKVEESQQKLVAYEREH--NI----------------V-----MVDEKQN-------
A0A2W0BQL1      ELRAKVEESQQKLVAYEREH--NI----------------V-----MVDEKQN-------
A0A3P0XH15      PLKNQVTESQDALSTYQKQN--NL----------------I-----GVDSNGSGQD----
A0A3M1WQW8      ELREKLEQLQEELVRYSREH--EI----------------I-----QLDENQT-------
A0A3N1JHC1      GAKKKLQESGEALQEYARAS--GI----------------VL----TSETQEP-------
A0A2V9KA79      QLRKQMQEQQDRITRYKQ----------------------------ATLSELPENLGNNY
G8P085          SLRERAAEAQKKLADFQEKN--NI----------------LMLGGGSSGSSKDGGGESPS
Q1ILD9          ELKTGIQSSEQQIADYQKTH--KI----------------I-----GTDENNN-------
Q1IJZ6          DLNQQVEAAQQKLINYEKES--GL----------------I-----AITATDPKNPAAAP
A0A2V8TCE6      ELRDEVEDLEKRLQSYRESR--RI----------------L-----PSAGAEN-------
Q1ITG0          ELKNNVEESQRKLAEYQSKA--NI----------------I-----GTDETDN-------
A0A3N5PCI5      EQRRKVEVSELALQKYRERE--NS----------------L-----SLEAGQN-------
A0A3M1Q0S9      SLKEDINRRRLELHEYAMRH--NI----------------V-----TGDANE--------
A0A3M1VZ38      ELKREVSDLELALQDYAAQH--QI----------------V-----LGQGED--------
A0A3M1PY35      DAQAELLELERRLAEERRRL--GP----------------V-----LARGSDE-------
A0A3M1VMP2      EAQAEVLELEAKLAQARRQA--PP----------------T-----VPEREDE-------
                                                                            

A0A2V7YYV7      ------IGELKDIQT----SHLQVPNSRLSD-----------------------------
A0A2V7Z0J5      ------IKEVNQIQQ----AETQSTNARSGD-----------------------------
A0A2V7Z3M4      ------VSEVKQIQQ----AETQSPNTRTAD-----------------------------
A0A3M2D9H8      ----QIADLQKQLAQ----SSEQSSEKRLQDVTNIISGLQAE------------------
A0A399Y5V2      ----ELQQRDAELAD----AISKTRGEKTSD-----TGSQAL------------------
Q01X01          -----LQTESDLNAY----GRGKRAAGRAEG-----DGNREF------------------
A0A2V7VMF7      ----AAASSIGKLNE----DYVAAQARRIGIEAALKQFAEMRKARKNLDTI-P-----QV
A0A2V8JK38      ----TVTEKLRQLQE----EYTRAQAERIQKQSYERMVRTGS----------A-----DA
A0A2V9IXG5      EMASVEFEMVSRYRA----DYEDAKAKREEEEQKLAKLETYIADSSKLTNI-P-----EL
A0A2V9J2P4      EMASVEFEMVSRYRA----DYEDAKAKREEEEQKLAKLETYIADSSKLTNI-P-----EL
A0A192WQ77      GSLAIVRDRQSQYSK----ELTGIEIELGKLDKSLTRLKELQDSGGDPMTL-P-----EL
A0A1Q7RLS4      ----ITNDRLSTLQS----ELTEAQVKKGEIEGLLKQIDANRQNGGAYENI-P-----QI
A0A2V2R525      ----TVVERLNSLNR----SLLTAENDRTLAEAAYRAAL----E--------P-----GA
A0A321LPW6      ----LTTDKLSRLHD----QVMRAETDRLLKGSLYEELN----M--------G-----RL
A0A2V9R9V4      ----LVAEKLSRLHD----LATRAETDRILKESLYEQVR----Q--------G-----RV
A0A321LE75      ----PAVNKLAQLYT----QVTTAEVQRKLKESLYQQVK----G--------G-----NI
A0A2V8R8U7      ----IEAVRDATYSS----QLLAAENERRTFLAIYEAAKN---A--------P-----DP
A0A2V8QMP4      ----LNALQLSTYSS----QMQTAEAA-------YTSAEQTKNT--------S-----GI
A0A2V8R4S3      ----LNALQLSTYSS----QMQTAEAARKQAEADYKSAVETRNT--------S-----GI
A0A2V8NJ55      ----ITNVRVGSYSS----QLIEAENKRKQAQATYDAARN---S--------S-----DP
A0A2V8Q7I0      ----TEAQRLADLTK----QLFESENKRKNAEAVYKSAST---A--------T-----DK
A0A2V8S6K4      ----VTVERVAMLST----EWLNAQNEVTKLQSEYDAAQKAQAA--------S-----DI
A0A317I2L9      ----VEGQRLNSLSG----QLLDAENQRKTAQAIYNSAKN---A--------S-----DP
A0A2V8LLF9      ----LEAMRLQTYSA----QLLAAEDNRRSQEAIYDAARD---A--------N-----DP
A0A352FRF4      ----LRQQRVSTYSS----QLLEAENQKRSLQSAYEAAKT---S--------P-----DP
A0A2V8MKV0      ----VPIQREQTYNK----QLLDAQNEYRKLKADYDEAKA---S--------T-----EL
A0A2V8PYY8      ----VAAQSEQAYNK----QLHDAENERRKLKADYEEAKG---A--------A-----DL
A0A1Q7YKQ8      ----LAADRLAQLSK----QLLEAENNRKNLQSLYEAAAH---Q--------S-----NP
A0A352F3R7      ----LEVARLSTLSS----QLLQAENDRKLIQAQLEAARR---E--------K-----DP
A0A0B6WXT1      ----LTLERLATLSG----QLLEAENERKNLQSAYEAAQR---E--------T-----DI
A0A3B9MEU8      ----LEAARLATLSG----QLLQAENDRKMIQAQLEAARK---E--------P-----DP
A0A2V8MHG6      ----TVVDRLAGLNK----QLLEAENERKAAEAAYRATL----A--------P-----GA
A0A2V8P7N1      ----TVVDRLAGLNK----QLLEAENERKAAEAAYRAVL----A--------P-----GA
A0A2V8M3M6      ----TVVDRLAGLNK----QLLEAENERKAAEAAYRAVL----A--------P-----GA
A0A1Q7NJH5      ----TVVDRLAGLNK----QLLEAENDRKAAEAAYRAVL----A--------P-----GA
A0A2V8PJY0      ----TVVDRLAGLNK----QLLEAENDRKAAEAAYRAVL----A--------P-----GA
A0A1Q7Y6W9      ----TVVERLAGLNR----QLLEAENQRKLAQAVYEASL----Q--------P-----GA
A0A2V8NC68      ----TVVDRLVGLNR----QLLEAENDRKMAEASYRAAL----R--------P-----DA
A0A399WK13      ----IVMDRLSGLNK----AMLEAENARKNAEANYFEIAK---S--------P-----ER
A0A352FLX4      ----TVVERLEGLSK----QLLIAENERKMAESAYKASL----Q--------P-----GA
A0A2V8RTL7      ----IVIDRLSGLNK----QLLEAENARKLAEAKYFAIKD---S--------P-----ES
A0A3E0PCJ6      ----IVTQRLMGLNE----QLLEAEEQRKNAEAQFNAVRD---S--------P-----SR
A0A3M1S4R8      ----IVIDRLAGLNK----QLLEAENIRKIAEAEYMAVKD---S--------P-----EK
A0A1Q7YFI6      ----TVVERLAGLNR----QLLEAENERKLAEAAYRAAQ----A--------P-----GA
A0A136KC10      ----IVMDRLSGLNK----SMLEAENARKNAEANYFEVAK---S--------P-----ER
A0A2V8SEX6      ----IVLERLAGLNK----NLLEAENKRKNAEAQYVAIKD---S--------P-----EA
A0A3M2D6Y5      ----IVIDRLAGLNR----QLLEAENARKIAEAEYNAVKD---S--------P-----DR
A0A0B6WWQ6      ----TVVERLAGLNR----QLLDAENERKLAEAAYLASL----E--------P-----GA
A0A3B9MK99      ----TVVERLGGLNK----QLLEAENARIEAESKFNAAK----V--------G-----GA
A0A352EX26      ----TVVERLAGLNK----QLLEAENERKTAEAAFNAAK----A--------P-----GA
A0A2V8MM59      ----TVVERLSGLNK----QLLEAENDRKLAEAEYNAAK----A--------P-----GA
A0A2V8PFE8      ----TVVERLAGLNK----QLLEAENDRKMAEAEYNAAK----A--------P-----GA
A0A2V8PWS6      ----TVVERLAGLNK----QLLEAENDRKMAEAEYNAAK----T--------P-----GA
A0A2V8LCT5      ----TVVERLAGLNK----QLLEAENDRKMAEAEFNAAK----A--------P-----GA
A0A352FTJ9      ----TVVERLAGLNK----QLLEAENDRKMAEAEFNAAK----A--------P-----GA
A0A2V8G155      ----IVVQRLADLNT----ALTRAKTERIQKQAAYDQIRNARDVPGSVDTF-P-----LI
A0A2V8HDM7      ----IVVQKLADLNT----ALTRAKTERIQKQSAYDQIRNARDVPGSVDTF-P-----LI
A0A2V8DRT9      ----IVVQKLADLNA----AVTRAKTERIQKESAYEQIKAVQSDREALDTI-P-----AI
A0A2V7VYF3      ----IVVQKLADLNG----AVTSAKNERITKEAGYNRLRTMADDRSALDAF-P-----AI
A0A1F2SVH2      ----IVVQKLSELNA----AVTRAKTERIEKEAAYNQIRTVQNDRATLDTI-P-----AI
A0A2V8AJG9      ----IVVQKLADLNA----AVTRAKTERIQKEAAHNQLRGLQHDRNALDTF-P-----AI
A0A2G6PYV5      ----VEEQALVKLNE----EIAVANRSFIEKRNNLQALQAST----------P-----SQ
A0A2V8F956      ----IVVQKLTELTG----AVTQAKTERFQREALYRQVESLRGNPAMLDTF-P-----AI
A0A1F2S1W5      ----VVVQRLADLNA----AVTKANTVRIQKEATYNQVKAVLENPAAIDTV-P-----AI
A0A1F2T595      ----IVVQKLQELNA----AVTRANTARIQKEAVYNQVRTVLEDPAAMDTV-P-----AI
A0A2V8JQV5      ----VAEEKLHHLEA----DLSEALADRVEKQSKYEIAKSAP-----VESL-P-----QI
A0A2V9AC41      ----VVIDRLLDLNR----SLTKAEAERIGLEAQMHSIHGRN-----YDEV-P-----LV
A0A2V8K4L4      ----VASASVRLVQE----ELLKARADRMIAQSKYELLASSP-----PEAL-P-----QV
A0A2V8NCZ3      ----VVSTSVRLLQE----ELLKARAERMVTQSRFELIQSSP-----PEAL-P-----QV
A0A2V9MAM9      ----LAENRLHLIES----ELSKAQADRIAKTPAYQLADKEH----------P-----EL
A0A2V9M454      ----AEEARFEDMSK----ELSQAQSDRISKESLYKMVVSNEAQV-------G-----FI
A0A2V9IVR7      ----VEEKKLGDLSK----ELTDAQAEVVRAESLYNVARNNENQM-------A-----SL
A0A2V9ILE2      ----VEEKKLGDLSK----ELTDAQAEVVRAESLYNVARNNENQM-------A-----SL
A0A2V9LGY4      ----VEEKKLGDLSK----ELTDAQAEVVRAESLYNVARNNENQM-------A-----SL
A0A2V9J4D6      ----VAEQRLSELSS----DLTRAQSDRAEKESLHQLVKSNEAQI-------A-----LL
A0A2V9L9C5      ----VAEQRLSELSS----DLTRAQSDRAEKESLHQLVKSNEAQI-------A-----LL
A0A2N9M9N1      ----VVQQRLAQLST----DLTAAQVERANKQSVYDSARHNNAEA-------A-----VL
A0A2V9JEC4      ----VVQLRLEDLSK----DLTTAQTDRAQKESLWESVQEDNSLA-------E-----VA
A0A2V9LPQ3      ----VVEQRLSDLSR----DLTTAESDRAQKESLYQMVKSNPEQI-------A-----ML
A0A348V070      ----PLIQKITEVNT----ALTAATLDRVNKFSAYNQLKALR-----PEEL-P-----ES
A0A2Z5G3A3      ----SDINRLELATT----ALSGAESNRILTGAVEQIVKTGD----------P-----EL
A0A2V7UGP8      ----ITNQKLGQLNQ----DVLEAQVESSRKEARYRGLLTTP----------P-----GS
A0A239MKT6      ----TAFQRLSALNE----ELTRAEVARIQREALYHIIQTND----------V-----DL
A0A3E0PCN7      ----IVVQRLSDLNG----KLNQAEMERINAEAALSAAQQDP-----MRGV-T-----VA
A0A2V8IYW3      ----YIGELPSQLQS----NLQVIQTTQIQLQSLSESLNRDRDRRLVLERGLA-----DM
G2LEI9          ----PEVARLTGLNQ----ALLEAEKERLRAEERYQASLTQP-----IDSL-D-----EM
A0A317J121      ----LDNSKLRQLQG----ELSAIQADRIAKQAKYELVAKTS-----PEAL-P-----GV
A0A2V7YW66      ----VILKRLEVLNG----SLMEAKRVRIEKEAKYHETITGP----------K-----EN
A0A2V7Z0V0      ----VTLKRLEALNT----QYIEAKKMRIEREAQYHETQSGP----------R-----ES
A0A2V8GFD4      ----IVVQRLEDLNG----AVTKAHTERLQKQALFEQLQAARGDAAALDRF-P-----TV
A0A2V8HSS5      ----IVVQRLEDLNG----AVTKAHTERLQKQALFEQLQAARGDAAALDRF-P-----TV
A0A2V8KP55      ----TVTEKLRQLQE----EYTRAQAERIQKQSYERMVRTGS-----ADAL-P-----QI
A0A399WNU1      ----TVVQRLSDLNT----KLSQAENDRITAEAAYKAALNNP-----LAGTTA-----QA
A0A2V9CG11      ----VSDARLVELQS----ELTKAQAERIAKQAKFEQVKSTP-----VESL-P-----EM
A0A2V2R0I6      ----IATQRLGDVNR----ELTQAQSERMKREALFEFAKAGN-----LDAV-P-----QM
A0A2V8XAR9      ----ITTQRLSDINK----QLTDAQSERMKKESLYEFAKSGN-----LDAV-P-----QV
A0A2V8VZA0      ----ITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P-----EV
A0A1Q7CB82      ----ITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P-----EV
A0A2V8WIU1      ----ITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P-----EV
A0A1Q6Y9F5      ----ITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P-----EV
A0A2V9EVV8      ----ITTQRLSDINK----QLTDAQSERLKKESLYQFAKAGN-----LDAV-P-----EV
A0A2V8YF91      ----ITTQRLSDINR----QLTEAQSERMKKESLYQFAKSGN-----LDAV-P-----QV
A0A2V8XZK2      ----MTTQRLGDINR----QFTDAQSERMKKESLYEFAKAGD-----LDAV-P-----QV
A0A2V8ZTX6      ----MTTQRLSDINK----QFTDAQAERMRKESLYEFAKAGN-----LDAV-P-----QV
A0A2V9BT79      ----MTTQRLSDINK----QYTDAQAERMKKESLYEFAKAGN-----LDAV-P-----QL
A0A1Q8B793      ----ITTQRLGEINK----ELTEAQSDRMKKEALYQLAQSGS-----LDAL-P-----AV
A0A2V9BCA0      ----ITTQRLGEINK----ELTEAQSDRMKKEALYQLAQSGS-----LDAL-P-----AV
A0A2V9BWU9      ----ITQQKLSDLNK----ELTQAQGERMRSEALYQLVGTGH-----IDAL-P-----PV
A0A2V9DKX2      ----ITQQKLSDLNK----ELTQAQGERMRSEALYQLVGTGH-----IDAL-P-----PV
A0A2V9JSI3      ----VEEQRLAQLSN----DYTNAQNVRLDKESLFELASSNEAEA-------A-----VL
A0A2V9WI32      ----IVTSKLDELNK----ELTAAEGDRIQKESAYKLASAGN----------P-----EI
A0A2V8IVN9      ----IVVQKLSDLNS----AVTQAKTERLQKEALYSQLNSLRSGRGAALDTFP-----AI
A0A1F2TPT3      ----IVMARLNELSA----SITRAQTGLFDKEASYNRALALRANPDKLDQL-P-----QM
A0A2V8JTQ2      ----IVTTKLTDLNR----ELTAAEVDRVQKDVNYQLARSGQ----------P-----DL
A0A2V8UZY0      ----LVTAKLDDLNR----GLTAAEADRIQKEVNYRLAVSGR----------P-----EL
A0A3N5YNR8      ----IVLQTLEDLNR----QMTTVEGELIGKTADYQAVRDAT----------P-----EN
A0A350UEK1      ----VDEEKLKQIQD----QLTAVQGDRVSKQSRWEMASSAP-----AETL-P-----DV
A0A350UIQ4      ----VDEVKLKQIQD----QLTAVQGDRVSKQSRWEMASSAP-----AASL-P-----DV
A0A3N6A5T6      ----IIMQKLADLNQ----EMTKVEAQMIERSAEFDAVKNAT-----VQDF-P-----DA
A0A1F2Q9L4      ----VTLQRLEGLNK----DYVGAMSERIGKEAHYKELANTP----------D-----DM
A0A1H5SQF5      DLGSVELARLNDLNA----QLTAAETVRIAAEAAYRMTQSRD----------A-----DV
A0A2Z5G448      ----LVSDSLRLVNE----QLIQAEADRIVKEARYHLAETRN----------P-----EL
A0A3E0NV31      ----ASSRRVGDLAR----LQTEAEAEAARLRSYVDTLRAGR-----TEGV-P-----DT
A0A3N5M5V0      ----IVLQTLEDLNR----QMTTVEGELIGKTAEFQAVRDAT----------P-----ED
A0A2V9AEW6      ----LAEARLKEIQD----ELSKAQADRIANQAKYAEAAGKS-----ADSL-P-----EI
A0A2V8WQK6      ----PVVNRLKELQD----ELSKAQADRIAKQAKSEEARSKP-----ADSV-P-----EM
A0A2V8XIF4      ----PAENRLKELLD----ELSKAEADRIAKQAKFEEAQSKP-----ADSL-P-----EM
A0A3N5XQP8      ----EVTQKLNDLNT----EITRAQANLIAEQSQYDQARAAS-----ATRV-P-----TN
A0A2Z5G7H4      QAYSVIVDRLQQATA----TLSQATSNRILKGAVYKIVQSGN----------A-----EL
A0A2V9KCS3      ----VAEARLRQLQE----ELSKAQGDRVAKQSRYEVALSSS-----LEAL-P-----EV
A0A2U3KC61      ----IVTAKLNELNN----ELTVAQTDRIQKESNYNLAMAGD----------P-----AE
A0A2V9Y2R7      ----IVTAKLDELNK----ELTEAQTDRIQKEANYKSAMVGD----------P-----TA
A0A372IT17      ----VVLAQLENLNQ----ALSQAELNRILKEAIDHTAQSGD----------P-----EL
A0A136JPP4      ----LAASRLQTLSE----QWLSAADDRRKLEARYNGAVQASSRGEGRNI--P-----DL
A0A399WUJ8      ----LAASRLQTLSE----QWLSAADDRRKLEARYNGAVTASSRGQGQNI--P-----DL
A0A2V9L5B5      ----MATARLEELLE----AYTKAQSERFEKQSLYSLVEAGK-----IQDL-P-----GV
A0A2V9L7I0      ----MGNARLEELLQ----EYTKAQAQRFEKQSLYSLVEAGK-----VQDL-P-----AV
A0A2V9LK56      ----LANERLGQLQQ----EYTKAQADRFQTESLYNLVKPDA-----AKDV-P-----GT
A0A2V9YHT3      ----IITAKLNDLNK----AYTDATNDRIHKQATYRLTLNSS----------P-----EL
A0A2V9NGH6      ----IITAKLDELNR----ELTTAESGRMEKESIYGLVQATD----------S-----DA
A0A2V9PYE6      ----IITAKLDELNK----ELTAAESGRMEKESIYGLVQATD----------S-----DA
A0A2V9NL07      ----ITTAKLDELNK----ELTAAESARMEKESVFRLSDSVD----------T-----ES
A0A2V9QD92      ----ITTAKLDELNK----ELTAAESARMEKESVFRLSDSVD----------T-----ES
A0A2V9WPZ6      ----ITTAKLDELNK----ELTAAESERMEKESVYRLIQSGD----------P-----DV
A0A2V9ZLH4      ----IITEKLDELNK----ELTAAESDRMQRESLYRLTRSGD----------P-----DV
A0A2V9RQF1      ----IITSKLDELNK----ELTAAESDRMQKESVYRLVQSGD----------P-----DT
A0A2V9YDK8      ----ITTAKLDELNK----ELTSAESERMEKESVYRLIQSGD----------P-----DV
A0A2V9V8F7      ----ITTAKLDELNK----ELTAAESGRMEKESVYRLIQSGD----------P-----DV
A0A2V9XGR9      ----ITTAKLDELNK----ELTAAESGRMEKESVYRLIQSGD----------P-----DV
A0A2V9V3Q5      ----IITQKLDELNK----ELTSAESERMEKEAIYRMTQTGD----------P-----DA
A0A2V9NWS3      ----ITTSKLDELNK----ELTSAESDRMAKESFYTLVQAAD----------A-----DT
A0A2V9USA9      ----ITTAKLDELNK----ELTSAESERMDKEAFYRLVESGD----------P-----DA
A0A2V9XW18      ----ITMAKLDELNK----ELTAAESERMDKEALYRLVDSGD----------P-----DA
A0A3M2BZG9      ----AIIERKKSLET----TLNRAVIDRLDKQAIWDELRNLT----------D-----AE
A0A1Q7N5R7      ----GAPPRGSPLGEFFSLRIEQDQMRRDADALEHVLISMRD----------P-----GA
A0A3M1SIV3      ----LTAGILRSKSE----EWLKAEADRRKLEQMYEAALQAANRGEIFSIVSR-----ET
A0A3E0PHB0      ----LSASRLSTVSS----QYLTAIDERRKLEAEYSAAVQAKNP---YAL--S-----DA
A0A3M2D491      ----LAASILEQKST----EWLKAEAERRAIEQQYRTAVEVAKKGEILSV--A-----S-
A0A357F267      ----LAATRLGSMSE----TWLRALEARRQLESRYNAAVSARARGEGMNL--P-----DL
A0A353C9L6      ----LSASRLSSLSE----TWLKAMESRRQLEGRYNAALTANSRGEGMNI--P-----DL
A0A2V8RQV0      ----LAAQRLGAMSE----AYMKAMETRRQLEATLNAAESANARGEAVNI--P-----SI
A0A2V8SJH5      ----LSAARLQSMSE----TWLKAMEGRRQLEARYTAAAQAGARGEGMNI--P-----DL
A0A2V9QB26      ----ISEEKLQQLQG----ELSKTQTDRITAQSRWEITAASP-----PDAL-P-----DF
A0A2V9VYY4      ----IVTEKLGELNK----ELTEAETDRIQKEADYKLAMNGDPEMFMKTSP-D-----GR
A0A2V9KIE8      ----LVNDRLQQLEQ----EYTKAQAARFHAEASYTLVKSTK-----NMDL-P-----SV
A0A352F549      ----TVVERLAGLNK----ELLEAENDRGLAEAAFRTSKLPG-----ATEA-S-----AE
A0A3B9MLP9      ----TVVERLAGLNK----ELLVAENERSLAEAAYRASLAPG-----VTEA-N-----AE
A0A3D5SQ87      ----TVVERLAGLNK----ELLVAENGRSLAEAAYRASLAPG-----VTEA-N-----AE
A0A2V8NW86      ----ISEEKLRQLQG----ELSKTQADRITAQSRWQGTTTSP-----PDAL-P-----DV
A0A2V8ZHL8      ----VVEQRLADLSR----DLTNAQSDRVQKESLYELVKSNE------SQV-A-----FV
A0A2V9B240      ----VVEQRLADLSR----DLTNAEGDRVQKESLYELVRSNE------SQV-A-----FV
A0A2V9CBM2      ----IANERLQQLQQ----ELTKAQAELYEKESLYRLVQTSD-----YGSL-P-----GV
A0A2V8XN17      ----VANERLQQLQE----QLTKAQSERYEKEALYRLVQTGE-----LGAL-P-----GV
A0A2V8WX45      ----VANERLQQLQE----QLTKAQAERYEKEALYRLVQTGE-----YESL-P-----GV
A0A1Q6YR79      ----VANERLQQLQE----QLTRAQSERYEKEALYRLVQTGE-----FGAL-P-----GV
A0A1Q7VA32      ----VANERLQQLQE----QLTRAQSERYEKEALYRLVQTGE-----FGAL-P-----GV
A0A2V9EY85      ----VANERLQQLQE----QLTKAQSERYEKEALYRLVQNGE-----FGAL-P-----GV
A0A2V9H8K0      ----VANERLQQLQE----QLTKTQAERYEKEALYRLVQAGE-----SGAL-P-----GV
A0A2V9FFE5      ----VANERLQQLQE----QLTKAQSERYEKEALYRLVQTGE-----SGAL-P-----GV
A0A2V9GM43      ----VANERLRQLQE----QLTKAQSERYEKEALYRLVQTGE-----SGAL-P-----GV
A0A1F2RFI7      ----LTTEKLKQLQE----EATRAQADLFQKESLYNQVRTGD-----LSSV-P-----GI
A0A1F2RZS3      ----MNAQKLQQLQE----EATRAQSDLIQKESLYNQIRDGD-----FSSV-P-----GI
A0A1F2USE2      ----IVNQRLRQLQE----QLTQAEADRYQKEALYQLLAQGD-----YASL-P-----GI
A0A2V9C238      ----IVNERLRQLQE----ELTRAQAARYEKESLYRLVQAAD-----YASL-P-----GM
A0A1F2Q9F5      ----IVNERLLQLQA----ELTRAQAERIAKESLYRLTQAGE-----YGAL-P-----GI
A0A1F2QQH9      ----IVNERLLQLQA----ELTRAQAERIAKESLYRLTQAGE-----YGAL-P-----GI
A0A1F2QXK7      ----IVNERLLQLQA----ELTRAQAERIAKESLYRLTQAGE-----YGAL-P-----GI
A0A2V9DEM9      ----IVNERLRQLQE----ELTRAQAARYEKESLYRLVQAAD-----YASL-P-----GM
A0A2V9CYQ5      ----IANERLQQLQQ----ELTKAQAELYEKEALHRLVQTSD-----YGSL-P-----GV
A0A2V9BWU8      ----VANERLQALQE----ELTKAQADGYQKESVYRLVQSGN-----YGSL-P-----GV
A0A2V8ZG48      ----VANERLQQLQE----ELTKTQAERYEKEAVYRLVQAGD-----YGSL-P-----GV
A0A2V8Y334      ----VANERLQQLQE----ELTKAQTERYQKEALYRLVQAGD-----YGSL-P-----GV
A0A2V9AY68      ----VANERLQQLQQ----ELTKAQAQRYEKESVYRLVQAGD-----YESL-P-----GV
A0A257VBK0      ----ILDTKIASINE----RLTQVGVKESEVAAIASQLEAWR----------TSGGDPLS
A0A2V7XDY0      ----AVTSSITKLTA----DLIEAQARRIGLEAALKQIAQLK----------AANQPLDA
A0A350UQT3      ----ILSARLLQLNT----EYTRAQAERVAAEAGYEQTRSGS----------L-----ES
A0A2U3JZ71      ----ILSARLLQLNT----EYTNAQADRVRKEAAYKSVAGGS----------L-----EA
A0A2V8TTB0      ----ILSARLLQLNT----EYTNAQGDRVKKEAAYNSIQSGS----------L-----AA
A0A1F2TCR2      ----TVLPRLNSLND----SVTRARLARLQKGQVYEQVRAVK----------PDSDEADN
A0A2N9LQU7      ----IVIDRLRHLNS----QLADAEGDRIIKEARYRLASTGN----------P-----EL
A0A2P6WFK7      ----ITVDRLKLLNQ----QLTEAEADRIVKEARHRLAATRN----------P-----EL
A0A1F2V330      ----TNLSLFAATQA----QLRSSSGLKANDQARLAAVQQEI----------TELEKEGV
A0A2V8U914      ----LAADKLRGVQD----ELSKAQSDLIAKQVQFDLIAK------------------NP
A0A2V7W309      ----VTLQKLGKLNT----DVTSAQGDMYDKQARYNSIQSTA----------P-----ET
A0A2V8TLH7      ----ITNDRLSALQA----DYTETQVKAAELESVLKRVDEVR----------QNGGSYEV
A0A1Q7ZJT1      ----ITNDRLSTLQS----ELTEAQVKKGEIEGLLKQIDANR----------QNGGAYEN
A0A2V8VC99      ----ITNDRLSTLQA----GLTETQVKKGELEGLLKQIDSVR----------LSHGSYEN
A0A348UZU3      ----TMLDKISELNK----ALTEAQIERVRKESYYNGIKNAS----------P-----DF
Q01XL7          ----LADSKMKVLQG----DLAAIQADRIAKQARWEMAKNTP----------I-----DS
A0A2V8ERZ5      ----IVLSRLNQLND----AVTRARTERVQKESLYNQV-KAI----------ANGTAPDA
A0A2V8GTX0      ----IIVSRLNQVND----AASHARTNRIQKEALYNQV--------------AATKDREG
A0A2V8J0X9      ----IVVSRLNQLND----KVTTSRNERLSKEAIYNQLRRAD----------PSSDAIDN
A0A372IRG7      ----LVTDDLRTIND----QLAEARADRIVKEARYRMAQTRN----------P-----DL
A0A1F2U158      ----IVLSRLNALND----AVLRARTTRIEKESVNNQIKSLG----------T-TPV-DS
A0A2V8F6S9      ----LVGARLNKLND----DAMMARSRKLQKELLYNQVKAMA----------AGQPL-DS
A0A1I6MH75      ----QTTSTLEDLSK----ASGAAHIARILAESRYRMLSGMD----------PGTID-GT
E8WVF6          ----QIASSLEDLAK----ASGTAKLARIIAESRYRMLNGMD----------PNAIE-GS
A0A1H5Z7N3      ----EITTSLEDLNR----AVGQAQISRIMAEVRYHTLSGMD----------PNQID-DS
A0A1G7JVV8      ----QVTAAVEALST----AAIAAKVQRILAESRYRVLASSD----------PALME-SN
A0A1H4T6W9      ----QLAVSVDALST----ASVGAKVQRILAESRYRVLANSD----------PDLLE-SN
I3ZEU5          ----QLAVSVDALST----ASVSAKVQRILAESRYRVLASSD----------PDLLE-SN
A0A428MDU2      ----QISTSLEDLSK----AAGDARIARIVAESRYRMLAGMD----------PNTME-GS
A0A239HDF6      ----QISTSLDDLAK----ASGQAKLARIIAESRYRMLSGME----------PDAIE-GS
A0A1Q3QQB6      ----QISSSLEDLSK----AAGEAKIARIIAESRYRVLSGMD----------PDSVE-SS
A0A3N1K1G7      ----QISSSLEDLSK----AAGEARIARIIAESRYRILSGMD----------PNTIE-GS
A0A2W0BGU4      ----VVEQRLGEIST----NFTQSQNDRIQKEALYNQVQTNP----------------DQ
A0A2W0BVQ9      ----VVQQRLGEIST----NFTQSQNDRIQKEALYNQIQANP----------------DQ
A0A3D1ASD2      ----ILSARLQQLNT----EYTNAQTDRVRKEAGFNAMQSGQ----------M-----EA
A0A2N9MK30      ----ILSARLLQLNT----DYTNAETERVKKEAAYKSVSTGS----------L-----ES
A0A2V9MN96      ----IVTAKLDELNK----ELTGAQTDRMQKEANYGLAEAGD----------P-----SG
E8UZE1          ----AIVDRLSQLNS----DLSKAQADRIMKEVTFRESMVSD----------A-----DQ
A0A2V7V2Z1      ----LLDQKLKELGT----SLTTLRTERLEREALYNQMRGAA----------NP----EE
A0A2V7X2F7      ----LLAQKLQQLGT----ALTETRTVRLEKEALYRQMRGAD----------VP----ED
A0A2V7V2I1      ----LVEQRLRELGT----SLTALKTQRIEKEALYRQMKEAP----------NS----EE
A0A2V7U3M2      ----LLEQKLKELGT----ALTTLRTDRLEKEALYNQMRNAA----------NP----EE
A0A2V7UHT0      ----LLDQKLKELGT----ALTTLRTERLEKEALYRQMRGAS----------NP----EE
A0A2Z5FVL3      ----STLDQLQKATA----AVSQAHTNVILKGAIYEVVKSGD----------P-----ET
A0A1V6HR88      ----VVLSRLQALNA----DYTRAVSERIGKGAALKELEVAT----------P-----QI
A0A3E0P0A3      ----VTLQRLTAANS----AFLEAQRRRIEAQAEYNELSNRP----------A-----DD
A0A2V9KBD6      ----IVTTKLADLNK----ELTASEADRVQKEVSYRLARSGQ----------P-----EL
A0A2W0AJ66      ----IVTAKLDDLNK----ELTAAEADRMQKEATYRLTPSSQ----------P-----EL
A0A1Q7RBU1      ----IVTAKLDDLNR----ELTAAEAERVQKEVNYRLASSGR----------P-----EL
A0A2V9JPV9      ----IVTAKLDDLNK----ELTSAEADRVQKEIDYRLARSGE----------P-----EL
A0A2V8EXP2      ----IVVQKLADLNA----AVTRAKTERIQKEATYNQMKALQ----------TERAGLDT
A0A2W4RYA1      ----IVAQKLTDVNT----EVTRARTERMRQESLYRQLQDAL----------ARSADLDG
G8P0Y7          ----LTTEKLDELNR----ELTSAQADRIQKESLYNVAKRGD----------P-----ST
A0A3D4VGU2      ----LVDANLETINS----QLAQAEADRIVKEARYKMALTRN----------P-----DL
C1F294          ----LVDANLETINS----QLAQAEADRIVKEARYKMALTRN----------P-----DL
A0A3P0X3W6      ----ILSARVAQLNS----EYTEAENDRIRKQTAYQGVKSGN----------A-----SA
A0A1E3Y9R6      ----IIVQKLNALNE----QFVQARIARMNAEVQVNAMAERR----------ARGESLES
A0A2W4TLP2      ----IVVQKLNALNE----QLVQARIERMNREVQVNAIRELR----------ASGESLET
A0A3R9WF43      NSHNTVLDRLFTLNQ----EMTSAEANRISSEAVYHLVKTQN----------PEVVLGLG
A0A317HKM4      ----IVVQKLGDLQA----AVTRARADTIEKDAQIKQMSALE----------ADHKPLDT
A0A2W0C122      ----VVTSKLNELNK----QLTAAEEDRMEKEASYQAIAAGS----------L-----DR
A0A2W0AUU7      ----VVTSKLDELNK----QLTAAEEDRMEKDASYQAIAAGS----------L-----DR
A0A2W0BQL1      ----VVTSKLDELNK----QLTAAEEDRMEKDASYQAIAAGS----------L-----DR
A0A3P0XH15      ----LTIEDMRVANQ----QLSEAQADRVVKEARYRMAMTRN----------P-----EL
A0A3M1WQW8      ----IAIERLTDLNR----RLVEAEAERIRAETLYRLSQEAD----------V-----DT
A0A3N1JHC1      ----VAAEHLREIQQ----GLAQAEVDRANRQSAVEMARNAS----------V-----DS
A0A2V9KA79      KLLETIQARLQTVGE----RISNDAARRVAAANEMRELQRQG----------A-----TE
G8P085          PSASTVTDRLTQLNN----RLTVAQGDRIVKEAQMRAAENGN----------T-----AV
Q1ILD9          ----LTLATLDDVSK----QYTDAQADRIMKEAKYRLAKSGN----------P-----EL
Q1IJZ6          VLHIPALDRLTALNQ----DLVTAEASRVTREALYRLARSGD----------L-----DR
A0A2V8TCE6      ----IALKGVSDIDA----IYLQARARRIATESEWTAARGTD----------P-----SS
Q1ITG0          ----LAVSDLTDVSK----QLTDAESDRIMKEAKYRLAQTGN----------P-----EL
A0A3N5PCI5      ----IVVQRLNSLNA----SVTQAKTDLIAVESLYRQLAASQ----------RDQGALDT
A0A3M1Q0S9      ----VSLQNLQDLRN----RRVEAEADLEDKRARYQVLTSAS----------P-----DS
A0A3M1VZ38      ----VTRRNLSNIQE----RYTQAKIKLAEARARLDTVRSTR----------P-----ES
A0A3M1PY35      ----MGSERLVALDQ----ALTEAKRERAAAEARVEALDGAE----------P-----LS
A0A3M1VMP2      ----PGSTRLSRLEQ----TLTEVKAERAAAEARLAAYQEAT----------P-----SG
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      -----------------------INQLQADIVRLESDHETVLGVNALGQPARVTPTLTVD
A0A399Y5V2      -----------------------VATLT--------------------------------
Q01X01          -----------------------YDAMA--------------------------------
A0A2V7VMF7      ATDPV------------------VAGLNAQIATFTVELSR---LKEK-YKEGHPEVQKVN
A0A2V8JK38      LPQITGSSL--------------ISQFVGRLSDLKRQDAE---LTVT-FAPDYPSRRRIR
A0A2V9IXG5      VSSPS------------------FRSYYIQWVEANNALEK---LRLDGKGEEHPTLVAKR
A0A2V9J2P4      VSSPS------------------FRSYYIQWVEANNALEK---LRLDGKGEEHPTLVAKR
A0A192WQ77      ASDSE------------------LKELNRQRIRVERDIAS---ADVS-YRPGHPKYEEKV
A0A1Q7RLS4      SGDTV------------------VRDLYREKAGLEREYER---LLVT-YKDKHVRVLEKQ
A0A2V2R525      AEALAASNQ---------------STAAAKLSDLRQRLAQ---LKAE-YTDKWPEIKVVQ
A0A321LPW6      DRLSEAFSDPKI------------SELTKIRGELAATYAQ---LSVR-YGPENPRVAESK
A0A2V9R9V4      AQIPEAFADTKT------------VELQRKLGELATTAAE---LSVT-YGPKYPKMAEIN
A0A321LE75      DVATEAFTDSKL------------TGLQARLNELEVKARE---LDVK-FGADHPRVVEIR
A0A2V8R8U7      FANPEVQKDERI------------LRLRGKISDLKDKLTF---LRQK-YTDEWPDVKQAS
A0A2V8QMP4      WAIPQVQSNPTV------------VKLRDKIGELEEQKAA---LLVN-YTPEWPAVQKIE
A0A2V8R4S3      WAVPQVQSNPSV------------LKLREKMGELEEQKAA---LLVN-YTPEWPAVQKIE
A0A2V8NJ55      WSIPEIQDDKSV------------QRLRDRISDLEEKRAS---LLRT-YTEEWPAVQATN
A0A2V8Q7I0      FSIPEVQKSGRV------------TALRDRISALREKRET---LKVT-YTDKWPEVLKLD
A0A2V8S6K4      FSIPKVQDNKQI------------QDLQIKLAALNEQRVA---LLKQ-YTENWPAVQKVE
A0A317I2L9      FTVPEVIKSTRI------------VALRERISAIKERRDA---LLVT-YTPEWPEVRKLE
A0A2V8LLF9      FNAPEIQSDQRI------------QKLRDKIGDLEDKRNS---LLEI-YTPEWPEVKKIE
A0A352FRF4      FANPEVQKDERI------------MKLREKISELKDKETG---LLQK-YTKEWPEVQQVE
A0A2V8MKV0      LSNPEVQKNESV------------LKLRDKLSELQAQRAA---LRQT-YTDEWPDIKKLD
A0A2V8PYY8      ISNPEVQKNESV------------MKIRDKLTELQSQRAA---LLQT-YTTEWPDVKKLD
A0A1Q7YKQ8      MAVPDVADSKRI------------QQLREKLDQLKQKRSE---LLVI-YTVEWPEVKRVD
A0A352F3R7      FSIPDVNASARV------------DKLRDRISALKEKRDA---LLIV-YTSEWPEVKKID
A0A0B6WXT1      WSVPEVQSDQRI------------QKLRDRIGELEEKRAA---LLVQ-YTPEWPEVKKVD
A0A3B9MEU8      FSVPDVNSSARV------------EKLRDRISALKEKRDA---LLIV-YTPEWPEVKKID
A0A2V8MHG6      LEAQAEATNN-SS-----------ATTEAKLAELKQHRAQ---LLQE-YTEKYPEVRDLD
A0A2V8P7N1      LEAQAEATSNKSS-----------ATPEAKLAELKQHRAQ---LLLE-YTEKYPEVKDVD
A0A2V8M3M6      LEAQAEATSNKSS-----------ATPEAKLAELKQHRAQ---LLLE-YTEKYPEVKDVD
A0A1Q7NJH5      LEAQAEATSNKSS-----------AATEAKLAELKQRRAQ---LLLE-YTEKYPEVKDVE
A0A2V8PJY0      LEAQAEATSNKSS-----------AATEAKLAELKQRRAQ---LLLE-YTEKYPEVKDVE
A0A1Q7Y6W9      SEARAEDANK-QI-----------QQYEANLVELRRKRAE---LLVE-NTEEHPDVQQVE
A0A2V8NC68      ASAMVE--AK-SS-----------SDADAKLNELKRKRAQ---LLLE-YTEKYPEVKDLD
A0A399WK13      LSAMAEAEMARFITEQQNNIRQFQSDTLKKISDLRQARAL---KLQE-YQEGAPEIKEID
A0A352FLX4      AEALAEGGINEKDVPSATRIT---TDSELKLAELKQKRAE---LLVE-NTEKWPAVREID
A0A2V8RTL7      LNALAEQDSQRYITERENSVLQLRTDVRKKINDLNAEKAR---KLED-YKETAPEIIEID
A0A3E0PCJ6      LSALAEEQMARYITERENDIRRFVNDTQKEITALRAKRQK---MLVE-YVERAPEIQEID
A0A3M1S4R8      LRALAEEKLQRFITERENDMRSLNNETAKKIAELEAEKAK---LLIE-YQESAIEVQEIN
A0A1Q7YFI6      AEALARENRN--------------KQAEEQLLELRKKRAE---LLVE-NTEDWPEVKEID
A0A136KC10      LAAMAEAEMARFITEQQNNIRAFQSDTLKKISDLRQARAL---KLQE-YQEGAPEIKEID
A0A2V8SEX6      INALAEQDNQRIIQDRKLAIIAYRNDTQKKISDFRSQRAK---LLQE-YKESAPEIVEID
A0A3M2D6Y5      LKALVEEKLQRYITERENDMRALNNEATKRIAELEAEKAR---LLVE-YQESALEVQEIN
A0A0B6WWQ6      AEAMVEKEDGIS------------VAALNKLTELRQRRAQ---LLVE-ATEEMPEVKEVN
A0A3B9MK99      ATALAEVDAKQV------------NETEGKLADLRQKRAL---LMVD-ATEEAPEVKEVD
A0A352EX26      ASALAEGDNKQA------------GDGENKLADLRQKRAL---LMVD-ATEEAPEVKEVD
A0A2V8MM59      ANALAEAGAKDI------------ADSESKLSDLKQKRAQ---LLVD-ATEEAPEVKEIQ
A0A2V8PFE8      ATALAE-GAKDI------------NESESKLADLKQKRAQ---LLVD-ATEEAPEVKEVD
A0A2V8PWS6      ATALAEAGAKDI------------NESESKLADLKQKRAQ---LLVD-ATEEAPEVKEVD
A0A2V8LCT5      ASALAEAG-KDI------------ELSESKLAELKQKRAE---LLVT-ATEEAPEVKEVD
A0A352FTJ9      ASALAEAGAKEI------------EATDSELTKLRQKRAQ---LLIE-ATEEAPEVKEID
A0A2V8G155      LTNGF------------------IQQQKSQLSELQREYAQ---LSEK-LGDKHPEIIKVK
A0A2V8HDM7      LTNSF------------------IQQQKSQLSELQREYAQ---LSEK-LGDKHPEIIKVK
A0A2V8DRT9      LSNVF------------------IQQQKTELAELQRQESQ---LSEK-LGQRHPDMLKAK
A0A2V7VYF3      LSNSF------------------VQQLKSELADAQHKQAQ---FSET-LGDKHPDMIKAR
A0A1F2SVH2      LSNGF------------------IQQQKNVLADLQRQQAQ---LSDK-LGPNHPDMVRLS
A0A2V8AJG9      LSNTF------------------IQQQKGEIAELQRQQAQ---LSEK-LGPRHPDMLKVS
A0A2G6PYV5      AIEVN--------------QNVAIKDLSSQISRKKLEYEA---NLSK-YKPQLPKMVALN
A0A2V8F956      LANTF------------------IQQQKTELAQLQSQSAQ---LGDK-LGPNHPDMVKIR
A0A1F2S1W5      LSNAF------------------VQQQKTELAQLLRQRAQ---LSEK-LGPNHPDMIKVN
A0A1F2T595      LSNTF------------------VQQQKAALADLQRQRAQ---MSEK-LGPNHPEMVKIN
A0A2V8JQV5      LDDGT------------------LRDLQSKLTELRSQTAE---LRVS-LTPAHYRVQRLE
A0A2V9AC41      RDSLV------------------IGGLKGELAKSEADYAS---LAKE-FKAGYPPLDNLK
A0A2V8K4L4      LDDSS------------------LREYESKLVDLKRQRAE---LSPS-FTPDHPRMQKLE
A0A2V8NCZ3      LDDPS------------------LREYESKLVDLRRQGAE---LGSS-FTPAHPRMQKLE
A0A2V9MAM9      LVDNA-----------------VIRDYQVKLTELRKQLAD---LDSV-LTPENYKVVRLK
A0A2V9M454      QTNSL------------------LPGLEAKELDLKEQYSE---ALAH-YGPTYPKVLSLQ
A0A2V9IVR7      VGNDL------------------LSRLEERYAELKSQYVE---AREQ-YGPNFPKVVRLR
A0A2V9ILE2      VGNDL------------------LSRLEEKYAELKSQYVE---AREQ-YGPNFPKVVRLR
A0A2V9LGY4      VGNDL------------------LSRLEERYAELKSQYVE---AREQ-YGPNFPKVVRLR
A0A2V9J4D6      AQDHL------------------LETLEQKVADVKTEYID---ARTT-YGPNFPKVVRLQ
A0A2V9L9C5      AQDHL------------------LETLEQKVADVKTEYID---ARTT-YGPNFPKVVRLQ
A0A2N9M9N1      AEDAL------------------LGQLESKNAELHTEYAA---ATSQ-YGPNFYKVKQLG
A0A2V9JEC4      SNDAL------------------LQHLEQNYADLKTQYAA---SLAQ-AGPNFYKAVQIR
A0A2V9LPQ3      AQNDL------------------LQKLQEKSADLKAQYVD---ALGQ-FGPNFPKVVRLR
A0A348V070      PSNPA------------------IARLREQYALLSREYAR---RLAT-LKPEYPEMQKLK
A0A2Z5G3A3      ISGLAGSPMLGAASSGVASSLSLIQGLRSQEAVLQGQMAE---YSSK-FSPDYPKLVDMK
A0A2V7UGP8      IKEVT--------------QSNLIQQLRQKTAELEREYTQ---KSKQ-FKPDWPDMVRLQ
A0A239MKT6      VLNSA---SSLGAGLAGGNEMRVLGTLREQASAIKIRMAS---ESVK-FGSQYPAVLELQ
A0A3E0PCN7      SKDAR------------------TTSLEQELSTLRLQLEQ---LKVE-FTEEWPAVKEVR
A0A2V8IYW3      RADPA----------TAAATADPSDRTPDPLDAARTELAT---LGRR-LLPTHPDVIAAK
G2LEI9          QSDPE------------------LQKLRGKISELKQRRLE---LLGT-YTELHPDVVQID
A0A317J121      LEDIN------------------VRGYQTRIADLRREAAV---LKTT-LTPDNPKVKKIE
A0A2V7YW66      VADSL--------------SGGMVTELRKEVLNLQRDYDT---KLKT-YKPDFPEMVTLK
A0A2V7Z0V0      MSDSL--------------TTGVVSDQRGQILKLEREYET---KLKT-YKPDFPDMVTLK
A0A2V8GFD4      LSNGF------------------IQQLKGEIAALQRQHAE---MADN-LGERHPTMIKLK
A0A2V8HSS5      LSNGF------------------IQQLKGEIAALQRQQAE---MADN-LGERHPTMIKLK
A0A2V8KP55      TGSSL------------------ISQFVGRLSDLKRQDAE---LTVT-FAPDYPSRRRIR
A0A399WNU1      KDART-------------------AGLESQLTTLRQQLAQ---LKVD-YTDEWPEVQKVE
A0A2V9CG11      LDDPT------------------LREYRLRLTDLQRQFVE---LTAT-LTPAHYKVQRVQ
A0A2V2R0I6      QNNSF------------------LNELIRKRNELNAEYND---AVSQ-YGPNFPRVQRLQ
A0A2V8XAR9      QSDAG------------------LAELLRKRNDLSSQHSD---ALSQ-YGPNFPKVQRLQ
A0A2V8VZA0      QNNSA------------------LGDLLKKRSDAASQYND---ALAQ-YGPNFPKVQRLQ
A0A1Q7CB82      QNNSA------------------LGDLLKKRSDAASQYND---ALAQ-YGPNFPKVQRLQ
A0A2V8WIU1      QNNSA------------------LGDLLKKRSDAASQYND---ALAQ-YGPNFPKVQRLQ
A0A1Q6Y9F5      QNNSA------------------LGDLFKKRSDAASQYTD---ALAQ-YGPNFPKVQRLQ
A0A2V9EVV8      QNNSA------------------LGDLFKKRSDAASQYTD---ALAQ-YGPNFPKVQRLQ
A0A2V8YF91      QTNTA------------------LTELLKKRSDTSAEYAN---ALTQ-YGPNFPKVLRLQ
A0A2V8XZK2      QSNAA------------------LTDLLKKQRDSSAEYTD---ALAQ-YGPNFPKVQRLK
A0A2V8ZTX6      ESNTA------------------LADLLKKKGETSADYAD---ALTQ-YGPNFPKVLRLK
A0A2V9BT79      DSNSA------------------LTELLKKRGETSADYAD---ALQQ-YGPNFPKVLRLK
A0A1Q8B793      RDSEL------------------LQDIYKKRNDAYTQYTS---ALNQ-FGPNFPRVQRLQ
A0A2V9BCA0      RDSEL------------------LQDIYKKRNDAYTQYTS---ALNQ-FGPNFPRVQRLQ
A0A2V9BWU9      RDSLL------------------LQDLQKKQSELNTQYVE---ALNQ-YGPSFPKVVRLQ
A0A2V9DKX2      RDSLL------------------LQDLQKKQSELNTQYIE---ALNQ-YGPSFPKVMRLQ
A0A2V9JSI3      MQSEV------------------LGRLEEKYAELKAQLVD---ASGQ-YGPNYPKVVRLQ
A0A2V9WI32      FAKAE--------------PSSLINQLRTQESDLRMKYAE---ATTQ-FGSSYPKVMQLG
A0A2V8IVN9      LSNTF------------------IQQQKSELLQLQSQYTQ---LSEK-FGDKHPDIIKVK
A0A1F2TPT3      LNNAA------------------LQQLRLELERLRRDRAT---AART-LRAQHPSMLKLE
A0A2V8JTQ2      VARLE--------------PDNLLTRLRAQQADLENQIAQ---ASVQ-LGPAHPKMAELS
A0A2V8UZY0      IAKLE--------------PDNLITRLRAQLADLENQIAQ---ASVQ-LGPAHPKMVELS
A0A3N5YNR8      FPQSL--------------RTPSISLLEERLFGLQQNLAS---LSAQ-FGSEWPAVIQVR
A0A350UEK1      LNDTL------------------MRGYQEKISDLRRQQQE---LLET-FTPENQRVKRVA
A0A350UIQ4      LNDSS------------------MRGYQEKLSDLRRQQED---LLEV-FTPETSRVKRVN
A0A3N6A5T6      LVTDN------------------IRQLETTLADLEQKLAN---MTSH-YGPVWPEVVQLK
A0A1F2Q9L4      VADTV--------------SGGLVTQLRGEQLKLERDYAT---KLNT-YKPEWPAMQELK
A0A1H5SQF5      VLGIDSSQLNGAPGALASLDTVRLHQLRTQTGQLEVQISA---ETQK-YGPRNPAILSLK
A0A2Z5G448      LVSVA--------------PTTTLVSLRTQQAELLVQSAE---LKSK-YGFDYPRVREVE
A0A3E0NV31      AKTQE------------------LRALEAQIARQEQELAA---LSAR-YGPEWPSVRQTR
A0A3N5M5V0      FPQSL--------------RTPSISLLEERLFGLQQNLAS---LSAQ-FGNEWPAVVQVR
A0A2V9AEW6      LEDPT------------------MRDYRQKLTELQRQYAE---LSAT-LTPEHYKVLRVQ
A0A2V8WQK6      LEDPT------------------MREYRQKLTELQRQYAE---LSAT-LTPEHYKVKRVQ
A0A2V8XIF4      LEDPT------------------MREYRQKLTELQRQYAE---LSAT-LTPEHYKVQRVQ
A0A3N5XQP8      LRSSV------------------TEQIEARLSALRQDYAR---LTSQ-FGPEWPEVIQAQ
A0A2Z5G7H4      ISGLS-ANGIVSGSPTLSTSLGLIQSLRMQEAALQGQIAQ---DTSK-FGPSYPRLMDSR
A0A2V9KCS3      LDDAS------------------LQDYRQKLTELRRQLAE---LGAT-YTSTHPKVERVD
A0A2U3KC61      FAKPS-----------REGTSSMLEKLREKEADLNTQYAQ---ATTQ-FGSGYPKVVELK
A0A2V9Y2R7      FAKIQ-----------AGGTSSLVDKLREKEADLNVQHAQ---ATTQ-FGSAYPKVVELR
A0A372IT17      ISGLT-ASAGAEETGGLQHSLELIETLRSRESTAKAELAQ---DETR-YGAAWPGMQERQ
A0A136JPP4      YENKVYQDTVRLNTERKAKLQDQIREIEKQIKDAETEKAE---LLVK-YTPEYVKVKQVE
A0A399WUJ8      YENKVYQDTVRLNTERKAKLQDQIRDIEKQIKDAETEKAE---LLVK-YTPEYVKVKQVE
A0A2V9L5B5      LSNRL------------------VQDLEIRLADTKKEYAQ---VTTW-VKPDYPKAQQVE
A0A2V9L7I0      LSNRL------------------IQDLEERLADVQKEYAL---VTTW-VKPEYPKALQVK
A0A2V9LK56      LSNKL------------------IQDLEFKIADLEREYAQ---LTAV-VKPDYPSAVRLK
A0A2V9YHT3      LSQAD--------------PNTLIEQLRTREADLKTQYAQ---VSTQ-FGPAYPKVVEVG
A0A2V9NGH6      AAAAA-ISADHSTRNASLS-SSLLEKLREQQADFRIQVSQ---LSTQ-FGPAYPKVAQLN
A0A2V9PYE6      AAAAA-TSADHSTRIASLS-SSLLEKLREQQADLRIQVSQ---LSTQ-FGPAYPKVAQLN
A0A2V9NL07      AAAVA-NSGSAKG---SGSTSGLLDKLQAAKADLKIQIAQ---VSTQ-FGPAYPKLAELN
A0A2V9QD92      AAAVA-NSGSAKG---SGSTSGLLDKLQAAKADLKIQIAQ---VSTQ-FGPAYPKLAELN
A0A2V9WPZ6      VASVP-VGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAE---LSTQ-FGASYPKVAQLN
A0A2V9ZLH4      IATAT-ATGGTEG--NASSGSTLLDKLRSQEADVKIQVAE---LSTQ-FGPSYPKVAQLN
A0A2V9RQF1      AASAA-LSAAGTAGTNSST-SGLLEKLREQQADIRIQTAQ---LSTQ-FGPSYPRLAQLN
A0A2V9YDK8      IASTT-SVAGSNGGTGANSGSSLLDNLRSKQADLKIQVAE---LSTQ-FGSSYPKVAQLS
A0A2V9V8F7      VASAP-VGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAE---LSTQ-FGASYPKVAQLN
A0A2V9XGR9      VASAP-VGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAE---LSTQ-FGASYPKVAQLN
A0A2V9V3Q5      VASAV-TSAPVATLAGTGS-SPLLDKLHQQQADLKIQVAE---LSTQ-FGPAYPKVAQLN
A0A2V9NWS3      AAAAA-LSSATGSGLSSAS-SNLLEKLREQQADLKIQVAQ---LATQ-FGPAYPKLTQLN
A0A2V9USA9      IASSA-GGIETGSA--QSA-SALLESLRAKQAELHIQTAD---LNTQ-FGPSYPKLAQLN
A0A2V9XW18      ILSSA-NALEEAGAGGQSS-SALLGGLRSKEADLKIQAAD---LSTQ-FGPSYPRLNQLN
A0A3M2BZG9      VANSL--------------ISSQITQLRSEVDKLERQYRK---ALQT-FRDDWPSVTKLK
A0A1Q7N5R7      LADAL----------APIGAVQRSADLTQALHELTTKRAEQRALAYR-YTPDHPTLQRVT
A0A3M1SIV3      PNSEFISTLRANIIAKKNSLDARLSEIDNKIKAAESERAA---LLAR-YTPENPKVKQIE
A0A3E0PHB0      SGGVLASQLRQTKTERKAKFDEQVRALDEKVKTAESELAK---LRVK-YTEQHWKVKEAI
A0A3M2D491      -DNKFIITAREQQLKLKKDSEARLEDIEGQIEKAEKEKAA---LLAR-YTEEHPSVKQIE
A0A357F267      YENKIFQDTMRLNTERKAKLQDQIRDIDKQIQQAETEKAE---LLVK-YTPEYFEVKKKV
A0A353C9L6      YENKIFQDTIRLNTERKAKLQDQIRDIEKQIQETEAEKAE---LLVK-YTPEYPEVGKKE
A0A2V8RQV0      GENKIFQDTMRLNTERKAKLQDQIRDIEKQIQQTEVEKSE---LLVK-YTEAYPEVGKKD
A0A2V8SJH5      SESKIFQDTIRLNTERKAKLQDQIRDIEKKIQDSEVEKAE---LLVK-YTPEYSKVKVVE
A0A2V9QB26      LNDSA------------------LRSLQEKLTELRRQHAE---LITI-YTEKHNKVKQVE
A0A2V9VYY4      GGSGL------------------LDKLREKEADLETQYAM---ATTQ-FGSGYPRVTELN
A0A2V9KIE8      LSDKF------------------IQELEGRLAELERQYAE---MTSM-VKPEYPKAVQLK
A0A352F549      VSDKQ------------------IAELKTRLGELRQKRAQ---LLLT-DTEESPEVKDAT
A0A3B9MLP9      TSDKQ------------------VAEFKTRLAELKQKRAQ---LALT-DTEESPEVKDVN
A0A3D5SQ87      TSDKQ------------------VAEFKTRLAELKQKRAQ---LALT-DTEESPEVKDVN
A0A2V8NW86      LNDSS------------------LRSLQEKLTELRRQKAE---LITI-YTEKHNKVKQVE
A0A2V8ZHL8      AQNDL------------------LQRLEEKFADLKAQYVD---ALEQ-YGPKHPKVERFR
A0A2V9B240      AQNEI------------------LQRLEEKFADLKAQYVD---ALEQ-YGPKHPKVERLR
A0A2V9CBM2      FENRM------------------LQDLTVRLTDLKREYAQ---LSTT-FGSDYPRVKEIQ
A0A2V8XN17      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVKEIQ
A0A2V8WX45      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FNADYPRVKEIQ
A0A1Q6YR79      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVKEIQ
A0A1Q7VA32      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVKEIQ
A0A2V9EY85      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVKEIQ
A0A2V9H8K0      FENKL------------------IQDLSARLAELKREHAQ---LSTT-FNPDYPRVKEIQ
A0A2V9FFE5      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FNPDYPRVKEIQ
A0A2V9GM43      FENKL------------------IQDLSERLAELKREHAQ---LSTT-FNPDYPRVKEIQ
A0A1F2RFI7      LENKL------------------YQDLSIKLADLRREYSE---LTAT-FTPEYPRVKRLK
A0A1F2RZS3      LENKL------------------YQDLSLKLNDLRREYSD---LSAT-FTEEYPRVQRLK
A0A1F2USE2      HDNTV------------------METLTVKLAELQREHAQ---LTTT-FTAKYPRVEQLE
A0A2V9C238      AENKL------------------VADLAVRLADLQREQAQ---LATT-FTADYPKVRQIQ
A0A1F2Q9F5      FENKL------------------MQDLTVQLAELRRQHAQ---AATT-FSPDYPTVKQLQ
A0A1F2QQH9      FENKL------------------MQDLTVQLAELRRQHAQ---AATT-FSPDYPTVKQLQ
A0A1F2QXK7      FENKL------------------MQDLTVQLAELRRQHAQ---AATT-FSPDYPTVKQLQ
A0A2V9DEM9      AENKL------------------VADLAVRLADLQREQAQ---LATT-FTADYPKVRQIQ
A0A2V9CYQ5      FENRM------------------LQDLTVRLTDLKREYAQ---LSTT-FGSDYPRVKEIQ
A0A2V9BWU8      VENKL------------------IQDLSERLAELKRELAQ---LSTK-FNAEYPRVKEIQ
A0A2V8ZG48      VENKL------------------IQDLSERLAELKRQFAD---LSTK-FNPEYPRVKEIQ
A0A2V8Y334      VENKL------------------IQDLSERLADLKRELAQ---LSTK-FNAEYPRVKEIQ
A0A2V9AY68      VENKL------------------VQDLSERLAELKRELAQ---LSTK-FNPEYPRVKEIQ
A0A257VBK0      IPAVAQDPS--------------VQDLAKQYNELNRDLGK---LQAK-FTPKHPEVLKKQ
A0A2V7XDY0      VPQFAADPT--------------IMILNTQVSAANNELTR---LRQQ-YKEGHPEIQKLL
A0A350UQT3      AQVSGQGEA--------------IRRLLERQNEAAERFAE---VKAH-FGVNHPEFRKAQ
A0A2U3JZ71      AQVSTQGEA--------------LKRLSERLDEEQQKFAE---IKAH-YGPNHPEYRKAS
A0A2V8TTB0      AQVSSQGEA--------------LKKLTENLNEAKERFAE---VRNH-YGINHPEYRKAQ
A0A1F2TCR2      LSIIATSPG--------------VVTAKSRLADLNSQRLT---LSSR-YMDTHPDIQKLD
A0A2N9LQU7      VAAVVPSTT--------------LQALRMQEADLKSQYAQ---LDAK-FGSGFPRVQELQ
A0A2P6WFK7      LGTVDPN----------------LQTLRTQEADLKAQLAQ---VSAK-YGNGYPKLRELQ
A0A1F2V330      LDAAPPKEK---------------TPAETNLEERRLHLKQ---LRSV-FTEQYPEVVSTE
A0A2V8U914      AEITTENPG--------------IRDYETKLTDLRRQLAD---LESI-LQPESYKVVRVK
A0A2V7W309      VAQQDAT----------------VIHLNEELSRLQRDFNA---KRAQ-YTEAHPVMQDLA
A0A2V8TLH7      IPQISGDAV--------------VQDVYREKAILERDLEK---LSVT-YKDKHVRVLEKQ
A0A1Q7ZJT1      IPQISGDTV--------------VRDLYREKAGLEREYER---LLVT-YKDKHVRVLEKQ
A0A2V8VC99      IQQISGDPV--------------VQELYREKVGLEREYER---LLVT-YKDKHIRVQEKQ
A0A348UZU3      IPEAMNNPL--------------IQRLREEYLKLSREYAK---MEEK-FQPEYPEMQRLK
Q01XL7          LPDVLSDPT--------------LLGLKSRIVDLRREMAQ---LTAT-LTPEHYKVQKIQ
A0A2V8ERZ5      IPAIATNAG--------------VASAKAKLSDLQREKAK---LLER-YQDKHPQVINAV
A0A2V8GTX0      LSQIASNPF--------------VQQLKTRIVELQRDRVR---LEER-YGEKHPDVQRVN
A0A2V8J0X9      FPIVGTNSA--------------VVDAKNALATLTAQKAN---YAGR-YGPEHPRMMEVK
A0A372IRG7      LVSVSGGV---------------LGSLRSQEADLMVQKAQ---LQSK-FGPEYPKLREID
A0A1F2U158      IPAIAQNAQ--------------VQLHKAQLSELQRQKAQ---LSER-YGEKHPDIINVN
A0A2V8F6S9      VPAIAQNPT--------------VVGAKNKVQELQRTLTE---LSAR-YGEKHPSIQKAR
A0A1I6MH75      ID------------MNPGTMPVQFAQLRSQIALAKANYAQ---LMTT-LGPNNPKALELS
E8WVF6          IDA--------GTTATTGGATNGLANLRSNLATARATYAE---LTAT-LGPNHPQVKAAR
A0A1H5Z7N3      VASTQVGSSGNLTSGAPGAGDQQLATLRTQMETTKADLAK---LNVA-MGDRNPQIRALR
A0A1G7JVV8      LQA------------SGAGQESELSKLRDDAAQTKAQIAQ---SSVS-LGPKNPQILALQ
A0A1H4T6W9      LDV------------AGG--QSELSKLRSDAAETQASIAE---LSIT-LGPKNPKIVALQ
I3ZEU5          LDV------------AGG--QSELSKLRSDAAETQASIAE---LSIT-LGAKNPKIIALR
A0A428MDU2      IET------------TPGTAPGELNLLRGQVASAKANYAQ---MEST-LGPNHPQAQALK
A0A239HDF6      IDA------------GPGLPPSGLNALRTQLSTARSTYAE---QEAT-LGPNHPQAKSTK
A0A1Q3QQB6      IDA------------APGAAPQELTQLRTQLATARASYAQ---MQAT-LGPNHPQAKALR
A0A3N1K1G7      IET------------TPGTAPGELNTLRAQIAVARASYAQ---LEAT-MGPNHPQAKAQK
A0A2W0BGU4      VPAIANNEV--------------MQKLEENYANLRGQYVE---ALNQ-YGPNYPKVLRLD
A0A2W0BVQ9      VPAIANNEV--------------MQKLEENYANLRGQYVE---ALNQ-YGPNYPKVLRLD
A0A3D1ASD2      ALISSQGQS--------------LKKLTEAYDEAQSRLAD---VKLH-YGINHPEYRKAQ
A0A2N9MK30      AQASTQGDA--------------LKTIAERLEQAQEKFAE---VKTH-YGPNHPEFHKAQ
A0A2V9MN96      FAKLSADNL--------------LEKLRVQQAELETQYAQ---ATTQ-FGPSYPEVIQLR
E8UZE1          IVPTTTFPG--------------LTSLRAQKITLESQYAS---LSSK-YGDSYPRVAQIK
A0A2V7V2Z1      LPEVMRSPL--------------VQSLRIELAGLERQQAQ---LLER-YMDQHPEVVKVR
A0A2V7X2F7      LPEVRKDSV--------------VQQLRMDLSTLEQKQTQ---LLEQ-YLDQHPEVIKVR
A0A2V7V2I1      LPEVMRNPL--------------IGSLRVELASLQRQSVQ---LQER-YLDQHPEVVKNR
A0A2V7U3M2      LPDVMRSPL--------------VQALRIELATLERSQAQ---LLER-YMDQHPEVVKVR
A0A2V7UHT0      LPEVMRNPL--------------VQSVRIELASLERAQAQ---LLER-YMDQHPEVVKVR
A0A2Z5FVL3      IMGLPSNTALAGAASGMSNDLAVISSLRTREATLNGQINE---LLAK-FGPAYPKVDELK
A0A1V6HR88      AAEILPDPV--------------VAQLRGEVVEMEREYAS---RLAT-FKPEWPAMVELK
A0A3E0P0A3      LAETLSGGL--------------VSSQRAELIRLQREYDT---KLET-YRPDFPTMVELK
A0A2V9KBD6      LAKLEPGSL--------------LTTLRAQQDDLERQNAQ---ASVQ-LGPTNPKMAELS
A0A2W0AJ66      IAKSEPDNL--------------VTKLRAQEADLQMQLAQ---ASVQ-LGPTHPKIRELS
A0A1Q7RBU1      IAKLEPDNL--------------ITKLRAQQADLENQMAQ---ASVQ-LGPAHPKMGELS
A0A2V9JPV9      IAKLGPDNL--------------ITKLRAQQADLENQMAQ---ASVQ-LGPANPKISELS
A0A2V8EXP2      FPAILSNQF--------------IQQQKGELAELQRQQAQ---LSEK-LGPRHPDMVKIG
A0A2W4RYA1      FPAVLNNQL--------------VQQQKLELAALNQKKAQ---LSET-FGDRHPEIVAIN
G8P0Y7          LSVILQDPI--------------LSALRQRQSELQTRYAQ---LDTW-AGQSYPQMREIT
A0A3D4VGU2      LVSVAPNTV--------------LTSLRSQEANLLVQQAD---LQSR-FGPRYPKLEEVR
C1F294          LVSVAPNTV--------------LTSLRSQEANLLVQQAD---LQSR-FGPRYPKLEEVR
A0A3P0X3W6      IDISTQAEQ--------------LTRLQQQMQDAEQAMAI---VQTH-YGPNNANYKVAA
A0A1E3Y9R6      FPPVLASPV--------------VQKLRADIVAKESERAR---LGTQ-YGPAYPAMRDLA
A0A2W4TLP2      YPAIMNSPV--------------VQALRADIAAKEAERAR---LGTQ-YGPAYPAMRELA
A0A3R9WF43      SMSIASGNGSSSGALTADGGVDLLRSLRTQEASLRREYAS---YATK-YGEKNPRLLQLQ
A0A317HKM4      LPAIAANPF--------------IQTLKGELTTSERELGQ---ASKE-LGEHHPTIIKLR
A0A2W0C122      IGENKSGEA--------------LQSLRLREAELKNEYAQ---ATTT-YGPNHPKVIELT
A0A2W0AUU7      LSESKSGDA--------------LQSLYLREAELKNEYAQ---ATTT-YGPNHPKVLELT
A0A2W0BQL1      LSESKSGDA--------------LQSLYLREAELKNEYAQ---ATTT-YGPNHPKVLELT
A0A3P0XH15      LLSVAPSAT--------------LSQLQQQAAALTVQQAQ---LQSK-FGPEWPRVKEVQ
A0A3M1WQW8      LPPVMSNPI--------------VQTLRQRLADDRRRLVK---LQQQ-YTDEWPEIQSLK
A0A3N1JHC1      LPQVADDPT--------------MRDDRAKLTELHRQLAE---MSTT-MTPSNYKVQKVE
A0A2V9KA79      NRAVVEEAS----------------AVQKKLEDLRLELKG---LQARGYTENHPEVIRLR
G8P085          LAAMFPSAN--------------LAALQSQQATLYGQYVQ---LSTK-FGQNYPPLAQVK
Q1ILD9          IGMLVPDSV--------------LPVLRTQEADIQNQLSQ---ATAI-YGPNYPRVVELK
Q1IJZ6          LTSLGAESLTSPTDQAQAAMFTNLQALRQRQSQLKQQMAS---AVQI-YGARNPHLVDVD
A0A2V8TCE6      LPAVVENPT--------------VQRLQHEVNDLEIQRAE---LLRT-FKPGWPQVEVLT
Q1ITG0          IGTILPDSV--------------LPVLRSQEADLRNQLAQ---YSTK-FGSNYPKVIQLN
A0A3N5PCI5      FPLIRSNGV--------------VQEIRGRLANLQRERMQ---LASN-LGAKHPEMVRVN
A0A3M1Q0S9      IDEVRQHPT--------------IAQLSAEVARLERDYAN---KRVL-LGERHPDVQQIA
A0A3M1VZ38      LQEVLENPV--------------VRELRSRVSALESEYRE---KLVQ-LGEKHPEVQTVK
A0A3M1PY35      IEAVRSDPL--------------VVRLREELASREQRLEE---LRTR-FGPDWPEVRELS
A0A3M1VMP2      IPEVNANPQ--------------VQRYRQDLAELRRELAE---LEGK-VGPNWPRLVELR
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      QQIELTQK---------------R------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      KQVVQIQK---------------A--------------------------KEERAA----
A0A2V8JK38      SQIEEIQK---------------Q--------------------------IEGERG----
A0A2V9IXG5      TELDNLRK---------------Q--------------------------LRNELV----
A0A2V9J2P4      TELDNLRK---------------Q--------------------------LRNELV----
A0A192WQ77      AELATVDR---------------K--------------------------IAARID----
A0A1Q7RLS4      KEIEETTQ---------------K--------------------------IASEVD----
A0A2V2R525      EQIAEIEK-----------QDVEN--------------------------KTNSKS----
A0A321LPW6      KQMAEIDN---------------Q--------------------------IRASRA----
A0A2V9R9V4      QQMAAIRD---------------Q--------------------------IAAGRV----
A0A321LE75      NQMVTIQE---------------Q--------------------------INRSRG----
A0A2V8R8U7      AQIDELEK---------------E--------------------------LKKAPQ----
A0A2V8QMP4      KQLKSLHE---------------Q--------------------------LDKMPD----
A0A2V8R4S3      KQLKSLHE---------------Q--------------------------LDKMPD----
A0A2V8NJ55      DEIKQVKS---------------E--------------------------LDKKPA----
A0A2V8Q7I0      AAIKPLEA---------------E--------------------------LDRAAD----
A0A2V8S6K4      AQIKQTED---------------A--------------------------QQKIAK----
A0A317I2L9      ASLKPLEA---------------E--------------------------LQAAAA----
A0A2V8LLF9      AQLEPLKK---------------Q--------------------------LIAAPK----
A0A352FRF4      AQIAQLEV---------------E--------------------------LKKAPT----
A0A2V8MKV0      AQIKPLEQ---------------A--------------------------LEAAKR----
A0A2V8PYY8      AQIKPLEQ---------------A--------------------------LEAAKR----
A0A1Q7YKQ8      EQIKTIEE---------------A--------------------------LTKAPG----
A0A352F3R7      AQLKGLEA---------------E--------------------------LAKAPP----
A0A0B6WXT1      EQIKRLKQ---------------D--------------------------LDKAPY----
A0A3B9MEU8      AQLKGLEA---------------E--------------------------LAKAPP----
A0A2V8MHG6      QQIAMLEK-----------QAEQS--------------------------RAHTES----
A0A2V8P7N1      QQIAMLEK-----------QVDQS--------------------------RRHTES----
A0A2V8M3M6      QQIAMLEK-----------QVDQS--------------------------RRHTES----
A0A1Q7NJH5      QQIAMLEK-----------QVDQV--------------------------RTHTES----
A0A2V8PJY0      QQIAMLEK-----------QVDQV--------------------------RTHTES----
A0A1Q7Y6W9      QQIAEIER-----------QLKEA--------------------------KSHAAN----
A0A2V8NC68      EEIALLEK-----------QTKEG--------------------------KTHATS----
A0A399WK13      AQITSYQNSIDNAVQKFQNDLDKY--------------------------RDSTKK----
A0A352FLX4      KQIAAIEK-----------VMGDA--------------------------RRRATG----
A0A2V8RTL7      KQIASLEDSLEKLLEKNNKDIQAY--------------------------KERSAT----
A0A3E0PCJ6      REIATLMNEIADFRDKNDKALQQY--------------------------RKTVGE----
A0A3M1S4R8      RKMEALKSTVEKAQEKNREELEKY--------------------------RARTAK----
A0A1Q7YFI6      RQIAILEA-----------QVNQS--------------------------HSEDVS----
A0A136KC10      AQITSYQNSIDNAVQKFQGDLEKY--------------------------REATKK----
A0A2V8SEX6      TQIRSLEDSLTKLVDENTTEVQKL--------------------------QERASK----
A0A3M2D6Y5      RKIDALKRTVEVAQEKNRKDLEEY--------------------------RSRTAK----
A0A0B6WWQ6      EQIAELER-----------QINEA--------------------------RARAKD----
A0A3B9MK99      QQIAELER-----------QVKDV--------------------------RSRKSV----
A0A352EX26      QQIAELER-----------QVNDS--------------------------RNRKTN----
A0A2V8MM59      QQIAELQK-----------HLGET--------------------------RSRSTS----
A0A2V8PFE8      QQIAELQK-----------HLHES--------------------------RARNTN----
A0A2V8PWS6      QQIVELQK-----------HLNES--------------------------RARNTN----
A0A2V8LCT5      QQIDVIQK-----------HLVET--------------------------RSRSTA----
A0A352FTJ9      QQIDVLQK-----------HLADT--------------------------RARGTA----
A0A2V8G155      SAIQISQA---------------K--------------------------LSGEIS----
A0A2V8HDM7      SAVQISQA---------------K--------------------------LSGEIS----
A0A2V8DRT9      LNVQNAEA---------------R--------------------------IQAEIN----
A0A2V7VYF3      SAVDTALA---------------K--------------------------LNTEID----
A0A1F2SVH2      SAVREAES---------------K--------------------------IQGEIA----
A0A2V8AJG9      NAIQLAES---------------K--------------------------LQGEIA----
A0A2G6PYV5      AEIKSMEK---------------R--------------------------LANEQK----
A0A2V8F956      SAIRLTQA---------------K--------------------------LDGEIG----
A0A1F2S1W5      TAIQLAET---------------R--------------------------LQAEVA----
A0A1F2T595      VALRGAET---------------R--------------------------LQNEIA----
A0A2V8JQV5      AQMGELET---------------A--------------------------FERERA----
A0A2V9AC41      VRMEETRR---------------R--------------------------LQAEIQ----
A0A2V8K4L4      AQITELET---------------A--------------------------LEAARQ----
A0A2V8NCZ3      AQIAEMET---------------A--------------------------LEDARQ----
A0A2V9MAM9      AQITALES---------------A--------------------------LAKERE----
A0A2V9M454      DQIKDLQA---------------L--------------------------VVRERK----
A0A2V9IVR7      DQAEEIRS---------------S--------------------------LEAERK----
A0A2V9ILE2      DQAEEIRS---------------S--------------------------LEAERK----
A0A2V9LGY4      DQAEEIRS---------------S--------------------------LEAERK----
A0A2V9J4D6      QQIDEVQL---------------L--------------------------IQQERH----
A0A2V9L9C5      QQIDEVQL---------------L--------------------------IQQERH----
A0A2N9M9N1      NQINEVEE---------------L--------------------------IDRERK----
A0A2V9JEC4      KQLAEVES---------------L--------------------------INRQRM----
A0A2V9LPQ3      GQVAQMQS---------------L--------------------------IEQEQK----
A0A348V070      SEIEATYD---------------S--------------------------LTREKE----
A0A2Z5G3A3      SNLQVIQA---------------A--------------------------IASEVA----
A0A2V7UGP8      AEWDSARK---------------T--------------------------MAEESQ----
A0A239MKT6      NQLNSIDA---------------Q--------------------------VHEQMV----
A0A3E0PCN7      RKIAAVEN---------------E--------------------------LKGTRK----
A0A2V8IYW3      RRVAQLEA---------------ERVAMPKASDAPASAAAPQVADNVVVRRMRETQ----
G2LEI9          QVLAQAEN---------------E--------------------------LKEAKA----
A0A317J121      VQINELQI---------------T--------------------------LNKEVT----
A0A2V7YW66      AEIEKSQQ---------------H--------------------------INDVVK----
A0A2V7Z0V0      ADIEKARQ---------------H--------------------------LNEVLG----
A0A2V8GFD4      ASLQSADA---------------K--------------------------LQAEIA----
A0A2V8HSS5      ASLQSADA---------------K--------------------------LQAEIA----
A0A2V8KP55      SQIEEIQK---------------Q--------------------------IEGERG----
A0A399WNU1      KQIAGIEK---------------E--------------------------LQSNRK----
A0A2V9CG11      AQIAELQS---------------A--------------------------VKNQRT----
A0A2V2R0I6      AQLKDLDA---------------T--------------------------IEKEKQ----
A0A2V8XAR9      AQLKDLDA---------------N--------------------------IEKEKK----
A0A2V8VZA0      AQLKEFDQ---------------T--------------------------IEKEKQ----
A0A1Q7CB82      AQLKEFDQ---------------T--------------------------IEKEKQ----
A0A2V8WIU1      AQLKEFDQ---------------T--------------------------IEKEKQ----
A0A1Q6Y9F5      AQIKEFDQ---------------T--------------------------IEKEKQ----
A0A2V9EVV8      AQIKEFDQ---------------T--------------------------IEKEKQ----
A0A2V8YF91      AQLKEIDE---------------N--------------------------IQGEKR----
A0A2V8XZK2      TELKDIED---------------S--------------------------IEKEKR----
A0A2V8ZTX6      AQLKDIDD---------------N--------------------------IEKEKQ----
A0A2V9BT79      AQLKDIDD---------------N--------------------------IEKEKR----
A0A1Q8B793      EQLKEFDG---------------L--------------------------IDAEKK----
A0A2V9BCA0      EQLKEFDG---------------L--------------------------IDAEKK----
A0A2V9BWU9      AQLKEIEH---------------L--------------------------IAREKA----
A0A2V9DKX2      AQLKEIEH---------------L--------------------------IAREKA----
A0A2V9JSI3      DQVNEIQG---------------F--------------------------IERERK----
A0A2V9WI32      NQLKQVEA---------------S--------------------------IQAEDE----
A0A2V8IVN9      SAIQLAQA---------------R--------------------------LDGEIG----
A0A1F2TPT3      ETIQATQA---------------K--------------------------LDVERS----
A0A2V8JTQ2      KQLAQVRR---------------S--------------------------VDAEVK----
A0A2V8UZY0      KQLDQARR---------------S--------------------------VDAEVN----
A0A3N5YNR8      QQIQEVEK---------------Q--------------------------LQREKK----
A0A350UEK1      AQVASLEK---------------S--------------------------LEVERA----
A0A350UIQ4      AQISSLEK---------------S--------------------------LANERD----
A0A3N6A5T6      REVNEVNT---------------Q--------------------------LVREKK----
A0A1F2Q9L4      AQIDKGRQ---------------H--------------------------LGNVTK----
A0A1H5SQF5      SELAELQR---------------Q--------------------------TNEEIS----
A0A2Z5G448      KQLTAVQT---------------D--------------------------IDAEIS----
A0A3E0NV31      SELAELRR---------------D--------------------------LSAAGG----
A0A3N5M5V0      QQIREVEQ---------------Q--------------------------LVREKR----
A0A2V9AEW6      AQIDELKA---------------Q--------------------------IEKERG----
A0A2V8WQK6      AQITELRS---------------E--------------------------MQKERA----
A0A2V8XIF4      AQINDLKA---------------E--------------------------MQRERN----
A0A3N5XQP8      RQITQGEQ---------------E--------------------------LKQERE----
A0A2Z5G7H4      ANLSGMES---------------A--------------------------IEDEVH----
A0A2V9KCS3      AQIASVQS---------------A--------------------------LERERV----
A0A2U3KC61      NQLKQVRT---------------E--------------------------IVAEET----
A0A2V9Y2R7      NQLQEVRS---------------G--------------------------ISVEQT----
A0A372IT17      AQLTEIQK---------------S--------------------------IHDEVR----
A0A136JPP4      EKIASLKT---------------T--------------------------KQQTET----
A0A399WUJ8      EKIVSLKN---------------T--------------------------KQQTES----
A0A2V9L5B5      KQIDALQA---------------E--------------------------LDKQKK----
A0A2V9L7I0      KQIDALQA---------------E--------------------------IDRQKK----
A0A2V9LK56      KQIDLLQS---------------I--------------------------LGKDKR----
A0A2V9YHT3      NQLKQVQE---------------T--------------------------IQGETR----
A0A2V9NGH6      SQLQEVES---------------Q--------------------------IQLEMK----
A0A2V9PYE6      SQLQEVES---------------Q--------------------------IQLEMK----
A0A2V9NL07      NQLQEIDS---------------Q--------------------------IQGETK----
A0A2V9QD92      NQLQEIDS---------------Q--------------------------IQGETK----
A0A2V9WPZ6      NQLKEIDI---------------Q--------------------------IQGEMK----
A0A2V9ZLH4      NQLKEIDV---------------Q--------------------------IQSEIR----
A0A2V9RQF1      NQLKEVEA---------------Q--------------------------TQVEMK----
A0A2V9YDK8      NQLKEIVA---------------Q--------------------------IQAETK----
A0A2V9V8F7      NQLKEIDI---------------Q--------------------------IQGEMK----
A0A2V9XGR9      NQLKEIDI---------------Q--------------------------IQGEMK----
A0A2V9V3Q5      SQLKEIEN---------------Q--------------------------IQVETR----
A0A2V9NWS3      GQLKEVDA---------------Q--------------------------LQAEMK----
A0A2V9USA9      NQLKEIDT---------------Q--------------------------IQGEMK----
A0A2V9XW18      NQLKEIDS---------------Q--------------------------IQGEMK----
A0A3M2BZG9      EELEGKRA---------------K--------------------------LTALVS----
A0A1Q7N5R7      SEIETLER---------------T--------------------------TIPALA----
A0A3M1SIV3      ATIQKLQE---------------G--------------------------KEKIRQ----
A0A3E0PHB0      SLIASLKE---------------Q--------------------------KNQLED----
A0A3M2D491      AQIQQLRE---------------T--------------------------KEKVKN----
A0A357F267      ERIAALQE---------------T--------------------------RAKTET----
A0A353C9L6      AKIASLKE---------------T--------------------------KDKTER----
A0A2V8RQV0      AKIASLRE---------------T--------------------------KEKTEK----
A0A2V8SJH5      ERIASLKA---------------T--------------------------KDRTES----
A0A2V9QB26      AQIALLEA---------------A--------------------------LQKEQA----
A0A2V9VYY4      NQLKQVRA---------------A--------------------------IEAEKT----
A0A2V9KIE8      KQIDVLEA---------------R--------------------------ITAQKQ----
A0A352F549      QQIATLEK---------------Q--------------------------LADTRG----
A0A3B9MLP9      QQIAILEK---------------Q--------------------------LDETRG----
A0A3D5SQ87      QQIAILEK---------------Q--------------------------LDETRG----
A0A2V8NW86      AQIASLEA---------------A--------------------------LQKERT----
A0A2V8ZHL8      SQVDEVQS---------------L--------------------------IDTERK----
A0A2V9B240      SQVDEIQS---------------L--------------------------IDTERK----
A0A2V9CBM2      SQITDVEA---------------S--------------------------LQQERK----
A0A2V8XN17      SQIDEIEA---------------S--------------------------LRDERQ----
A0A2V8WX45      SQIDEIEG---------------S--------------------------LQVERK----
A0A1Q6YR79      SQVDEIES---------------S--------------------------LREERQ----
A0A1Q7VA32      SQVDEIES---------------S--------------------------LREERQ----
A0A2V9EY85      SQIDEIES---------------S--------------------------LREERQ----
A0A2V9H8K0      SQIDEIAA---------------S--------------------------LREERQ----
A0A2V9FFE5      SQIDEIAA---------------S--------------------------LREERQ----
A0A2V9GM43      SQIDEIAA---------------S--------------------------LREERQ----
A0A1F2RFI7      NQIEEIER---------------T--------------------------VQRERG----
A0A1F2RZS3      SQIDQTAA---------------A--------------------------LDRERQ----
A0A1F2USE2      NQIQEVQG---------------L--------------------------LGQEQD----
A0A2V9C238      SQINELDA---------------A--------------------------LARERG----
A0A1F2Q9F5      NQIDEIER---------------L--------------------------LAQERA----
A0A1F2QQH9      NQIDEIER---------------L--------------------------LAQERA----
A0A1F2QXK7      NQIDEIER---------------L--------------------------LAQERA----
A0A2V9DEM9      SQINELDA---------------T--------------------------LARERG----
A0A2V9CYQ5      SQITDVEA---------------S--------------------------LQQERK----
A0A2V9BWU8      SQIDEIEA---------------T--------------------------LREERQ----
A0A2V8ZG48      SQINEIEA---------------T--------------------------LKEERQ----
A0A2V8Y334      SQIDEIEG---------------T--------------------------LKEERQ----
A0A2V9AY68      SQIDEIEA---------------A--------------------------LKDERK----
A0A257VBK0      EEIRGLKE---------------R--------------------------ISQQAE----
A0A2V7XDY0      LQLDQAQK---------------T--------------------------KERQGT----
A0A350UQT3      AQLREIQS---------------Q--------------------------VDATRD----
A0A2U3JZ71      LQLAELER---------------Q--------------------------LQSGKE----
A0A2V8TTB0      TKVQELET---------------Q--------------------------IADTGA----
A0A1F2TCR2      AQIAIAKK---------------D--------------------------LIAQRQ----
A0A2N9LQU7      AQLARLDQ---------------N--------------------------IADELT----
A0A2P6WFK7      TQLSKLNA---------------A--------------------------IADEVA----
A0A1F2V330      REIKELEK---------------A--------------------------VAAAPP----
A0A2V8U914      AQIVQLEA---------------A--------------------------IARESR----
A0A2V7W309      QQIEKTKL---------------A--------------------------RAAAVR----
A0A2V8TLH7      SEIDKTNQ---------------K--------------------------LASEVD----
A0A1Q7ZJT1      KEIEETTQ---------------K--------------------------IASEVD----
A0A2V8VC99      KEIDEISR---------------K--------------------------IASEVD----
A0A348UZU3      AELDTARE---------------L--------------------------LKNETQ----
Q01XL7          AQISELQQ---------------T--------------------------LDKEKT----
A0A2V8ERZ5      AALQDAQR---------------Q--------------------------LDLEIA----
A0A2V8GTX0      GQIQDAQR---------------Q--------------------------LDAEIE----
A0A2V8J0X9      DQIENAKR---------------R--------------------------LVAERT----
A0A372IRG7      RQLGSVRS---------------D--------------------------IQTEIT----
A0A1F2U158      ARLGDEQR---------------Q--------------------------LDLETA----
A0A2V8F6S9      TDLAEGQK---------------Q--------------------------YEFEVA----
A0A1I6MH75      NEIKELDA---------------Q--------------------------LAAEQK----
E8WVF6          AQIDEFQH---------------A--------------------------VEAEQN----
A0A1H5Z7N3      AQVDTLNQ---------------E--------------------------IRAEQD----
A0A1G7JVV8      AHLREVDR---------------E--------------------------IKTEET----
A0A1H4T6W9      AHQREIQR---------------E--------------------------LRSEEN----
I3ZEU5          AHQREVQR---------------E--------------------------VQAEEN----
A0A428MDU2      AQIDELEK---------------E--------------------------IDAEQK----
A0A239HDF6      AQIDELAR---------------Q--------------------------VAAEQN----
A0A1Q3QQB6      AQIDELSK---------------E--------------------------VTKEQN----
A0A3N1K1G7      AQIDELAK---------------E--------------------------IDAEQS----
A0A2W0BGU4      KQVKEASA---------------L--------------------------IAAERG----
A0A2W0BVQ9      KQVKEASA---------------L--------------------------IAAERG----
A0A3D1ASD2      GQVAELDR---------------Q--------------------------LQTAKT----
A0A2N9MK30      TQLDQVQA---------------Q--------------------------FDATRG----
A0A2V9MN96      SQLNQVRN---------------S--------------------------IATEQK----
E8UZE1          SELAEVNR---------------T--------------------------ITTELR----
A0A2V7V2Z1      NQIQETRK---------------K--------------------------IAAESQ----
A0A2V7X2F7      RQIEDTRK---------------R--------------------------LSAEGQ----
A0A2V7V2I1      NQITETRE---------------K--------------------------IASEAQ----
A0A2V7U3M2      NQIQETRK---------------K--------------------------IAAESQ----
A0A2V7UHT0      NQIQETRK---------------K--------------------------IAAESQ----
A0A2Z5FVL3      ADLTAIQN---------------S--------------------------IKEEIQ----
A0A1V6HR88      GRIDQARG---------------N--------------------------LIPAAR----
A0A3E0P0A3      TQIDEARR---------------Q--------------------------LNQLIE----
A0A2V9KBD6      SQLSQVRS---------------S--------------------------IDAEVK----
A0A2W0AJ66      NQLAQTRR---------------S--------------------------IRSEVK----
A0A1Q7RBU1      NQLAQAQR---------------S--------------------------VDAEVR----
A0A2V9JPV9      KQLAQARQ---------------S--------------------------VDVEVR----
A0A2V8EXP2      LAINAAEE---------------R--------------------------IQGEIA----
A0A2W4RYA1      RAIELAQQ---------------K--------------------------LDTEIQ----
G8P0Y7          SQLDQLNK---------------S--------------------------INEQVK----
A0A3D4VGU2      QQLKQVRS---------------D--------------------------INKEIT----
C1F294          QQLKQVRS---------------D--------------------------INKEIT----
A0A3P0X3W6      NTLAEVTR---------------E--------------------------YQAARD----
A0A1E3Y9R6      SQIEAANR---------------D--------------------------LDLEID----
A0A2W4TLP2      TQIERARR---------------D--------------------------LETEVS----
A0A3R9WF43      EQINAVDA---------------Q--------------------------MQTEMA----
A0A317HKM4      EAVQNADR---------------K--------------------------LQAEIA----
A0A2W0C122      NRINAINL---------------S--------------------------IQTELK----
A0A2W0AUU7      NRIKAMDT---------------S--------------------------IQTELK----
A0A2W0BQL1      NRIKAMDT---------------S--------------------------IQTELK----
A0A3P0XH15      GSLVQVRK---------------A--------------------------IDVEIN----
A0A3M1WQW8      GEIAETEQ---------------Q--------------------------LAEIEK----
A0A3N1JHC1      SQIKELEE---------------E--------------------------MQRHRF----
A0A2V9KA79      RQIQEFEA---------------S--------------------------ASAQAPVEGP
G8P085          DQMQKTDA---------------E--------------------------LERQSS----
Q1ILD9          KQLAQVNA---------------S--------------------------LAKETR----
Q1IJZ6          KQLSDVDS---------------Q--------------------------IKGELK----
A0A2V8TCE6      RKLEGARQ---------------Q--------------------------LSSETEA---
Q1ITG0          NQLAQTDA---------------S--------------------------LKKEIR----
A0A3N5PCI5      SAIEAAER---------------E--------------------------LDSEVA----
A0A3M1Q0S9      TELAAGRE---------------R--------------------------LASETER---
A0A3M1VZ38      AKLDSSRE---------------H--------------------------LQEQIAA---
A0A3M1PY35      RAIAEARV---------------R--------------------------LAERAAA---
A0A3M1VMP2      AAVKETER---------------N--------------------------LENEMEA---
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      --------------------------------SR-------------------LDELKSL
A0A399Y5V2      --------------------------------NR-------------------REQAAAV
Q01X01          --------------------------------RR-------------------ANEAS--
A0A2V7VMF7      ---------------------QIADGLQ----AE-------------------FAQLQKR
A0A2V8JK38      ---------------------RIVKTFE----VE-------------------YSAATER
A0A2V9IXG5      ---------------------KYADGMR----VS-------------------VSVLRNR
A0A2V9J2P4      ---------------------KYADGMR----VS-------------------VSVLRNR
A0A192WQ77      ---------------------EVVSGLR----SE-------------------YGLKRDQ
A0A1Q7RLS4      ---------------------RIINGLR----SQ-------------------YDLLKDR
A0A2V2R525      ---------------------LAVKGLE----TK-------------------FREAQRR
A0A321LPW6      ---------------------SLEARLR----AD-------------------YERSARD
A0A2V9R9V4      ---------------------QLEEKLK----AD-------------------YERVVRD
A0A321LE75      ---------------------DLEARLK----AE-------------------YERAIRD
A0A2V8R8U7      ---------------------EVLASMK----SR-------------------ADAAEAH
A0A2V8QMP4      ---------------------EIIAGLE----NR-------------------YEAAVKN
A0A2V8R4S3      ---------------------EIIAGLE----NR-------------------YEAAIKN
A0A2V8NJ55      ---------------------EIINSLK----LR-------------------YETALAT
A0A2V8Q7I0      ---------------------EIIARLK----SE-------------------YQESYAH
A0A2V8S6K4      ---------------------AIVIGMG----AS-------------------LDGAKKR
A0A317I2L9      ---------------------EAIQGLK----AQ-------------------YEAALAH
A0A2V8LLF9      ---------------------EVLAGLK----SR-------------------RDSAIAH
A0A352FRF4      ---------------------EVLASMK----AK-------------------SDAATTQ
A0A2V8MKV0      ---------------------QILVSME----SR-------------------YKAAEAT
A0A2V8PYY8      ---------------------QILASME----SR-------------------YKAAEAT
A0A1Q7YKQ8      ---------------------EVLATMK----SK-------------------YDAAVTT
A0A352F3R7      ---------------------EIVTSIQ----RR-------------------YEAAVSR
A0A0B6WXT1      ---------------------EVIKAMR----SR-------------------YEAALAR
A0A3B9MEU8      ---------------------EIVTSIQ----RR-------------------YEAAVSR
A0A2V8MHG6      ---------------------VVKTNLE----TR-------------------YRQALQK
A0A2V8P7N1      ---------------------MVKTNLE----TS-------------------YRQALQK
A0A2V8M3M6      ---------------------VVKTNLE----TS-------------------YRQALQK
A0A1Q7NJH5      ---------------------VVKTNLE----TS-------------------YRQALQK
A0A2V8PJY0      ---------------------VVKTNLE----TS-------------------YRQALQK
A0A1Q7Y6W9      ---------------------ILTTNLK----TN-------------------YLQAKAQ
A0A2V8NC68      ---------------------VAITNLE----TS-------------------YRQAMAR
A0A399WK13      ---------------------TLLYNLQ----TK-------------------YLQAKAN
A0A352FLX4      ---------------------VVTTNLA----TR-------------------YRQALAT
A0A2V8RTL7      ---------------------ILLENYK----TQ-------------------YQQAKDQ
A0A3E0PCJ6      ---------------------TILENLK----TR-------------------YLQTKER
A0A3M1S4R8      ---------------------EILTNLQ----TR-------------------YEQAKAQ
A0A1Q7YFI6      ---------------------TLKTNLE----TR-------------------YHQALAR
A0A136KC10      ---------------------TLLYNLQ----TK-------------------YLQAKAN
A0A2V8SEX6      ---------------------LLVDNLR----TK-------------------YLQTKNE
A0A3M2D6Y5      ---------------------EILTNLQ----TK-------------------YEQAKAQ
A0A0B6WWQ6      ---------------------VMLTNLR----TR-------------------YRQALAR
A0A3B9MK99      ---------------------TLLTNLE----TD-------------------YRQTLAR
A0A352EX26      ---------------------TLLTNLE----TQ-------------------YRQTLGR
A0A2V8MM59      ---------------------VLLTNLE----TR-------------------YRQTLAR
A0A2V8PFE8      ---------------------TLLTNLE----TK-------------------YRQSLAR
A0A2V8PWS6      ---------------------TLLTNLE----TK-------------------YRQALAR
A0A2V8LCT5      ---------------------TLLTNLE----TK-------------------YRQAAER
A0A352FTJ9      ---------------------TLLKNLE----TK-------------------YRQAADR
A0A2V8G155      ---------------------KVVDSVK----TD-------------------YLAAVAQ
A0A2V8HDM7      ---------------------KVVDSVK----TD-------------------YLAAVAQ
A0A2V8DRT9      ---------------------KVVHALS----ND-------------------YQAALAQ
A0A2V7VYF3      ---------------------KVVESVH----NE-------------------YLTALAR
A0A1F2SVH2      ---------------------KVVQAMR----ND-------------------YRQTVAQ
A0A2V8AJG9      ---------------------KVVQSVK----NE-------------------YQAALIQ
A0A2G6PYV5      ---------------------KLYNRLIQSISKDVQDRKNELA----------YLEAQRK
A0A2V8F956      ---------------------KVVQGVK----NE-------------------YLAALAK
A0A1F2S1W5      ---------------------QVLQAMR----ND-------------------YEAALTE
A0A1F2T595      ---------------------QIAQAIR----SE-------------------YEAALAE
A0A2V8JQV5      ---------------------NILRGIA----NQ-------------------YEDAKRR
A0A2V9AC41      ---------------------NEVKRIE----VT-------------------YTAAKNN
A0A2V8K4L4      ---------------------KVVTRLR----ND-------------------YAAAESH
A0A2V8NCZ3      ---------------------KVVTRLN----ND-------------------YAAAQSH
A0A2V9MAM9      ---------------------ETRQRLR----ND-------------------YLTARRR
A0A2V9M454      ---------------------RVVDNLH----ND-------------------YLAAVER
A0A2V9IVR7      ---------------------RIVERYH----GE-------------------YVAAQQR
A0A2V9ILE2      ---------------------RIVERYH----GE-------------------YVAAQQR
A0A2V9LGY4      ---------------------RIVERYH----GE-------------------YVAAQQR
A0A2V9J4D6      ---------------------RVVERIQ----RD-------------------YEAAVER
A0A2V9L9C5      ---------------------RVVERIQ----RD-------------------YEAAVER
A0A2N9M9N1      ---------------------RIMERIE----SD-------------------YRTAVRR
A0A2V9JEC4      ---------------------RLVKQTK----DA-------------------YDTAVRR
A0A2V9LPQ3      ---------------------RTVERIQ----ND-------------------YRAASTR
A0A348V070      ---------------------NLIKTAY----AE-------------------YQGALAK
A0A2Z5G3A3      ---------------------RMGARAE----ND-------------------FKVAKTA
A0A2V7UGP8      ---------------------KIFDDTLKTAKME-------------------YEEASAH
A0A239MKT6      ---------------------RLNSETR----SS-------------------YLLAKAD
A0A3E0PCN7      ---------------------LSADVQLSDLQRQ-------------------FREASSR
A0A2V8IYW3      ---------------------TEIDKLD----RQ-------------------IAGKEAD
G2LEI9          ---------------------NTLVRIK----TA-------------------YENAKRR
A0A317J121      ---------------------AEIQRIK----ND-------------------YDVALRR
A0A2V7YW66      ---------------------ELTEKARNAAAAS-------------------YQTALRQ
A0A2V7Z0V0      ---------------------EQVDKAKSNSLAA-------------------YQTAQRQ
A0A2V8GFD4      ---------------------KIAESVR----TE-------------------YLAAAAQ
A0A2V8HSS5      ---------------------KIAESVR----TE-------------------YLAAAAQ
A0A2V8KP55      ---------------------RIVKTFE----VE-------------------YSAATER
A0A399WNU1      ---------------------RSADTQIASLLQT-------------------YREAASR
A0A2V9CG11      ---------------------LILRRIG----SE-------------------YSAARQR
A0A2V2R0I6      ---------------------NILNGLE----AD-------------------YREARQH
A0A2V8XAR9      ---------------------KIVDVLE----SD-------------------YREARQR
A0A2V8VZA0      ---------------------KILDVLE----SD-------------------YHEAQQR
A0A1Q7CB82      ---------------------KILDVLE----SD-------------------YHEAQQR
A0A2V8WIU1      ---------------------KILDVLE----SD-------------------YHEAQQR
A0A1Q6Y9F5      ---------------------NILNVLE----SD-------------------YHEAQQR
A0A2V9EVV8      ---------------------KILDVLE----SD-------------------YHEAQQR
A0A2V8YF91      ---------------------GILDALE----SD-------------------YREARQR
A0A2V8XZK2      ---------------------KVLEVLE----SD-------------------YREARQR
A0A2V8ZTX6      ---------------------KILDVLE----SE-------------------YREARQR
A0A2V9BT79      ---------------------KILEVLE----SD-------------------YREARQR
A0A1Q8B793      ---------------------NIVTSIE----NE-------------------YRAARQR
A0A2V9BCA0      ---------------------NIVTSIE----NE-------------------YRAARQR
A0A2V9BWU9      ---------------------NIINRIE----AE-------------------YHTARQR
A0A2V9DKX2      ---------------------NIVNRIE----AE-------------------YHTARQR
A0A2V9JSI3      ---------------------RIAGRVR----ND-------------------YRAAMGR
A0A2V9WI32      ---------------------RIASRVQ----NE-------------------YLSALQR
A0A2V8IVN9      ---------------------KVVQSVK----NE-------------------YLGSLAK
A0A1F2TPT3      ---------------------RVLEAMR----ED-------------------LGVSRAA
A0A2V8JTQ2      ---------------------GIGERIT----YE-------------------YQTAAER
A0A2V8UZY0      ---------------------RIGKRIT----YE-------------------YQSAVGR
A0A3N5YNR8      ---------------------ETINRVQ----SE-------------------YRVAVNR
A0A350UEK1      ---------------------QILRRIR----NE-------------------YEEAMRK
A0A350UIQ4      ---------------------QILRRIR----NE-------------------YEEAMRK
A0A3N6A5T6      ---------------------RAIQRAR----AQ-------------------YQVAVDR
A0A1F2Q9L4      ---------------------EMVGKARDSARAE-------------------YQGALRR
A0A1H5SQF5      ---------------------RVGNQAA----RN-------------------LDLARKT
A0A2Z5G448      ---------------------NLLKRFE----EE-------------------YNAAVNT
A0A3E0NV31      ---------------------RAADAVL----QQ-------------------YRAAQRR
A0A3N5M5V0      ---------------------ETIRRAQ----SE-------------------YKVAVNR
A0A2V9AEW6      ---------------------NVLGRMR----NE-------------------YEAALRR
A0A2V8WQK6      ---------------------NVLRGLG----NE-------------------YAAAVRR
A0A2V8XIF4      ---------------------NVLRRIG----NE-------------------YTAAVRR
A0A3N5XQP8      ---------------------RALEEAQ----GR-------------------YRASLQQ
A0A2Z5G7H4      ---------------------RVAERSK----ND-------------------YEIARRE
A0A2V9KCS3      ---------------------NILKRIR----NE-------------------QEAAVRR
A0A2U3KC61      ---------------------RMQHGVR----DE-------------------YLAAVQR
A0A2V9Y2R7      ---------------------RMQHRIR----DE-------------------YLAAAQR
A0A372IT17      ---------------------RVGERAH----AD-------------------YEIAQRA
A0A136JPP4      ---------------------EVSQIID----RDQKKIEKDAVSGALVSLRSQVDAARRR
A0A399WUJ8      ---------------------EVSQIID----RDQKKIEKDAVSGALVSLRSQLDAAKRR
A0A2V9L5B5      ---------------------AVVDNIV----DE-------------------YRSATAK
A0A2V9L7I0      ---------------------AVTENIV----DE-------------------YRSAAAK
A0A2V9LK56      ---------------------TLVQNLV----DA-------------------YSSAVNR
A0A2V9YHT3      ---------------------RIGGRLQ----SE-------------------YQAATQR
A0A2V9NGH6      ---------------------KVIARVR----SD-------------------YLASVHR
A0A2V9PYE6      ---------------------KVIARVR----SD-------------------YLASVHR
A0A2V9NL07      ---------------------KVGGRLR----GD-------------------YLAALQR
A0A2V9QD92      ---------------------KVGGRLR----GD-------------------YLAALQR
A0A2V9WPZ6      ---------------------KMGGRVR----GQ-------------------YMASLHR
A0A2V9ZLH4      ---------------------KIAGKVR----NQ-------------------YLAAVQR
A0A2V9RQF1      ---------------------KITSRVR----SD-------------------YLASLQR
A0A2V9YDK8      ---------------------KIAGHVR----SQ-------------------YMASLQR
A0A2V9V8F7      ---------------------KMGGRVR----GQ-------------------YMASLHR
A0A2V9XGR9      ---------------------KMSGRVR----GQ-------------------YMASLHR
A0A2V9V3Q5      ---------------------KAVDHLR----GQ-------------------YQTALQR
A0A2V9NWS3      ---------------------KVVARVR----SD-------------------YLAALQR
A0A2V9USA9      ---------------------KIASKVR----GQ-------------------YMTALQR
A0A2V9XW18      ---------------------KIVAKVR----GQ-------------------YNAALQR
A0A3M2BZG9      ---------------------AEVNQRRDLARTA-------------------YQEALRK
A0A1Q7N5R7      ---------------------KAL-----------------------------ATELESR
A0A3M1SIV3      ---------------------EESAQIE----QESKQAEERAKKEILTGLAAQLNSARKR
A0A3E0PHB0      ---------------------ESKQIIE----DESKTLEKAVQKEITSALAAKLNTARRR
A0A3M2D491      ---------------------EVEKKLE----LESKLLEQRAQKELLTALSAQLNAAKQK
A0A357F267      ---------------------EVTQIID----RDQKKIEVDAINGALVSLKAQLDAKRKE
A0A353C9L6      ---------------------EVSGIID----RDQKKIEKDAVTGALVSLRAQLDSKRRE
A0A2V8RQV0      ---------------------EVSKIID----TDQKKIEKEAVSGALVSLRAQLNAARTQ
A0A2V8SJH5      ---------------------EVSTIID----KDQKKIEKDAVNGALVTLRSQLSAAQKQ
A0A2V9QB26      ---------------------AIVDRIR----ND-------------------YKTALRR
A0A2V9VYY4      ---------------------KLQQKMR----DD-------------------YLAALQR
A0A2V9KIE8      ---------------------ALVENIV----EE-------------------YHAAESN
A0A352F549      ---------------------SAKQIITTNLEVN-------------------YRKAVER
A0A3B9MLP9      ---------------------SARKIITVSLDSN-------------------YRQALDR
A0A3D5SQ87      ---------------------SARKIITVSLDSN-------------------YRQALDR
A0A2V8NW86      ---------------------AIVDRIR----ND-------------------YETALRR
A0A2V8ZHL8      ---------------------RIVERLR----ND-------------------YMAALGR
A0A2V9B240      ---------------------RVVERLR----ND-------------------YEAALGR
A0A2V9CBM2      ---------------------RAADQIT----NE-------------------YFAASSR
A0A2V8XN17      ---------------------RAADRIA----ND-------------------YSAAVRR
A0A2V8WX45      ---------------------RAADRIA----ND-------------------YSAAVRR
A0A1Q6YR79      ---------------------RAADRIA----ND-------------------YSAAVRR
A0A1Q7VA32      ---------------------RAADRIA----ND-------------------YSAAVRR
A0A2V9EY85      ---------------------RAADRIA----ND-------------------YSAAVRR
A0A2V9H8K0      ---------------------RATDRIV----ND-------------------YSAAVRR
A0A2V9FFE5      ---------------------RAADRMV----ND-------------------YSAAVRR
A0A2V9GM43      ---------------------RAADRMV----ND-------------------YSAAVRR
A0A1F2RFI7      ---------------------AFAKRVT----DD-------------------YRAALNR
A0A1F2RZS3      ---------------------AFAQRVA----ND-------------------YKAAANR
A0A1F2USE2      ---------------------KAAERIR----KE-------------------YGAAQQR
A0A2V9C238      ---------------------RVAGRIT----ND-------------------YLAAVRR
A0A1F2Q9F5      ---------------------RAAERLA----ND-------------------YQAAMRR
A0A1F2QQH9      ---------------------RAAERLA----ND-------------------YQAAMRR
A0A1F2QXK7      ---------------------RAAERLA----ND-------------------YQAAMRR
A0A2V9DEM9      ---------------------RVAGRII----ND-------------------YLAAVRR
A0A2V9CYQ5      ---------------------RAADQIT----NQ-------------------YLAASSR
A0A2V9BWU8      ---------------------RAADKIT----NE-------------------YSAAVRR
A0A2V8ZG48      ---------------------RVADKIV----NE-------------------YLAAVRR
A0A2V8Y334      ---------------------RAADKIT----NE-------------------YFAALRR
A0A2V9AY68      ---------------------RAADKIT----NE-------------------YFAALRR
A0A257VBK0      ---------------------TVLGSYR----NQ-------------------LSALRGE
A0A2V7XDY0      ---------------------QIIAALR----AD-------------------YEQLQKR
A0A350UQT3      ---------------------NAIRRMQ----VE-------------------YEQAQAR
A0A2U3JZ71      ---------------------NIGQRVE----VE-------------------YREALNR
A0A2V8TTB0      ---------------------SIAQRVE----IE-------------------YREAVNR
A0A1F2TCR2      ---------------------RVIETAK----TD-------------------YEAAVAE
A0A2N9LQU7      ---------------------NVGQRLH----DE-------------------FLAAQNS
A0A2P6WFK7      ---------------------NVGRRME----TE-------------------YQSAAKT
A0A1F2V330      ---KPTVAEPSAARMHYVQIRAEKESLE----QR-------------------LTSYGQE
A0A2V8U914      ---------------------RVRQSVQ----ND-------------------YVAAQRR
A0A2V7W309      -----------------EAYSRALEEAR----AQ-------------------VSAASSR
A0A2V8TLH7      ---------------------RIISNLR----TQ-------------------YALLKDR
A0A1Q7ZJT1      ---------------------RIINGLR----SQ-------------------YDLLKDR
A0A2V8VC99      ---------------------RIINGLR----AQ-------------------YELLKDR
A0A348UZU3      ---------------------RLIRAAY----AD-------------------YQAALKK
Q01XL7          ---------------------GLLKRLD----ND-------------------YQEALRR
A0A2V8ERZ5      ---------------------RAVQSVK----NE-------------------YETAVLQ
A0A2V8GTX0      ---------------------RSVAAIK----AD-------------------YQAALDE
A0A2V8J0X9      ---------------------KVLESLK----ND-------------------YNAAFAQ
A0A372IRG7      ---------------------NLTQRFQ----TE-------------------YDAAVKT
A0A1F2U158      ---------------------KALQTVR----NE-------------------YERAVLE
A0A2V8F6S9      ---------------------RAATTIK----ND-------------------YESAVLE
A0A1I6MH75      ---------------------RLLIQTR----EA-------------------YLATKAN
E8WVF6          ---------------------RLLTQAK----ET-------------------YLIAKAN
A0A1H5Z7N3      ---------------------RILAQAR----QN-------------------YIASRTN
A0A1G7JVV8      ---------------------RMVTEAK----QA-------------------LVAAQAN
A0A1H4T6W9      ---------------------RLLTEAK----QA-------------------LVAAKAN
I3ZEU5          ---------------------RLLTEAK----QA-------------------LVAARAN
A0A428MDU2      ---------------------RLLLQAK----QN-------------------YVVARTN
A0A239HDF6      ---------------------RLLLQSK----EN-------------------YLIAQAN
A0A1Q3QQB6      ---------------------RLLLQAK----EN-------------------FVVARAN
A0A3N1K1G7      ---------------------RLLLQAK----QN-------------------YVIARAN
A0A2W0BGU4      ---------------------RIAQRIR----ND-------------------YFAAARR
A0A2W0BVQ9      ---------------------RIAQRIR----NE-------------------YFAAARR
A0A3D1ASD2      ---------------------SITEQVA----IE-------------------YRTATQR
A0A2N9MK30      ---------------------SVMRRVE----VE-------------------FREGVNR
A0A2V9MN96      ---------------------NLLSKVR----DE-------------------YMAAIQR
E8UZE1          ---------------------RGRNQLE----LE-------------------YKLASEN
A0A2V7V2Z1      ---------------------RVIRAAE----ND-------------------YKAYAAQ
A0A2V7X2F7      ---------------------RVIRSAE----ND-------------------YKAAAAQ
A0A2V7V2I1      ---------------------RVIRAAE----ND-------------------YRAAVAQ
A0A2V7U3M2      ---------------------RVIRAAE----ND-------------------YKAAAAQ
A0A2V7UHT0      ---------------------RVIRAAE----ND-------------------YKAAAAQ
A0A2Z5FVL3      ---------------------RMRDRAR----NE-------------------YVVAQQV
A0A1V6HR88      -----------------EALAKAREAAR----AE-------------------YQGAQRR
A0A3E0P0A3      -----------------ENSRQAVTAAR----AR-------------------YQQALQT
A0A2V9KBD6      ---------------------RIGDRLT----YE-------------------YHSAAER
A0A2W0AJ66      ---------------------RTRERMT----NE-------------------YRMALER
A0A1Q7RBU1      ---------------------RIGEHIT----YE-------------------YKSAVGR
A0A2V9JPV9      ---------------------RIGERIT----YE-------------------YKSAVGR
A0A2V8EXP2      ---------------------KVVQAVR----NE-------------------YLSAQTQ
A0A2W4RYA1      ---------------------KVVASIT----AQ-------------------YEAAVAH
G8P0Y7          ---------------------NSVSRIH----ND-------------------YQTAVNR
A0A3D4VGU2      ---------------------NLTQRFK----AE-------------------YDAAVQT
C1F294          ---------------------NLTQRFK----AE-------------------YDAAVQT
A0A3P0X3W6      ---------------------NTGRRIQ----TD-------------------FAQADTR
A0A1E3Y9R6      ---------------------KVAAALQ----AE-------------------FQTARAR
A0A2W4TLP2      ---------------------KVAAAIE----AD-------------------FETALAR
A0A3R9WF43      ---------------------RITKRAE----NA-------------------YQYAKDN
A0A317HKM4      ---------------------AAAHTIR----ND-------------------FEAAQSR
A0A2W0C122      ---------------------RLQARAE----LE-------------------YQVASRR
A0A2W0AUU7      ---------------------RLQGRAE----LE-------------------YQVAARR
A0A2W0BQL1      ---------------------RLQGRAE----LE-------------------YQVAARR
A0A3P0XH15      ---------------------NMQQRFQ----VE-------------------YETALST
A0A3M1WQW8      ---------------------QILAKIE----AD-------------------YKAARTR
A0A3N1JHC1      ---------------------TIVKRLS----VE-------------------DDTAARR
A0A2V9KA79      VSARRPAGEPSPFFLRYLQLKSEVEAID----QR-------------------LNSSKQE
G8P085          ---------------------IVKNRLK----QE-------------------YDTAVAI
Q1ILD9          ---------------------DIEARFS----SE-------------------YEASLNT
Q1IJZ6          ---------------------LIVDRTE----LD-------------------LELARQS
A0A2V8TCE6      ------------------IARRIVSAEQ----AK-------------------YRAALDE
Q1ITG0          ---------------------DIEERFR----TE-------------------YESAKRT
A0A3N5PCI5      ---------------------KTVESVR----QE-------------------YLAALSR
A0A3M1Q0S9      ------------------IARQVREAAK----ID-------------------YEQARRR
A0A3M1VZ38      ------------------IAASAIDSAQ----AA-------------------FEQARRE
A0A3M1PY35      ------------------VFEEAVGAAR----AD-------------------LELARTR
A0A3M1VMP2      ------------------IYRQALESAR----AE-------------------LALRRES
                                                                            

A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A3M2D9H8      LNIYQQIYVNLSFSPASQS-SQNGTNNQLQAALVLYQQIYANLLSNYEAIRLARLQS---
A0A399Y5V2      QSFWKTALDKLQIQSNLQT-S---------------------------------------
Q01X01          ------------VASTLRQ-S---------------------------------------
A0A2V7VMF7      ESELRDAIDAQKADAARQS-QKKTEVEVLKKEAQSAASLYDVLLQKLNESDIAA---SIR
A0A2V8JK38      ERLLSVALEQQRDAVNKMN-REIIQYNILKREADSSKDIYNGLLTRLKEAGISG---GLR
A0A2V9IXG5      EQASQKSYSEKMAERRVTS-RHMAEMSSFIKSKENWASAFAAVEQKLRDLSLQE---GFV
A0A2V9J2P4      EQASQKSYSEKMAERRVTS-RHMAEMSSFIKSKENWASAFAAVEQKLRDLSLQE---GFV
A0A192WQ77      ERYLRGQLRSVQDRSEQLG-EATSRLETKRIESETRKQVFDSMSKVTNQISLAA---GLL
A0A1Q7RLS4      EAKLIKATDETRTESLQVN-RKASGYEMVRGEATETKRIYDLISARVKEIDLSS---SLL
A0A2V2R525      EQEIRDAFEKARSETITQN-SAAVNYRILQQEIQTNQELLNGLWQRYKENDVIL-AGT--
A0A321LPW6      EVSLKGALDRAKTEAARQN-QDAIQYGILKQDVDTAKSLYTEFLQKTNQANLEL-AQQ--
A0A2V9R9V4      ENALKAALEEAKAGAAQEN-QRAIQYSLLKQDVDTAKSLYTEFLQKTNQAYLEV-AQQ--
A0A321LE75      ETALKESLERAKIDAAQQN-QDAITFNILRQNVETAKTLYTDFLQKQSQARVQV-AEQ--
A0A2V8R8U7      ERSLEKAYSVQHGKTVSQT-RNVIDLAIKTQELTTDAQYLNTLMQKRRELAAGG-ADR--
A0A2V8QMP4      ERSATGSYFAARAKANDQS-VADTKLADLDQQIATDRQNLNLYMQRANELKVTAPDRA--
A0A2V8R4S3      ERSATGSYFAARAKANDQS-VADTKLADLDQQIATDRQNLNLYMQRANELKVTAPDRA--
A0A2V8NJ55      EQKIKTDYEHERGAAQAQG-KAALDIGGLTQELETYRQLFQTLSQKQNEIDLAG-NDQ--
A0A2V8Q7I0      ENSVRAMYNSQHGTATQQT-RNQIEMAQYKQELETDKQYLNTLMARKRDVQTSN-TDR--
A0A2V8S6K4      AASLQAAYYKERSAAQAQG-IQVIGLSNVEQQLTTSKQMLSTLLQRRQELETADIEGQ--
A0A317I2L9      EQSIKSMYNAQRGVTSQQT-RAQIDMVSYTQTLETNKQYLNTLQQRLREIQASS-GDR--
A0A2V8LLF9      EKSLVGAYSRQHGTTIQQT-KDQIDMAIITQALTTDQQYLNTLTQRLRELTATS-GSG-T
A0A352FRF4      LADLKTAYTKESGLTAQQT-KNIIELASMRADLASDQQYLNTLFQKRRELNAVS-GET--
A0A2V8MKV0      ERSLAQAYSQAHGVTAAQL-DHELELAAMTQKLTSDEQYLNTLNQKERELKATG-SDK--
A0A2V8PYY8      EKSLAQAYSQAHGVSTAQI-QHELELAAMTQNLTSDEQYLNTLNQKERELKATG-TDK--
A0A1Q7YKQ8      ENSLRASYNQQHSEFSQQT-QDQIQLTMIEQEIETNRQYLTTLLQRQRELENEQ-TGRMQ
A0A352F3R7      ENLLRRSYEQQKGTTTQQT-RDQIDLIALTQGLETDKQYLNTLLQRQRELQVTS-GDR--
A0A0B6WXT1      ENKLKQAYYQEAAAANEQN-QAEIELSRITQELETNKQFYNTLFQRQKELEITS-NDR--
A0A3B9MEU8      ENLLKRSYEQQKGTTTQQT-RDQIDLMAITQELETNKQYLNTLLQRERELTVAS-GDR--
A0A2V8MHG6      EEALRQAFEKQRAETLTQN-EAAVNYRIIQQQIETNKSLLDGLLQRSKENEVIL-AGT--
A0A2V8P7N1      EEALRQAFDKQRAETLTQN-EAAVNYRIIQQQIETNKSLLDGLLQRSKENEVIL-AGT--
A0A2V8M3M6      EEALRQAFDKQRAETLTQN-EAAVNYRIIQQQIETNKSLLDGLLQRSKENEVIL-AGT--
A0A1Q7NJH5      EEALRQAFAKQRAETLTQN-EAAVNYRIIQQQVETNKSLLDGLLQRSKENEVIL-AGT--
A0A2V8PJY0      EEALRQAFAKQRAETLTQN-EAAVNYRIIQQQVETNKSLLDGLLQRSKENEVIL-AGT--
A0A1Q7Y6W9      EDSLRDAFNKQRSETLVQN-EAAVNYNIIKQGIETNKQLLDGLLQQERTNDVVG-EGT--
A0A2V8NC68      EQALRADFEKQRGETLTQN-EAAVNYRILQQEIDTNKSLLDGLLQRAKENDVVL-AGT--
A0A399WK13      EDKIRADFNKQFGEATGQN-QSAVSLALLKQTIDTNKGFLENLRKQVSSNDVAA-QGS--
A0A352FLX4      EELLRKAYDQQRAETLTQN-EAAVSYRIIQQEIETNKTLLDGLLQRTKENDVVM-AGT--
A0A2V8RTL7      ETKIRSAYDVQYNEAQGQN-SGAVMIKLLEQTIETNRGFLDNLRKQQSGNDVAS-QGS--
A0A3E0PCJ6      EDKVRSAFNAQYNEAQGQN-QSEVTIKLLEQDIETKKGFYANLENQQKGNDLAG-AGT--
A0A3M1S4R8      EDKIRRAFEEQYRKAEGEN-RAAIDIKLLEQNIETNRGFLKNLIEQQSSNDVVA-QGT--
A0A1Q7YFI6      EESLRQAFDQQRAQTLTQN-EAAVNYRIIQQEVETNKQLLDGLLQTAKGNDVVM-SGT--
A0A136KC10      EDKIRADFNKQFGEATGQN-QSAVSLALLKQTIDTNKGFLENLQKQVSSNDVAA-QGS--
A0A2V8SEX6      EDKIRAAYDEQYNAAQVQN-GGAVRLKLLEQTIETNRGFLDNIRKQQSSNDVAS-QGS--
A0A3M2D6Y5      EDKIRKAFDEQYRRAEGEN-RAAIDIRLLEQNLETNRGFLKNLIEQQSSNDVIA-RGT--
A0A0B6WWQ6      EEALRQAFDEQRGETLTQN-EAAINYRIIQQEIETNKSLLDNLLQRAKENGMAM-AGV--
A0A3B9MK99      EQALRKAFEQQRGETLSQN-EAAINYRIIQQEIDTNKTLLDSLLQRSKENDVIM-ASK--
A0A352EX26      EQALRAAFQQSRSETVTQN-EAAINYRIIQQEIDTNKTLLDSLLQRSKENDVIM-ASK--
A0A2V8MM59      EQALRKSFDQQRAETLTQN-EAAINYRITQQEIDTNKGLLDSLLQRSKENDVVL-AGR--
A0A2V8PFE8      EESLRKSFNQQKGETVTQN-EAAINYRILQQEIETNKGLLDNLLQRSKENDVVL-AGR--
A0A2V8PWS6      EDSLRKSFNQQKGETVTQN-EAAINYRILQQEIETNKGLLDNLLQRSKENDVVL-AGR--
A0A2V8LCT5      EDSLRKSFNQQKGETLSQN-EAAINYRILQQQIETNRGLLDNLLQRSKENDVVL-AGR--
A0A352FTJ9      EEALRKSFNQQKGETVTQN-EAAINYRILQQEIETNKGLLDNLLQRSKENDVVL-AGR--
A0A2V8G155      ERSLTAALEQQKTEALVMN-RKAIEYGVLERDAKSSRQIYESLMQRAKETGVS-A--ELK
A0A2V8HDM7      ERSLTAALEQQKTEALVMN-RKAIEYGVLERDAKSSRQIYESLMQRAKETGVS-A--ELK
A0A2V8DRT9      EQSLMHALDQQKNDALALN-RKGIEYGALQRDAASNRQIFESLLQRTKETGIS-G--ELK
A0A2V7VYF3      EQDLVAALNAQKNEALGQN-RKAIAYGALQRDAASNRQMFEALLQRTKETGLS-E--ELR
A0A1F2SVH2      EQSLMSALEQQKSEALSLN-RKGIEYGVLARNAASNRQIFESLMQRTKETGIS-G--ELK
A0A2V8AJG9      EQTLTGALDQQKRDALALS-RKGIDYGALQRDNATNRQVFESLLQRAKETGVS-T--ELK
A0A2G6PYV5      KQNQKIVLADLKTKEQNASLDSKIQVLEQNSLVIDKRKEYLELALGLKEIGRTDK-----
A0A2V8F956      ENSLTGALNAQKGDA-----------------VQSSRQIFDSLMQRAKETGVS-A--ELK
A0A1F2S1W5      ERTLANELNRQKIEAQQLN-RTSIDYSALQRDAAANRQMFEALLKRTQETGVS-E--ELK
A0A1F2T595      ERSLSASLNQQKIEAQSLN-RAGIEYGALERDATANRQMFEALLKRTQETGVT-E--ELR
A0A2V8JQV5      EELLAQEYDAQTRVVSDQA-DKVAHYARLKREADSNRQLYEAMLQKVKEYNIA-S--AVT
A0A2V9AC41      ETGLRATMEDQKKTTLNLK-DAAVQYAMLAREVDMNKQLYDGVLQRLKEIGVA-A--EIR
A0A2V8K4L4      EKLLNDEFAKQLDTVSSQA-ANEVHYNILKREVDTNRQLYESMLSKVKESSIA-S--AMR
A0A2V8NCZ3      EKLLNDEFAKQLNTMSSQT-AKEIHYNILKREVETNRQLYESMLARVKESSIA-S--AMR
A0A2V9MAM9      EALLSSAYQQQTHLASDLR-KKMIHYDTLNREVATTRQFYEAMLQKVNDAGVA-T--AIR
A0A2V9M454      EKFLATAVAQQKVQVDRVN-QLLIQHNLLKREFESNQQLYDNLLQHLKDGNVS-A--GLR
A0A2V9IVR7      EAMISEALARQKVELEKLN-QLLIQQNILKHEFETNQQLYEGLLQRLKDATLS-S-----
A0A2V9ILE2      EAMISEALARQKVELEKLN-QLLIQQNILKHEFQTNQQLYEGLLQRLKDATLS-S--GLR
A0A2V9LGY4      EAMISEALARQKVELEKLN-QLLIQQNILKHEFQTNQQLYEGLLQRLKDATLS-S--GLR
A0A2V9J4D6      EKLLEATVAQQKFEVGKLN-QLLIQHNILKRDSDTNQQLYDNLLQRLKDATVT-A--GLR
A0A2V9L9C5      EKLLEATVAQQKFEVGKLN-QLLIQHNILKRDSDTNQQLYDNLLQRLKDATVT-A--GLR
A0A2N9M9N1      EQLLSQDVSAQRTEVEKLN-QLLIKYTILKGDFETNQQLYDELLKRLKDATVS-V--SLR
A0A2V9JEC4      ETLLSRTVAEQRKDVERLN-QLLIQHNILKGEFETNQQLYNDLLRRLKDATLS-V--SLR
A0A2V9LPQ3      VSLVSTSVVQQKAEVGRLN-QLLIQHNILQREFQTNQQLYDDLLQRLKDATVS-A--GLR
A0A348V070      EQNLQKLLDDLKAQAYKAN-STAILYNSLKIETDNKKALLEALSKRQSETDLASRLKDLQ
A0A2Z5G3A3      EAQSQMSYKALKKRADALN-DKTIEYELTRQEATDSRTLYVSLLGRLKEAGLL-E--GLR
A0A2V7UGP8      EKTVRGALEGQKSEAIKQK-QYGVEYSNLKAAVDSKREILNKLMQRETETGSLSQLKNAG
A0A239MKT6      EDGIRKRATDQRQQVLELG-NSLTALTFLQQEENTSRGLYQDLYTRLQEASIS-A--GVR
A0A3E0PCN7      ENELRRNFEAQRNAVLNQN-EAAINYNIIRQEIATNKTLLDSLLQRARETEVI-L--NGT
A0A2V8IYW3      SVRLRGTIAEYQRRVETAP-TRESEMAELTRDYETLKKGYESLLAKKEDSNIA-A--NLE
G2LEI9          EEELRARVEKQRNEVVTQN-GDGVMQRMMQDNIDNKKKMLQALQATTKDTEIN-L--RMD
A0A317J121      EKLLSADYTKQASQVSAEA-TKASQYSGLKREVETLQQTYSAMLLQANESNIN-SSVPLG
A0A2V7YW66      EQSLDGELTTLKGQAIDQN-SAAVGFTNLKVEIQTRRDLLNELMHKQSETEVAVRLQDTR
A0A2V7Z0V0      EQELEGELNALKRDVINQS-SAAVEYTNLKVEIQTRRDLLDELMRKQSETEVAVRLQDTR
A0A2V8GFD4      ERSLQAALDQQKHEAQELN-RRAIDYGVLQRDAATNRQIFDALLQRSKETGIS-G--ELR
A0A2V8HSS5      ERSLQAALDQQKHEAQELN-RRAIDYGVLQRDAATNRQIFDALLQRSKETGIS-G--ELR
A0A2V8KP55      ERLLSVALEQQRDAVNKMN-REIIQYNILKREADSSKDIYNGLLTRLKEAGIS-G--GLR
A0A399WNU1      ENELRSNFDAQRSAVLNQN-EAAINYRIIQQEIDTNKSLLNSLLQKARETEVV-L--NGT
A0A2V9CG11      EEFLAKAYADQEMIAADQS-SKAIRYRTLKGEVDSSRQLYEAMLERVKQAELA-T--AMR
A0A2V2R0I6      ENLLMRELEDQKAQANAMA-EKLVEYNILKREAEANKTLYDGLMNKLKEVGIA-E--SLK
A0A2V8XAR9      ESMLTQALDQQKAAANQMA-EKLVEYNILKREAEANKALYEGLMTKLKETAIS-L--GLR
A0A2V8VZA0      ETLLTQALDQQKAETNQMA-GRLVEYNILKREAEANKTLYEGLMTKLKETAIS-Q--GLR
A0A1Q7CB82      ETLLTQALDQQKAETNQMA-GRLVEYNILKREAEANKTLYEGLMTKLKETAIS-Q--GLR
A0A2V8WIU1      ETLLTQALDQQKAETNQMA-GRLVEYNILKREAEANKTLYEGLMTKLKETAIS-Q--GLR
A0A1Q6Y9F5      EALLTRALDQQKADTNQMA-GKLVEYNILKREAEANKTLYEGLMTKLKETAIS-Q--GLR
A0A2V9EVV8      EALLTRALDQQKADTNQMA-GKLVEYNILKREAEANKTLYEGLMTKLKETAIS-Q--GLR
A0A2V8YF91      ETLLTDALDQAKAEANQMA-ERLVEYNILKREAEANKALYEGLTTKMKETAIS-A--GLR
A0A2V8XZK2      ETLLSEALDQAKVEANQMS-EKLVEYNILKREAEANKALYEGLMTKMKETAIS-A--GLR
A0A2V8ZTX6      ETLMGQALDQAKAETNQMA-EKMVEYNILKREAEANKALYEGLMTKMKETAIS-G--ALR
A0A2V9BT79      ETLLADALNEAKAETNQMA-EKMVEYNILKREAEANKALYEGLMTKMKETAIS-G--ALR
A0A1Q8B793      ELLLLKALDQQKAEANQMA-ERLVQYNILKREAEANKALYEGLLTKLKEAGIS-A--GLR
A0A2V9BCA0      ELLLLKALDQQKAEANQMA-ERLVQYNILKREAEANKALYEGLLTKLKEAGIS-A--GLR
A0A2V9BWU9      ENLLSQALDKQKGESNAMA-EKLVQFNILKREAEANKQLYEGLLQKMKEASIS-A--GLR
A0A2V9DKX2      ETLLSQALDKQKGESNAMA-EKLVQFNILKHEAEANKQLYDGLLQKMKEASIS-A--GLR
A0A2V9JSI3      EKLLAAALAREKEAVGRLN-QVLIQHNLLKREFETTQQLYENLLQHLKDATVS-A--GLR
A0A2V9WI32      EKLLGAALDVQKQEANHLN-ESAIEYNLLKRDAESNRQLYEGLLQKLKEAGVS-A--GLR
A0A2V8IVN9      ENSFIAALNQQKGEALTMN-RKAIDYGVLDRDVQSSKQIYESLLQRAKETGVS-T--ELK
A0A1F2TPT3      EANLGKELESLKIEATAQN-RKNVELSILTREVASNRQIYDMFMQRARETGVA-K--DIN
A0A2V8JTQ2      ERMLRDALEAQKQVVDHLN-ASAVQSDILKREFETNRKLYEDLLQKQKEVGIS-A--SLK
A0A2V8UZY0      ERILQDALEAQKQTADKLY-ANAVQSEILKHEFETNRKLYEDLLQKQKEVGIS-A--SLK
A0A3N5YNR8      RQMLLGALNRQKSEANQLN-QDSIQYNILQREVDTNRQLYEGLLQRLKETGIS-A--GMR
A0A350UEK1      ERLLQTDYDRQTRLVTALG-EKAIQYNILKREVETNRQLYESMLQRVKEAGLA-S--ALR
A0A350UIQ4      ERLLQADYDKQTRLVTVQG-EKAIQYNILKREVETNRQLYESMLQRVKEAGLA-S--ALK
A0A3N6A5T6      RNRLQTALVAQKEMADQLN-ENSIQYNILQREVETNKQLYEGLLQRLKEAGVA-A--GLK
A0A1F2Q9L4      EEALVAELTRQKSDAMQLN-SAAVEYNNLKVEVSTRRTLLDELVRKQSETEVASRLQGTH
A0A1H5SQF5      EDGLLQSVDREKLRLGHMT-TSADQLLLLEQEETSNRTLYQDLYGKLEAANIL-A--GAK
A0A2Z5G448      EALLKGRLEQVKQEAFRVS-DSSADFEILKHEAQSTTDLYDALQMKLKEASVT-A--GLN
A0A3E0NV31      ADSFAAQIRAERRSSDRES-EAAVQLEILERKTQTNKQLYDGILQRLRETDIV-A--ELQ
A0A3N5M5V0      QQMLRRALQKQKAEANQLN-QDSIQYNILQREVDTNRQLYEGLLQRLKETGIS-A--GMR
A0A2V9AEW6      EKLLTEAHDAQQKVVADQS-SKAIHYDTLKRDVDSNRRLYETMLQRVKEASLA-A--AMR
A0A2V8WQK6      ERLLSKAQAEQEKIAADQS-DKVIHYDTLKRDVDSNRRLYEVMLQRVKEASLA-T--AMR
A0A2V8XIF4      ERLLVEVHANQEKVVADQS-SKAIHYDTLRRDVDSNRRLYEVMLQRVKEASLA-T--AMR
A0A3N5XQP8      YSQLSRVMDRQRQLAYRLN-SDLVQFNTLKREADTNRQLYEGLLARLKQAGVE-A--GFR
A0A2Z5G7H4      EDESRTEFATEKHQADSLN-DKAIEYAIVRQEADDSRGLYEDLLKRLKEAGVL-E--GLR
A0A2V9KCS3      ESLLAAEYGSQAKLVSEQS-GKTIHYNILRREVDTNRQLYDSMLQRVKEYGIA-S--AMH
A0A2U3KC61      ENLLTTAFNQQTQQANQLN-ESAIEYSVLKRDAEANRQLYQDLLQRFSEASVS-E--TLK
A0A2V9Y2R7      ERLLTSAFEQQKQRANLLN-ESAIEYSVLKRDAESNRQLYLSLLQKLKEAGVT-A--GLR
A0A372IT17      EDTAREEFEKQKTLAAQMN-DRRIAWTLARQEADESRRLYDQLFGKLKQAGVL-E--GLH
A0A136JPP4      EDQLLNAYEVEAERANVQG-QAATTLTTLKRALETNRGLLDTYTQRQKEQELALA--SGK
A0A399WUJ8      EDQLLNAYEVEAERANVQG-QATTTLTTLKRALETNRGLLDTYTQRQKEQELSLA--AGK
A0A2V9L5B5      EQYFAQAVDDQKREVNEIA-ARSIQYNILKREVDSNRQLYEGLLQRMKEAQAS-A--GLR
A0A2V9L7I0      EKYFAQAVEDQKREVNRIA-DKSIQFNILKREVDTNKQLYEGLLQRMKEAQVS-S--GLN
A0A2V9LK56      EKYLEQALKGQEKQVNDIA-EKTIQYNILKREADSNKDLYNGLLQRMKEAQVS-A--GLR
A0A2V9YHT3      ETLLQEALNQQKREANRLN-ERAIQYTLLKRDLDTNQQLYDGLLQRLKEAGIS-A--ALK
A0A2V9NGH6      EEMLRAAMEKQKQEANQLN-ESAIEYTLLKRDVDTNRTLYEGLLEKLKEAGVT-A--GLR
A0A2V9PYE6      EEMLHAAMEKQKQEANQLN-ESAIDYTLLKRDVDTNRTLYEGLLEKLKEAGVT-A--GLR
A0A2V9NL07      ENMLRSALEEQKQQENKLN-ESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVT-A--GLR
A0A2V9QD92      ENMLRSALEEQKQQENKLN-ESAIEFSLLKRDFETNRTLYEGLLQKLKEAGVT-A--GLR
A0A2V9WPZ6      EGLLRDALEKQKQQANKLN-ESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVT-A--GLH
A0A2V9ZLH4      ESMLHDAMEKQKQEANKLN-ESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVT-A--GLR
A0A2V9RQF1      ENMLRDALDRQKQQANRLN-ESAIDYSLLKRDVETNRTLYEGLLEKLKEAGVT-A--GLR
A0A2V9YDK8      ENMLRAALEKQKQEANKLN-QSAIEYSFLKRDVETSRQLYEGLLEKLKEAGVT-A--GLR
A0A2V9V8F7      EGLLRDALEKQKQQANKLN-ESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVT-A--GLH
A0A2V9XGR9      EGLLRDALEKQKQQANKLN-ESAIEYSLLKRDVETNRQLYEGLLEKLKEAGVT-A--GLH
A0A2V9V3Q5      ETMLRAALEKQKQEANRLN-ENAIDYTLLKRDVDSNRQLYEGLLEKLKQAGVT-A--GLK
A0A2V9NWS3      ETMLRGALTKQKQEANKLN-ESAIEFTLLKRDVETNRALYEGLLEKLKEAGVS-A--GLR
A0A2V9USA9      ENMLRDALEKQKQEANKLN-ESAIQYNILKRDSESYRQLYEGLLQRMKEAGVS-A--GLK
A0A2V9XW18      ENMLHTALDKQKQEANKLN-ESAIEYTLLKRDVDTNRQLYEGLLQKLKEAGVS-A--GLK
A0A3M2BZG9      EQNVEEELRKLTDEISAYS-SSALDYTTAKLELETKQRLFNDLLKKQSEAEVASSFHDAK
A0A1Q7N5R7      EAVLGTQITAGGRELRGIP-QRAIEEARLRRDATIAENLFTSVQQRYSEARLA-E--ASS
A0A3M1SIV3      EAKAKESYLREVEKANQQG-QAAMSLTDLTQKIETSRSLLNTYVQRQKELESAIS--SSR
A0A3E0PHB0      EAQLAAAYEQESAKANQQG-QKETMLTTARREIENNRGILDRLLQREREMELSIN--TSA
A0A3M2D491      EEQARASYLAEVERSNQQG-QAGMRLKTLTQAIDTNRELLNTYIQRQKELELAIS--SSR
A0A357F267      EAQAQAAYDAEAARANIQG-QAETKLTTLKRGIETNRNLLDTYTQRQKEAELAIA--SGR
A0A353C9L6      EAQALDAYEKEAALANVQG-QAQTKLTTLKREIETKRNLLDTYTQRLKEKELEVE--SGA
A0A2V8RQV0      EAQAQAAYEQESGTANVQG-QAQTKMITLKREIETNRNLLDTYTQRLKEQELSRA--NDA
A0A2V8SJH5      EAQSLAAYEQEASQANVQG-QAQTELITKKRAIETNRNLLDTYTQRQKEQELAIA--SGR
A0A2V9QB26      EKLLSAAYRNQSRLVTDQD-EKSIQYGILKREVDSNRETYQAMLQRVKEANIA-S--AVR
A0A2V9VYY4      ENLLDSAFNKQKQEANKLN-ESAIEYTVLKRDAETNRQLYQDLLQRLKEAGVS-A--GLR
A0A2V9KIE8      EKLLAQAVVQQKAEVNDIA-QKTIQYNILKREADTNKQLYESLLQRLKEAQVS-E--GLK
A0A352F549      EKTLRDSFNKQRGETVAQN-QAAINYNILKQEIETNKGLLAGLMQRSKENDVT-M--AGT
A0A3B9MLP9      EKTLRDSFNKQRAETVAQN-QAAINYNILKQEIETNKGLLEGLMQRSKENDVT-M--AGT
A0A3D5SQ87      EKTLRDSFNKQRAETVAQN-QAAINYNILKQEIETNKGLLEGLMQRSKENDVT-M--AGT
A0A2V8NW86      EKLLSAEYRNQSRLVTDQD-EKSIQYGILKREVDSNRGIYEAMLQRVKEANIA-S--AVR
A0A2V8ZHL8      EKLLAAAVAKEKADVGALS-QLLIQHNLLKREFDSNQQLYDSLLQRLKDATVS-A--GLR
A0A2V9B240      EKLLAAAVAKEKVGVGALS-QLLIQHNLLKREFDTNQQLYDSLLQRLKDATVS-A--GLR
A0A2V9CBM2      ESLLRHELAEQQKQIDRIA-EKSVQYNILKREVDTNKQVYDGLLQQLKSAGLA-A--SLK
A0A2V8XN17      ENLVQQALDNQQKQVSLIA-EKSVQYNILKREVDTNKQLYEGLLQQLKEAGVS-A--GLK
A0A2V8WX45      ENLVQQALGEQQEQVSLIA-EKSVQYNILKREVDTNKQLYEGLLQRLKEAGVS-A--SLK
A0A1Q6YR79      EDLVHQAVDGQQKQVSLIA-EKSVQYNILKREVDTNKQLYEGLLQQLKEAGVS-A--GLK
A0A1Q7VA32      EDLVHQAVDGQQKQVSLIA-EKSVQYNILKREVDTNKQLYEGLLQQLKEAGVS-A--GLK
A0A2V9EY85      EDLVHQAVDGQLKQVNLIA-EKSVQYNILKREVDTNKQLYEGLLQQLKEAGVS-A--GLK
A0A2V9H8K0      ENLVQQALNDQQKQINLIA-EKSVQYNILKREADTNKQLYEGLLLQLKEAGVS-A--SLK
A0A2V9FFE5      ENLVQQALDDQQKQVNLIA-EKSVQYNILKREVDTNKQLYEGLLLQLKEAGVS-A--SLK
A0A2V9GM43      ENLVQQALDDQQKQVNLIA-EKSVQYNILKREVDTNKQLYEGLLLQLKEAGVS-A--SLK
A0A1F2RFI7      KRLLDQAVEQQTKEINQIA-EKSIPYNILKREADTNKQLYEGLLQRLKEASVS-A--GLR
A0A1F2RZS3      KRLLDQAVAQQTSDFNAMA-EKSIQYNILKREADTNKQLYDGLLQRLKEASVS-A--GLR
A0A1F2USE2      QEFLRQAFQKQEEQANLIA-EKSVQYSILQREVETNQQLYEGLLQRLKEAGVS-A--GLK
A0A2V9C238      ENLVAQAFAEQQKQANLIA-GRSVQYNILKREVETNQQLYEGLLQRLKEAGVS-A--GLK
A0A1F2Q9F5      ETLLRRAFADQQAQAGRVA-EKSVQYNILKREVDTNKQLYEGLLQRLKEAGMS-A--GMK
A0A1F2QQH9      ETLLRRAFADQQAQAGRVA-EKSVQYNILKREVDTNKQLYEGLLQRLKEAGMS-A--GMK
A0A1F2QXK7      ETLLRRAFADQQAQAGRVA-EKSVQYNILKREVDTNKQLYEGLLQRLKEAGMS-A--GMK
A0A2V9DEM9      ENLVAQAFAEQQKQANLIA-GRSVQYNILKREVETNQQLYEGLLQRLKEAGVS-A--GLK
A0A2V9CYQ5      ESLLRHELAEQQKQIDLIA-EKSVQYNIRKREVDANKQVYEGLLQQLKSAGLA-A--SLK
A0A2V9BWU8      EELVKQALDDQQKQVNVIA-EKAVQYNILKREVETNRQLYEGLLQRLKEAGVS-A--SLK
A0A2V8ZG48      ESLVKQALDEQQKQVNLIA-EKAVQYNILKREVDTNRQLYEGLLQRLKEAGVS-A--SLK
A0A2V8Y334      ESLVKEALDGQQKQVNLIA-EKAVQYNILKREVETNKQLYEGLLQRLKEAGVS-A--SLK
A0A2V9AY68      EGLVKGALDTQQNQVNVIA-EKAVQYNILKREVETNKQLYEGLLQRLKEAGVS-A--SLK
A0A257VBK0      RANLAQEVDGARREGLQFV-EGLSRGEGLNTSSAAIKKYMDLLYDKMSELNVSSSLM---
A0A2V7XDY0      ESELRGAIDTEKAQAASQS-RKAAELDAIKKEAESAKGLYDVLLQKLNETDIAASIR---
A0A350UQT3      EKMLERSVNETKAEYDTLN-FRSFEYQRAKREAEADKNLYDELVRKIREAGINAGFQ---
A0A2U3JZ71      ESMLRKTVSETKAEFDALN-ARSFEYQSLKREAEADKTLYEELVRKIREASINSGFQ---
A0A2V8TTB0      EAMLEKAVAETKAEFDRLN-ARSFEYQTLKREAESDKKLYEELVRKIKEAGINASFQ---
A0A1F2TCR2      ERSFASSLEDQKRVAMDLD-RKSTDYSMLQRQADGDRKMYDTLLQEQKSLQVISNSR---
A0A2N9LQU7      ESLLRDQFEHQRQEAFNLN-ASAVQFATLKHEVESSQELSDTLQLKLKEAGLMAGLA---
A0A2P6WFK7      EAALRNQFNKQKEEAFKLN-EHAVQYLVLKHDVENSRDLYDTLQLKLKMAGVTAGLS---
A0A1F2V330      ERALESEMGRLQRRVQSTP-QHEIAITELTRGYEATKTRYNALLAKQQEAGLASRPERMN
A0A2V8U914      QTGLASVYARQSALVSKMT-AKMTHYNTLKHEVDTNRQFYEAMLQKVNEAGLASAVR---
A0A2V7W309      EGSVRSAYEQQRTEAQRLN-VDAAKYFDLRMAVDSKQTLLAALQKQLNETQVTARLRGSA
A0A2V8TLH7      ESKLAVAINETRSESLRVN-QKASNYELMRTEALDTKRIYDLISARVKEIDLSASLL---
A0A1Q7ZJT1      EAKLIKATDETRTESLQVN-RKASGYEMVRGEATETKRIYDLISARVKEIDLSSSLL---
A0A2V8VC99      EAKLIKVSDDTRAESLQVN-RKASSYEMVRGEEAETKRIYDLISIRVKEIDLSSSLM---
A0A348UZU3      EASLKELFEQQKEEAFRLN-SNAILYNSLKIELENKKNLLESLLKRQSETGVSARLKGLR
Q01XL7          EKLLSGAYNAQTHAVGAQA-DKASQYAMLKRDAEMAQQVYNGLLQQANQAALIALVP---
A0A2V8ERZ5      EQTLARNLDGAKSEAQDLN-RKGIGYGVMEREAKSNREVYQSLLTREKELRVSANSR---
A0A2V8GTX0      EKQLSADLEGQKAQATDLN-RKSIDYSVLQREAESNRQVYESLLQREKELRVVSNSR---
A0A2V8J0X9      ERSFSSQLEEQKGASMDLD-RKSGDYKLLQRKADSDRQVYQSLLSQQKELAVVANSR---
A0A372IRG7      EGLLQQRLDDTKQQAFHEN-ESAAQFEILQHGAESASELYDALQMKLKEAGITAGLN---
A0A1F2U158      ERTFAANLEEAKKDVQDLG-RKSVSYNVLEREARSNRTVYESLLQRENELRVSSNSR---
A0A2V8F6S9      EQTIARGLESAKADAQNLS-RLGVDYNVMQRDAQTNRTIYDTLLARQKELTVSSNSR---
A0A1I6MH75      EQQTSAALEQQKTDAYKLR-DDLVEYTLKAREYETTRTLYDGLVSRLRTASVQAGLE---
E8WVF6          ETQTTAALEAEKQDAYSLR-DAQVEYTLRLREFESNRTLYEGLLQKLRTAGVEAGLE---
A0A1H5Z7N3      EQQTRGALEAEKSTAYQLR-DQMVQYTLRQREYETNRQLYDGLLQRLRSAAVEAGLE---
A0A1G7JVV8      EAQTEGALEDQKNQSYRLR-DDLVEYTLRQRDYETNRALYEALLAKLRSASVQAGLD---
A0A1H4T6W9      EDQTSSALEEQKQESYRLR-DDLVEYTLRQRDYEANRTLYESLLSKLRAASVQAGLD---
I3ZEU5          EDQTTSALEQQKQESYRLR-DDLVEYTLRQRDYEANRTLYESLLSKLRAASIQAGLD---
A0A428MDU2      EDQTSAALEKQKSDAYKLR-DDLVEYTVRQRDFESNRTLYEGLLQRLRTAGVQAGLE---
A0A239HDF6      EEKTNAALDAQKADAYKLR-DDLVEYTLRQREFESNRTLYEGLLQRLRTAGIQAGLE---
A0A1Q3QQB6      EVQTKAALEQQKTDAYKLR-DDLIEYTLRQREFESNRTLYEGLLQRLRTAGVEAGLE---
A0A3N1K1G7      EDQTAAVLEAQKTDAYKLR-DDLVEYTLRQREFESNRTLYEGLLQRLRTAGVQAGLE---
A0A2W0BGU4      EQLLGATLAEQKKESGNFN-RLLIEHDLLKGDFEANQQLYQRLLQRVKDATVIAGLS---
A0A2W0BVQ9      EQLLGATLAEQKKESGNFN-RLLIEHDLLKGDFEANQQLYQRLLQRVKDATVIAGLS---
A0A3D1ASD2      EQMLKQELARTKSESDALN-ARSFGYEELKREAEADKKLYDELIRKIKEASINANFQ---
A0A2N9MK30      EEMLKKAVTETKAEFDRLN-ARSFEYESLKHEAEADKKLYEELITKIREAEINAGFQ---
A0A2V9MN96      ETLLTSAFDHQKQEANQLN-ESGIEYTALRRDADSNRQLYQSLLQRLKEASVTAGLR---
E8UZE1          ENKLRAATEAQKQQIFSMN-EDALHYSILQGQVASGRALYQDLTRKLQEAQITSGLS---
A0A2V7V2Z1      EASVASALEAAKAEALDLS-RRSVQYDTAKREAEAGKEVLNSLLSRHKQTDVAQELK---
A0A2V7X2F7      EASLAAALESTKEEIQELG-ARSGHYDSVKREVEASRAVLNSLTERHKETDVAQELK---
A0A2V7V2I1      EHGVADALEMAKREALELS-RRGVQYDSLKRELDASKEVLNSLMARHKQTDVAQELK---
A0A2V7U3M2      EASVSSALEAAKAEALDLS-RRSVQYDNAKREADAGKEVLNSLLSRHKQTDVAQELK---
A0A2V7UHT0      EASVSSALEAAKEEALDLS-RRSVQYDNAKREADAGKEVLNSLLSRHKQTDVAQELK---
A0A2Z5FVL3      ESGAKQLYDAEKQRADEMN-DKAVQYSMARQQADQSRSLYEKLQSRMKEAGVLEGFH---
A0A1V6HR88      EAALAAEINSLKVENREVN-SASIEYNNLRLEIDTRRQLLDEMLRKQSETDVSSRLQATR
A0A3E0P0A3      ERSLEREYEAMKEETRRYQ-SASTALQNLTGDIAAKRETLDRLRRSQSQANISASSG---
A0A2V9KBD6      ERMLRAALEKQKQVADDLD-AHAVQSEILKHEFETNRKLYEDLLQKQKELGITASLK---
A0A2W0AJ66      ERMLRNALETQKQAADTLN-ANAIQYNILKRDVDTNRKLYEDLLEKQKELGISATLK---
A0A1Q7RBU1      ERMLRSALEAQKQAADKLN-ANAIQNNILKHEFETNRKLYEDLLQKQKEMAISASLK---
A0A2V9JPV9      ERMLRYALEAQKQAADELN-ANAIQYDILKHEFETNRKLYEDLLQKQKEVGISASLK---
A0A2V8EXP2      EQSLINVLDQQKREALALN-RKGIDYSALQRDALSNRQIFESLLQRTKETGISGELK---
A0A2W4RYA1      ENNLLAALAQQEREAQQLN-AKAVEYRVLERNAQSARQLYDSLLQRAQETGVSGELR---
G8P0Y7          EQMLQEALGEQMGIADQLN-QNAIEYKILKQEADSNRQIYDGLLQQLKEASLAAGLT---
A0A3D4VGU2      QNLLEARLENTKQQAFKQN-ESSAQFEILKHKAQTSSELYDALQLRLEEAGITAGLN---
C1F294          QNLLEARLENTKQQAFKQN-ESSAQFEILKHKAQTSSELYDALQLRLEEAGITAGLN---
A0A3P0X3W6      EKMLAATLAAAKAQSDALS-LKSLEYQQLKRDADANKTLYNELFQKIKEAGINSGFQ---
A0A1E3Y9R6      EAALQQSLAGQQRESLGLD-RQMLDYSALEREAQSNRQLYENLLARAKETGAAGEYR---
A0A2W4TLP2      ERALQQSLDQQQRESLGLD-RRMLEYAALEREALSNRQLYENLMARAKETGAAADYR---
A0A3R9WF43      ENSIKGQFEKQQHEAIQLA-DNTVQLQVLAQEAYSNRALYQNLFSKLQEASLSSGVR---
A0A317HKM4      EQALEAALDRSKREVQALN-AKAVEYSALEREAASNREVLDKLLQRSTEARLARELE---
A0A2W0C122      EQKLRAAFEAQKVEANRLN-VSAIQYGLLRRESEANRQLYDNLEERMKEAGVAAGLR---
A0A2W0AUU7      EQKLRAAFEAQKIEANKLN-ESAIQYGLLKRESEANRQLYDTLEERMKEAGVTAGLR---
A0A2W0BQL1      EQKLRAAFEAQKIEANKLN-ESAIQYGLLKRESEANRQLYDTLEERMKEAGVTAGLR---
A0A3P0XH15      ENLMRKRLEDAKQQAYQQN-RSSAEYQILRHGADSASDLYDALQTRLKEAGITAGLN---
A0A3M1WQW8      EENLRAELMAQRAETLRQN-ERAINLSIKQQQVEASAELYRSLLQKMNDVDLLSTLT---
A0A3N1JHC1      QQLLKQQYDRQLAVVTDQG-SKQVRFNMLKHEVDVNEQVYQSMLQKAKEAGVIAALR---
A0A2V9KA79      QRDLTAQLETYRSRVQSTP-THAGALADMTRDLESTRTQYQSLLDKQQQATLASKRGKVE
G8P085          QSSLQQQYDEQTDKAYALN-RKAAEFAVLYAEGSSSRELYNTLQYKLQQAGVDAGLQ---
Q1ILD9          ENKIKGNFDQHQQEALSKS-QNFSEYSRLRREVDTSRDIYDDLLRKLREAGVMASLK---
Q1IJZ6          EDALRQAYEKQEQEANKIN-DSQIRLAVLQQEADSTRQLYETLYGRLEVSKLDEGIK---
A0A2V8TCE6      EERLGKLLEEQKSEAQRTG-RDSIEYATLQAEVERKRAVLNALLQRQNETAVSSQLRDMN
Q1ITG0          EDQLRASVENRKKEAFSQS-AKFSQYDILKNEVASGRSLYEDLLRKLNEAGIAAGLK---
A0A3N5PCI5      EKELTAELDAQKSRALALN-RQGIEYGVLLREVESNRQIYQNLLQRSNETAVSKDIQ---
A0A3M1Q0S9      AEGLRRLYEETEQRVSELQ-QAFVEYEARKAEIDRKQATLRELLDRKNQMTLSASLAEDR
A0A3M1VZ38      EQQLAQLLADATREASEAD-RAMIEYEARSLELERKKATLNELIAKENEMEQSANLGDT-
A0A3M1PY35      EARLQALFQQELAATDALQ-RRAQDYDRLYREYEQKRQVLDRLLARREEIGIAKDLRSIL
A0A3M1VMP2      EARLQRLIEEEQARAAQLQ-LATGELEALRSLYKQKREALDRLLARREEVAVTRDLQSIL
                                                                            

A0A2V7YYV7      --VL----VPVSPAVVP--DRPVSPTKALNISIAFGAGLLLAVGLAYLLERL-DQS-I--
A0A2V7Z0J5      --TF----VVLSPAVLP--KNPVSPNKALNVAVAFVAGLLLALGLALLFDYL-DQS-I--
A0A2V7Z3M4      --DF----VVLSPAVLP--SKPVSPNKVLNVAIALMAGLLLALGVAFLLDYL-DQS-I--
A0A3M2D9H8      TPEV----VQVEEARVP--SRPVRPQTATNVLLGGILGLILAGGIVFLIEYL-DDS-I--
A0A399Y5V2      --SA----ETVAPATLP--TAPVEPKLSRKVIFALTIGILLGAGIAFLVEYL-DDS-L--
Q01X01          --NV----RLVDPAQPA--THHHKPNVPLNLLFGLFGGLALATGYVMLQEQT-NSA-L--
A0A2V7VMF7      TNNA----SVVERASPP--LAPVWPNKRKMAGVGILVGVALGLGLVLLRDFL-SNT-V--
A0A2V8JK38      ASNI----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSAVFQEYI-DRS-I--
A0A2V9IXG5      TSNI----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALVVLGEVI-NPR-V--
A0A2V9J2P4      TSNI----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALVVLGEVI-NPR-V--
A0A192WQ77      TNNV----RVLDEAIIP--DTPIRPRKKVALMIGGLVGMFLGIGLVFFLDYL-DNT-F--
A0A1Q7RLS4      SNNL----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAIFFLDYM-DNT-V--
A0A2V2R525      PNNI----RVADYANTP--ERPIGPQRTRGVGLAFAFSLAFGIGLALLRELS-NNT-V--
A0A321LPW6      SSAL----HVIEPAEVP--TFPVDAKRLQGVLIALFVSLCAGLIFAFLLEYL-DNT-I--
A0A2V9R9V4      QSNI----RIISPARVP--KEPVSPNRQRTILIGLLLSLSGGIGLAWLLERF-DDS-I--
A0A321LE75      HNNM----RVIEPAQPP--GGPIGPNRMRGILIGLFLSLVAGIGLAFVLEYF-DNT-I--
A0A2V8R8U7      GTDV----SVSNYSRTP--QL-VGPQRMRNIMIAFVLALVAGIGLAFLIDYL-DDT-V--
A0A2V8QMP4      SGNV----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLAFLLDYL-DDT-L--
A0A2V8R4S3      SGNV----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLAFLLDYL-DDT-L--
A0A2V8NJ55      GNNV----TVATPARLP--RGPVGPARSRNIIVAFLLSLGVGIGLAFLLDYL-DDT-V--
A0A2V8Q7I0      ANEV----SIENYSRIP--RSPIGPARLRNVMIAFVLSLVAGIGLAFLLDFL-DDT-V--
A0A2V8S6K4      SNNV----IIQTPARTP--QL-VGPPRVRNIIIALLLALGAGIGLAFLLDYL-DDT-L--
A0A317I2L9      GNEV----SVENYSRVP--KAPIGPARIRNVMIAFLLSLVAGIGLAFLLDFL-DDT-V--
A0A2V8LLF9      ASEV----SIANYSRLP--HEPVGPARLRTIILALVMSLLVGIGLAFLLDFL-DDT-L--
A0A352FRF4      GTNV----SVSNPSRLP--RAPVGPARLKTILIALILSLVAGIGLAFLLDFL-DDT-I--
A0A2V8MKV0      GTNV----SVVSYSRLP--HEPTGPPRTRNILLALALALLAGIGLAFLLDFL-DDT-V--
A0A2V8PYY8      GTNV----SVVSYSRLP--HEPVGPQRTRNILVALALAFLAGIGLAFLLDFL-DDT-V--
A0A1Q7YKQ8      TNNV----SVSQYSREP--RAPVGPPRLRNILIAFLLSLGAGIGLAFLLDYL-DDT-L--
A0A352F3R7      SNEV----NIATYSRLP--KEPIGPQRLRNIFIAFLLSLGAGIGLAFLLDFL-DDT-V--
A0A0B6WXT1      ANNI----TVATPARVP--REPVGPKRLRNILIALLVALGAGIGLAFLLDYL-DDT-L--
A0A3B9MEU8      SNEV----SIPTPSRLP--KTPVGPQRLRNIFVALLLSLGAGIGLAFLLDFL-DDT-L--
A0A2V8MHG6      PNNV----HVVDHAAIP--KTPIGPKRMQAIALAALFALILGIALARYLDYM-DDS-V--
A0A2V8P7N1      PNNV----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALARYLDYM-DDS-V--
A0A2V8M3M6      PNNV----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALARYLDYM-DDS-V--
A0A1Q7NJH5      PNNV----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALAHYLDYM-DDS-V--
A0A2V8PJY0      PNNV----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALAHYLDYM-DDS-V--
A0A1Q7Y6W9      PNNI----HIVDYALVP--DGPVGPNRTRVVMLALVLSFGFGIGFALFLDYL-DDT-V--
A0A2V8NC68      PNNI----HVLDYSPQP--KVPVGPHRMQGILLASLFSLVFGVALARYLDYL-DDS-V--
A0A399WK13      DNNI----TVTEPAVPS--NIPVSPRRLTTVLGALFLSTLFGVGLALFLEYL-DDT-V--
A0A352FLX4      PNNI----RVVDYAIAG--KKPVAPRRVLTVALAFLFSIGCGIGLAFIIEYL-DDS-V--
A0A2V8RTL7      DNNI----SVASFGIPP--EAPVAPRRLMTVVAALLLSSLFGMGLALFLEYL-DDT-I--
A0A3E0PCJ6      ENNI----SVAEIAIPP--ERPVSPRRLTTVAVVMMLSLLFGAGLALFLEYL-DDS-I--
A0A3M1S4R8      TNNI----SVVDLAIPP--DTPVSPRRLLTVMMALFLSTCFGVGLAFFLEYL-DDT-I--
A0A1Q7YFI6      PNNV----HVLDYAPIP--KSPVGPRRMQGVALGFLFSLVIGIALARYLDYL-DDT-L--
A0A136KC10      DNNI----SVTEPAVPS--NIPVSPRRLATVLGALFLSTLFGMGLALFLEYL-DDT-V--
A0A2V8SEX6      DNNI----SVAGFAIPP--EHAVSPSRLMTVFAALFLSTLFGMGLALFLEYL-DDT-I--
A0A3M2D6Y5      ENNI----SVVDPAIPP--DTPVSPRRLLTVMMAFFLSIVFGVGLSLFLEYL-DDS-V--
A0A0B6WWQ6      ANNI----HIVEYAFPP--NRPIGPARLQAVGLAIVLGLAVGIGLAIFLDYL-DDS-L--
A0A3B9MK99      PNNI----SIVDYAVTP--DGPIGPNRSSTVSMALFLSLGLGVGLALLLEYF-DDT-L--
A0A352EX26      PNNI----SVVDYAITP--AGPVGPNRMRTVALALFLSLGLGVGLALFLEYL-DDT-V--
A0A2V8MM59      PNNI----SIVDYAIQP--DGPVGPARMRSVMLALVLSLALGVGLALFLEYL-DDS-V--
A0A2V8PFE8      PNNI----SIVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLALFLEYL-DDS-I--
A0A2V8PWS6      PNNI----SVVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLALFLEYL-DDS-I--
A0A2V8LCT5      PNNI----SVVDYAIVP--DFPVGPGRMRTVMLAFVLSLGLGIALALFLEYL-DDT-V--
A0A352FTJ9      PNNI----SVVDYAIVP--DFPVGPARLRTVMLAFLLALGFGAALALFLEYL-DDT-V--
A0A2V8G155      TSNI----SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLAFFFEHF-DNR-I--
A0A2V8HDM7      TSNI----SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLAFFFEHF-DNR-I--
A0A2V8DRT9      VSNI----RIVDAAELP--QVPASPDKPLNVLLAILGGSIMAVGLAFFFEYC-DNR-I--
A0A2V7VYF3      ATNV----RIVDAAEVP--RSPAGPNTRTDFLLAVLVGGVVAVGFVFGLEYL-DNR-I--
A0A1F2SVH2      TSNI----RVVDAAETP--RGPVRPNTRNNLLLALFGGATLAVGLAFFFEYL-DNR-I--
A0A2V8AJG9      TSNI----RVVDAAEVP--RRPASPNVPTNLLLAFFGGGTLALGLAFFFEYL-DNR-I--
A0A2G6PYV5      --------VIVEHARLP--HSPYAPSLKRHLFSGFIIAAGLAGLLIFLIEIT-DRK-I--
A0A2V8F956      TSNI----RVVDRAQTP--TEPVSPQKGLNLLLALFGGSLLACGLVFFFEHI-DSR-I--
A0A1F2S1W5      TGNI----RVVDLAENP--TGPISPNIFNSLLMALLGGLTLAVGLAFGLEYA-DDR-I--
A0A1F2T595      TGNI----RVVDPAEMP--TGPVSPNIINNLLLALFGGMVLAVGLAFTLEYA-DDR-I--
A0A2V8JQV5      ANNV----NIVDPARPP--GGAYKPDVYMYAMLGLATGVFLGLMLIVRQEQA-DRS-I--
A0A2V9AC41      SSNI----YLMGKAEPP--GGPSYPDKNGILLRGLFLGLLMGVGLAFLFDQL-DNT-I--
A0A2V8K4L4      ASNF----RIVDLAKPA--GAPYKPNLMNNAMLGSMAGIFLGVVLVLLKEQA-DRS-I--
A0A2V8NCZ3      ASNF----RIVDLAKPA--NLPYKPSPVNNAILGLMAGIFVGVVLVLLREQA-DRS-I--
A0A2V9MAM9      PSNI----RVVGPAQPA--LQPYKPNFLLNVAIGLFGGLVLAIGCVTVVNQAEAGR-S--
A0A2V9M454      ATNI----RIIDEATIP--SFPVRPNRPRNIEFALAAGLILGIALAFTREALD-NS-I--
A0A2V9IVR7      -------------------GAPVRPRKLFNVTIGLLVGLILGVALAFVQEALD-DS-I--
A0A2V9ILE2      ATNI----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALAFVQEALD-DS-I--
A0A2V9LGY4      ATNI----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALAFVQEALD-DS-I--
A0A2V9J4D6      ATNI----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFAFLEEQLEQKT-V--
A0A2V9L9C5      ATNI----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFAFLEEQLEQKT-V--
A0A2N9M9N1      ATSV----RLADAALVP--ATPIRPDKRVDIAVGLLVGLILGVTLAFIREGLD-RT-V--
A0A2V9JEC4      AASV----RVADRARVP--AVPVRPDTRRNFPLFAFAGLVIGVTLAFAQEALN-NS-I--
A0A2V9LPQ3      ATNI----HIVDTASPP--AVPVRPNKLLNLMLGLVAGGLLGLVLAFAEEGLERRS-I--
A0A348V070      ALNV----WIVDRASPP--VNPSFPNRRKTFIIGVLLALIGGAGTSLFINYL-VAT-V--
A0A2Z5G3A3      STNV----SVVDPGRSP--AKPTKPNIPLFLGGGLASGLFLGFCAALLFDTT-DTK-I--
A0A2V7UGP8      TGNV----WVVDAAEIP--DRIFRPNKKMNILLSLFVGLALGVGMAFFLEYL-DNS-I--
A0A239MKT6      STDM----VIVDPARPP--SLNSSPNASRLLATGTAAGLLLGLLIGIALHLR-DRF-L--
A0A3E0PCN7      PNNV----NLVDRAQPP--SAPQGPNRSRAVLMAFVASLIGGIGLAFVLNWL-DDT-V--
A0A2V8IYW3      KQQVGEQFKVLDPARVP--ERPFSPKRLQLNLTAIGIGLMLGMAVSALLEYR-DTS-L--
G2LEI9          LNNI----TVVDRAGTP--GAPISPRVSYTLSVAFFLSLFGGVGLAFAREYL-NTR-I--
A0A317J121      MGTI----RLVDPSTPP--AKPYKPRPALNIAFGTMAGLFLSVGIAFLWERM-DKS-V--
A0A2V7YW66      QSNI----RIIDKALVP--GGPFRPSLRQDVTYGLLLGLLAGLGLAVLIELM-DRT-V--
A0A2V7Z0V0      QSNI----RIIDKATVP--GGPFQPSLRKDGSYGLLLGLLFGVGCAVLIEVL-DRT-V--
A0A2V8GFD4      TSNV----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFGFVIEAL-DTC-L--
A0A2V8HSS5      TSNV----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFGFVIEAL-DTC-L--
A0A2V8KP55      ASNI----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSAVFQEYI-DRS-I--
A0A399WNU1      PNNV----HVVDRALVP--GAPSGPQRTKNVVIAFFASLFGGIAIAFGLNWL-DDT-I--
A0A2V9CG11      ASNV----LVIDHAEVP--RLPYKPNLPMNAALGMFGGFFLALGLVLFRERL-DRR-I--
A0A2V2R0I6      SSNI----RVVDPAMIP--SYPSRPAKARNLALAFLVGLVGGVGLALLREYL-DNT-V--
A0A2V8XAR9      SSNI----RIVDPAMIP--STPSRPAKARNITLAFLVGLVGGIGLALMREYL-DNT-V--
A0A2V8VZA0      SSNI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLALMREYL-DNT-V--
A0A1Q7CB82      SSNI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLALMREYL-DNT-V--
A0A2V8WIU1      SSNI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLALMREYL-DNT-V--
A0A1Q6Y9F5      SSNI----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLALMREYL-DNT-V--
A0A2V9EVV8      SSNI----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLALMREYL-DNT-V--
A0A2V8YF91      SSNI----RIIDPAMVP--TSPARPAKTKNITLAFLVGLVGGIGLALLREYL-DNT-V--
A0A2V8XZK2      SSNI----RIVDPAMVP--TSPARPAKARNIMLAFLVGLIGGIGLALMREYL-DNT-V--
A0A2V8ZTX6      SSNT------------------------KNIILSFLVGLVGGIGLALLREYL-DNT-V--
A0A2V9BT79      SSNI----RVVDPAMVP--ATPARPAKGKNIMLSFLAGLVGGIGLALLREYL-DNT-V--
A0A1Q8B793      SSNI----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLALLREYM-DNT-V--
A0A2V9BCA0      SSNI----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLALLREYM-DNT-V--
A0A2V9BWU9      SSNI----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLALLREYL-DNT-V--
A0A2V9DKX2      SSNI----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLALLREYL-DNT-V--
A0A2V9JSI3      ATNI----HVVDPALPP--AAPIRPKKTQNIAMGLLGGLALGVMLALFADVL-DNS-V--
A0A2V9WI32      SSNI----RIVDVARVP--TSPSAPNIPRDIVLGLALGLFGGIGLAFVLESL-DNT-V--
A0A2V8IVN9      TSNI----RVVDPAERP--RKPSSPQYALNLLLGLLGGTMLGVGLAFFFEYL-DSH-I--
A0A1F2TPT3      PSRI----RILDAATVP--SSPVGPDKGRSILGAVFAGLGLALVLAFGFEYL-DNR-I--
A0A2V8JTQ2      SSNI----WIVDPARPP--KLPAEPNILRNLALSLLFGICGGVWLSFGLAKIEEKT-I--
A0A2V8UZY0      SSNI----WIVDPARPP--KLPVEPDIRRNFALSLLFGIFGGVLLAFGLAKVNEKT-I--
A0A3N5YNR8      ASNI----HVVDHAEVP--ETPYSPQRAGDLALGLGVGLFLAIGLAFLMEYL-DNT-L--
A0A350UEK1      ASNV----RVVDEAQPP--ERPYKPSLPLNAVLGLLAGGFLAVGFVVTTEKA-DRA-L--
A0A350UIQ4      ASNV----RIVDPAKAP--ERPYKPRLPLNALLGLLAGGFLAVAFVVTTEKA-DRA-L--
A0A3N6A5T6      SSNI----NVVDRGETP--RRVYRPRTAINLALGLILGLMLGVSMAFFIDYL-DNT-I--
A0A1F2Q9L4      DSNI----VVVDRALVP--GGPYRPSLRRNLGLGLVLGLALGLGFVFFLEYL-DRS-V--
A0A1H5SQF5      SSNV----TIVNPARVP--SGPSRPQPVQNIALGFLAGLATGLFLAFATAYH-NDV-L--
A0A2Z5G448      SNNV----NLVDKAEVP--AFAVAPKKRTNYGFGALIGLFIGIAAALFLETL-DDT-I--
A0A3E0NV31      KEGI----RISIPATRP--NSQYAPNKTRSTLFALGIGLALGIAAALGLEFL-DQT-V--
A0A3N5M5V0      TSNI----HIVDHAQVP--TAPYSPQRAADLALGFGVGLLIAVGLAFLMEYL-DNT-L--
A0A2V9AEW6      DSNV----MVIDRARPP--KLPYRPSLPMNSAIGLLGGMFLGLGFVLLRERL-DRR-I--
A0A2V8WQK6      DSNV----LVVDRAKPP--LLPYRPSLPVNSAIGLFSGVFLGFGFVLLRERI-DRR-I--
A0A2V8XIF4      DSNV----LVVDRAKPP--LLPYRPSFPMNSAIGLFSGLFLGFGFVILRDRL-DRR-I--
A0A3N5XQP8      SNNI----QIVDRARTP--LNTWWPRRTMNLALAFLGGLFLGLGLAVTLHLL-DNR-V--
A0A2Z5G7H4      SSNI----TVVDPGRIP--STPKQPNIPVYLAIAAGVGLFLGVCGAFISDSI-DDK-I--
A0A2V9KCS3      ASNM----RVVDPAKAP--RLPYKPNLLQHAGVGFIAGLLLGTVFVVIQEQA-DRS-L--
A0A2U3KC61      SSNI----RVVDFARTP--TSPITPNVPRNIELGLLLGLACGIGLAFVLESL-DTS-I--
A0A2V9Y2R7      SSNI----RVVDVARTP--MFPVKPDVPRNIKLGFILGLCLGVGLAFVLESC-DNT-V--
A0A372IT17      TSSF----SIVNPARIPPGNHPKSPNLPLYYAAALGAGLFLGCAGAITCEFT-DRS-I--
A0A136JPP4      PNNI----KISERAEAP--TYPVGPNRARNIFIALLASLGAGIGLAFLLDYL-DDS-I--
A0A399WUJ8      PNNI----KISNRAVVP--TSPDGPKRARNIFIALLASLGAGIGLAFLLDYL-DDS-V--
A0A2V9L5B5      ASNI----RVVDAAEAP--KYPAKPRVLLNLVLGLILGLGLGVGMAFFQEYL-DKT-L--
A0A2V9L7I0      ASNV----RIVDAAEIP--KGPAKPRVLLNLILGLVVGLALGVGVAFLQEHL-DKT-L--
A0A2V9LK56      ASNI----RIVDAAEVP--RRPVRPRVILNLALGIIFGLGLGVAGVILLEYL-DNT-L--
A0A2V9YHT3      SSNI----RIVDSARPP--VLPSQPDVPRNLLLGLAAGLIAGVVLAFGAEVM-DST-I--
A0A2V9NGH6      SNNI----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLAFLLEGI-DNT-V--
A0A2V9PYE6      SNNI----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLAFLLEGI-DNT-V--
A0A2V9NL07      SNNI----RQVDIARTP--AGPAEPNIPRNLGFALALGLTSGIGLAFLLEGI-DNT-V--
A0A2V9QD92      SNNI----RQVDIARTP--AGPAEPNIPRNLGFALAFGLTSGIGLAFLLEGI-DNT-V--
A0A2V9WPZ6      SSNV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAFLLENL-DNT-V--
A0A2V9ZLH4      SNNV----KIVDAARVP--QAPSEPNIPRNLAFALLLGLTSGVGLAFLLENL-DNT-V--
A0A2V9RQF1      SNNI----RNVDIARAP--RSPAEPNVPRNLSFALALGITTGIGLAFLLEGI-DNT-V--
A0A2V9YDK8      SSNV----KIVNAARVP--MAPSEPNIPRNLAFALVLGLTSGVGLAFLLENL-DNT-V--
A0A2V9V8F7      SSNV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAFLLENL-DNT-V--
A0A2V9XGR9      SSNV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAFLLENL-DNT-V--
A0A2V9V3Q5      SNNF----RIVDPARSP--NAPVEPNIPRNLLFALVLGVSSGVGLAFLLEGM-DNT-V--
A0A2V9NWS3      SNNI----RNVDAARVP--SEPVEPNVPRNLAFALALGLSTGIGLAFLLEGV-DNT-V--
A0A2V9USA9      SNNF----RIVDTARVP--NGPIEPNIPRNLGFALVLGLMSGVGLAFLLEGL-DNT-V--
A0A2V9XW18      SNNF----RIVDSARPP--TGPIEPNVPRNLLFAAVLGLASGMGLAFLIEAL-DNT-V--
A0A3M2BZG9      ESNV----RVVDYAIVP--SAPFRPVLRKDLTTALLLGLLAGVGLILLIEFF-DRT-I--
A0A1Q7N5R7      TADV----RVLDAAVAP--RRPVKDSASRLIALGFLAGLGFGVVGAVLVDRL-DRR-V--
A0A3M1SIV3      PDNV----AVSTKASKP--DSPIGPPRNRNILISLIVSLFLGIGLAFLLDYL-DDS-V--
A0A3E0PHB0      PDNI----KVSGKA--Q--VNRTGPQRTRNILIALFISLAGGIGLTFLLDYL-DDS-I--
A0A3M2D491      PDNI----SIATEATKP--DAPIGPQRNRNILLAFLASLFVGIGLAFLFDYL-DDS-V--
A0A357F267      PDNI----KIAARAITP--KSPIGPQRNRNIFVAFMLSLAAGIGLAFLLDYL-DDS-V--
A0A353C9L6      PDNI----KIAANA-GG--AYPVGPQRSRNILVAFLLSLAAGLGLAFLLDYL-DDS-V--
A0A2V8RQV0      PENI----KIAANA-GP--AILVGPPRGRNIFVAFLFSLAAGIGLAFLMDYL-DDS-V--
A0A2V8SJH5      PENI----KIAANAVTP--GGPIGPARTRNILVAFLVSFGVGIGLAFLLDYL-DDS-V--
A0A2V9QB26      PSNV----RIIDAAEPP--EHPYKPNLPMNAAVGLLSGLCIGVAFVVTRGRA-DRT-F--
A0A2V9VYY4      SSNI----RIVDIARVP--TQPISPNVHRSLVLGFLLALGLGVGLALVRETF-DST-V--
A0A2V9KIE8      ASNI----RIVDQAETP--KLPVKPRVILNLALGFAFGLALGIGLAFFQEYL-DNT-V--
A0A352F549      PNNI----HVVDYAAIP--KGPVGPRRMQAVTLAMMLATAFGIALALFLEYL-DDT-V--
A0A3B9MLP9      PNNI----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALALFLEYL-DDT-I--
A0A3D5SQ87      PNNI----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALALFLEYL-DDT-I--
A0A2V8NW86      ATNV----RIIDAAEPP--KRPYKPSLPVNAAVGLLSGLCIGVAFLVTRGRA-DRT-L--
A0A2V8ZHL8      ATNI----HVVDPARPP--RVPVRPQKLLNIAIGLVVGLILGVTLAFVKEAL-DTS-I--
A0A2V9B240      ATNI----HVVDLARPP--KVPVRPQKLFNIAVSLVVGLILGVTLAFVKEAL-DSS-I--
A0A2V9CBM2      ASNI----LIVDPAEPP--AKPAKPKILLNLVLASILGLALGVGEAFLQERL-DDT-V--
A0A2V8XN17      ASNI----RLVDSAEPP--AKPVKPRTLLNLSVALFLGLALGICAALFQERM-DDT-L--
A0A2V8WX45      ASNI----RIVDSAEPP--ARPVKPRIALNLMVAAFLGLGLGVCAAFFQERM-DNT-L--
A0A1Q6YR79      ASNI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAALFQERM-DDT-L--
A0A1Q7VA32      ASNI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAALFQERM-DDT-L--
A0A2V9EY85      ASNI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAALFQERM-DDT-L--
A0A2V9H8K0      ASNI----RLVDSAQPP--AKPVTPRTLLNLAVAMFLGLGLGICTALFQERM-DDT-L--
A0A2V9FFE5      ASNI----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTALFQERM-DNT-L--
A0A2V9GM43      ASNI----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTALFQERM-DNT-L--
A0A1F2RFI7      ASNI----RVVDQAEVP--EMPAKPQKLVNLALALIFGLGLGVGMAFFQEYL-DNT-L--
A0A1F2RZS3      ASNV----RVVDPAEVP--TLPSKPRKLMNLALALMVGLSLGIGMAFFQEYL-DNT-L--
A0A1F2USE2      ASNI----RIVDSARPP--EKPAKPKVLLHLAMGFLLGLGLGVGAAFLQEYL-DNT-L--
A0A2V9C238      ASNI----RIVDAAEPP--KKPARPNLPLNLALAVLLGTGLGV----VQEHV-DNS-L--
A0A1F2Q9F5      ASHV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVFLQEHF-DNS-L--
A0A1F2QQH9      ASHV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVFLQEHF-DNS-L--
A0A1F2QXK7      ASHV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVFLQEHF-DNS-L--
A0A2V9DEM9      ASNI----RIVDAAEPP--KKPARPNLPLNLVLAVLLGTGLGVGAAFLQEHV-DNS-L--
A0A2V9CYQ5      ASNI----LIVDPAEPP--TKPAKPKILLNLLVASILGLALGVGEAFLQEHL-DDT-V--
A0A2V9BWU8      ASNI----RVVDSAEPP--ARPAKPRIPLNLAVAALLGLGLGISTAFLQERL-DDT-L--
A0A2V8ZG48      ASNI----RIVDSAVPP--AKPAKPKIPLNLAVATLLGLGLGISAAFLQERL-DDT-L--
A0A2V8Y334      ASNI----RIVDPADPP--AKPAKPRIPLNLAVGVLLGLGLGISTAFLQERL-DDT-L--
A0A2V9AY68      ASNI----RIVDSAEAP--AKPAKPKIPLNLAVASLLGLGLGISAAFLQERL-DDT-L--
A0A257VBK0      SSNV----RMVEPAQPP--MAPVKPNKRMNLLMGLLFGLMLSVGSIVAWQYL-DTS-V--
A0A2V7XDY0      SNNV----SVVERASAP--TSPIRPNKKRIAAVAGFLGLLLGVGLVIARDYL-DNT-I--
A0A350UQT3      NNMV----RIADAARPA--WKPVFPKLTLNLLLAFLFSSLLAVGAAILVDTL-DNT-I--
A0A2U3JZ71      NSAI----RIADLARPA--FKAVFPNIKLNVLLAFLLSTLLAIGTAICADLL-NNA-V--
A0A2V8TTB0      NSSI----RVADPARPG--LKPVFPLTWLNVLLAFLFATFLGVGAAVLTDVL-DNT-I--
A0A1F2TCR2      SNNV----QLMDRAEVP--AAPFTPNPRKDWFTAIMAGLLVGVGLAFGIEYL-DDT-V--
A0A2N9LQU7      SADI----SIVSRGMVA--ARPAFPKKSLMLPLGFLISVFGGLVFVFVLESF-DDS-L--
A0A2P6WFK7      SGYI----SIIDRAEIP--ATPVEPRIKRNLALGLFGGVIAGLLLAFGVEAL-DDT-L--
A0A1F2V330      KTVAF---RIVEPASLP--KGPSTPRRSRLLLVGLFVGLALGLAVAFVAEQM-DTT-F--
A0A2V8U914      QSNI----RLVAPAEPA--FRPYKPNLPLNLSIGLFAGLVLAVGSVMLTEQT-NSR-L--
A0A2V7W309      SSNV----HWVDHAETP--GSRINLSMKKNLQTAFPLGLFLGFAAIFFLEYM-DRS-I--
A0A2V8TLH7      SNNL----RVLDRAPLP--QMPIRPRPILNLLIGVMLGLLLGVGTVFFLDYM-DNT-V--
A0A1Q7ZJT1      SNNL----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAIFFLDYM-DNT-V--
A0A2V8VC99      SNNL----SILDKAPVP--KVPVRPRTVLNMAIGVLFGLLLGVGTVFFMDYM-DNT-V--
A0A348UZU3      TSNI----RIVDRADIP--LRPDSPRKFRNLLLALFLGLFGGLGLALGMEYL-DNT-V--
Q01XL7          ASNI----RVVDAAVAD--NIPSSPTPMRDIPTWSLFGGALCYGLLWFREVL-RRKRLTQ
A0A2V8ERZ5      TNNV----RLVDRAETP--RGPITAGGRRTVLMSLMIGLVLAVAVALGLDYM-NDT-I--
A0A2V8GTX0      ANNV----RLLDRSEVP--ESPFTPNTRRAWLMAILFGLGFGIAAAFAIDYL-DDT-V--
A0A2V8J0X9      ANNV----QVLDRADVP--PFPVSPNPRRDWMTAILAGLSIALGLAFGMEYL-DDS-V--
A0A372IRG7      SNNI----DVIDTAMIP--PYPVLPQKRQDATFGFLGGLIVGLILAVFLESM-DDT-L--
A0A1F2U158      ANNV----RVVERAEVP--AGPLTPTGRRTWLLSFAVGLVAAISVAYGLDYM-NDT-I--
A0A2V8F6S9      QNNV----RVIDHAELP--RGPMAPTGRRTWLLSLAVGLAIAVAVAYGLDYM-NDT-I--
A0A1I6MH75      STEI----DVVDLAMIP--ASPRLQPYSSVVLTACIFALLVGIILAFTLESL-DTG-L--
E8WVF6          SSEI----DIIDQAVPP--SDPQSTPQSTIILTYFAVSLVLGTLLAFLLESL-DTG-L--
A0A1H5Z7N3      STEI----EIVDNAVPP--VYPTLKPRSTILMIDLVVALIVGLIVAFVLDSL-DTG-L--
A0A1G7JVV8      ALEI----DVVDPAFKP--IGPTMTPRSSILSRDLILSLVFGIMLAFALESL-DTG-I--
A0A1H4T6W9      SLEI----DIVDQALKP--AAPSITPRSTILLRTLLISLVAGLMIAFTMESL-DTG-I--
I3ZEU5          SLEI----DIVDQALKP--AGPSMTPRSTILLRTVLIGLVAGLMIAFTMESL-DTG-I--
A0A428MDU2      SLEI----DVVDQALPP--ASPMLRPQSTIIMTSFVFGLLGGIVLAFLMESL-DTG-L--
A0A239HDF6      SLEI----DIVDQAVPP--ASPMLRPKSTLVLTTLAVAMILGVLIAFLLDTL-DTG-I--
A0A1Q3QQB6      SLEI----DVVDQALPP--AKPTLKRRSTVVLTGMVFGLLGGIIIAFIVESL-DTG-L--
A0A3N1K1G7      SLEI----DVVDQALPP--ANPVLRPQSTIILTMLFVGLIAGIIIAFLMESL-DTG-L--
A0A2W0BGU4      STNI----HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLAFIQDSL-DNS-L--
A0A2W0BVQ9      STNI----HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLAFIQDSL-DNS-L--
A0A3D1ASD2      TSNV----RIADSARPP--LKPVFPRTRLNVLIAFLFSTILAIGAAVMSDVL-DNT-L--
A0A2N9MK30      SNTV----RIADNARPG--LSPVFPNVPLNVGLALLFAAILAVGAAVLSDTL-DNT-I--
A0A2V9MN96      SSNI----RVIDVARLP--TGPAKPDVRRNIFLGFLLGLAGGVALAFLQESM-DTT-V--
E8UZE1          SDTI----SVIDPALTP--NIPSEPRRALNMEAGALLGLVVAFAVVFLIENA-NAT-I--
A0A2V7V2Z1      NSNI----RIVDPASVP--RGPVRPRTTRDILYGVFLGLALGIGLAFFLDYL-DNT-I--
A0A2V7X2F7      ASNI----RIVDPAVMP--NGPVRPNRQRDILTGALLGLVLAFGAAFFLEYL-DNT-L--
A0A2V7V2I1      ASNI----RIVDAAAVP--GSPVRPNRPSDIAMGLFLGLALGVMAAFFLEYL-DNS-I--
A0A2V7U3M2      NSNI----RIVDAASVP--RSPVRPQKTRDIAMGVALGLFLGIGLAFFLDYL-DNT-I--
A0A2V7UHT0      NSNI----RIVDGASVP--RGPVRPQKTRDIAMGLALGLFLGIGLAFFLDYL-DNT-I--
A0A2Z5FVL3      SSNI----TVVSPALAP--SAPSRPNIPLYLAGSLATGLLFGCIMAVVVDLM-DSK-I--
A0A1V6HR88      ESNV----RIVDRALVP--GGPFRPSLRRNVTFAGGAGLVLGFGLVLLLHYM-DRT-L--
A0A3E0P0A3      NQAIV---TQTERAVLP--TSPVSPSLRRHLPFGVALGLLCGVALVLLIDFL-DRS-I--
A0A2V9KBD6      SSNI----WIVDPARAP--KLPSEPNLVRNVALSLAFGLFGGMCLAFGLEKI-NEKTI--
A0A2W0AJ66      LSGL----RVIDPAQPP--KRPSEPNVPRNFGLSVGFGLVGGVLLAFGLAKM-HEP-I--
A0A1Q7RBU1      SSNI----WIVDPARPP--KLPAEPKILRNLALSLLFGIFGGVLLAFGLTKM-NEK-I--
A0A2V9JPV9      SSNI----WIVDPARPP--KRPAEPNILRNFALSLLFGIFGGVLLAFGLTKM-NET-I--
A0A2V8EXP2      TSNI----RVIDVAETP--RRPASPNVVANLLLALFGGLTLAVGIAFFFEYL-DNR-I--
A0A2W4RYA1      TSGI----RIVDPAVLP--RTPSSPRKVLNLSLGFVVAVLGALGLAFFFEYF-DNR-L--
G8P0Y7          SSNT----RVVDRARLP--RYPTKPNIPRNLEFALLVGLVVGIALAFGLEAL-DAT-V--
A0A3D4VGU2      SNSL----EVVDHANLP--VIPVTPQKKRTVVFGFLGGLIAGIAISLLLESL-DDT-L--
C1F294          SNSL----EVVDHANLP--VIPVTPQKKRTVVFGFLGGLIAGIAISLLLESL-DDT-L--
A0A3P0X3W6      NSSI----RIADEARPQ--NAPVFPKKGIFIFIGFFLSGVIAVAATLLSDMM-DKS-V--
A0A1E3Y9R6      GTAI----QVLDPATVP--SAPVLPRTPRDLLLAALAGGLLALGLAFGFEYF-DSR-I--
A0A2W4TLP2      GTSI----QVLDRAEVP--RVPVLPRTQRDLMLAALAGLVLAFGLAFGVEHF-DSR-I--
A0A3R9WF43      ATRI----DVVNEARPA--GTPSSPDYPKYLTLVAGIGIFLGISSAFVRESL-DES-I--
A0A317HKM4      STNI----RIVDSAEIP--TVPSLPRQTHNLMLAFAGSSSLALVLVFVLEVF-NTR-V--
A0A2W0C122      STNV----RLIDPAEAT--ELPVSPYLPRSSYLGLFLGFLLSAAVIGFRESM-DRA-L--
A0A2W0AUU7      STNI----RLIDPAGAT--GLPVSPNLRRTSCIGLFLGFLLSAAAIGIREGM-DRA-L--
A0A2W0BQL1      STNI----RLIDPAGAT--GLPVSPNLRRTSYIGLFLGFLLSAAAIGIREGM-DRA-L--
A0A3P0XH15      ATQI----DIVDRAVTP--ALPVFPVKRNDAAIGLAAGLVLGLALALFAETI-DDT-I--
A0A3M1WQW8      TTNI----QILDRAQVP--TTPARPRKLFTTGVSGLVGLLLGIVLALFVEYL-DNT-V--
A0A3N1JHC1      AANA----RVVSPAKAS--LIPTSPKLSICIFLAVLLGGVFSLLYILISERR-DNS-V--
A0A2V9KA79      TNVLW---RIADPARLP--SAPVTPGRVRILLLGLAAGLCLGLGLAVLAENL-DTT-F--
G8P085          SVNT----MRVDTARAP--LIPVEPKKLVILSFGLVLGLFAGVGSAFLREAL-SDK-L--
Q1ILD9          AANI----DVVDAAPVP--IKPVEPAMKLAMALGLIGGLFMGFAGVVVAEAV-DQS-L--
Q1IJZ6          STNV----AVISAGLPP--AKPSHPDPLVNGIVGLGGGLFVGLILAFVVETL-DDS-V--
A0A2V8TCE6      AGNA----RIVDRAIPP--TAPCKPRPGVELPLGLFVGLLLGMGAAFGMESW-DNT-L--
Q1ITG0          STNV----DVIDPSAVP--QLPVLPNVPLFIALGLFGGAFLGVCSAFVKESI-DQT-I--
A0A3N5PCI5      GPDI----QVVDAAEVP--RRPVRPDTRSTLMIGLLLSGILAVAIAFIREAF-DSR-L--
A0A3M1Q0S9      ALNI----RVIEKATPP--RMIFKPKKKLNVALGFLFGLFLGIGAAFVMEYV-DNT-I--
A0A3M1VZ38      AHNV----QIIDEAVPP--EIIYRPKKKLNILLGFLLGLCLGIGGAVLAEYI-DNT-I--
A0A3M1PY35      ERQV----SVVAPATPP--ERPAVPRYRLDLALSALLGLFLGIGAAFAAEAR-DNK-V--
A0A3M1VMP2      ERQV----HVVDRAKPP--KSPSAPRVKLNLALGLLLGLLLGVGGAFGAEAL-DVK-L--
                                                     .                      

A0A2V7YYV7      --KTNEDLTERLGLLPVGHIGYV-------------------------------------
A0A2V7Z0J5      --KSDAELTDRVGLISLGHVPFL-------------------------------------
A0A2V7Z3M4      --KSDQELTERLGLVPHGHIAFV-------------------------------------
A0A3M2D9H8      --RNGETVTKNLDLPVLGYISEM-------------------------------------
A0A399Y5V2      --RSKQDAEKAFGAPILGMIPRA-------------------------------------
Q01X01          --RSPGDAGAYLTLPELGAIPRAAKR----------------------------------
A0A2V7VMF7      --RDPEEIERYLHLDLLSAVPRYEA-----------------------------------
A0A2V8JK38      --KSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFGR--------------
A0A2V9IXG5      --KTVEEIQTSLSVPALGFLPRTKD-----------------------------------
A0A2V9J2P4      --KTVEEIQTSLSVPALGFLPRTKD-----------------------------------
A0A192WQ77      --RTPKDIEQHLGLSVLSVIPKHSEK----------------------------------
A0A1Q7RLS4      --RTSDDVEQYLRLNLLAIVPKEAD-----------------------------------
A0A2V2R525      --RTMSDVTRSIRLPTIAVVPTVKSWP---------------------------------
A0A321LPW6      --KTVDDVARFVRLPALGVIPMMTA-----------------------------------
A0A2V9R9V4      --RSVDDVNRYTQLPALAVIPVIGA-----------------------------------
A0A321LE75      --KSVEDVNRYAQLPALGIIPAITS-----------------------------------
A0A2V8R8U7      --KSLDDIDRYIHLPALALIPSVRS-----------------------------------
A0A2V8QMP4      --KSIEDVDRHLHLPTLALIPAPRE-----------------------------------
A0A2V8R4S3      --KSIEDVDRHLHLPTLALIPAPRE-----------------------------------
A0A2V8NJ55      --KSIEDVDRYIHLPALALIPGQRS-----------------------------------
A0A2V8Q7I0      --KSVDDIDRYVHLPALALIPASRG-----------------------------------
A0A2V8S6K4      --KSIEDVDRHVHLPTLALIPAPRE-----------------------------------
A0A317I2L9      --KSIEDIDRYVHLPALALIPASRS-----------------------------------
A0A2V8LLF9      --KSVDDVDRYLHLPALALIPTARN-----------------------------------
A0A352FRF4      --KSVDDVDRYINLPALALIPAVRN-----------------------------------
A0A2V8MKV0      --KSLDDVDRYIHLPTLALIPAARS-----------------------------------
A0A2V8PYY8      --KSLDDVDRYIHLPTLALIPAARS-----------------------------------
A0A1Q7YKQ8      --KSVEDVDRYLHLPALALIPSTRS-----------------------------------
A0A352F3R7      --KTVDDIDRYLHLPALALIPASRE-----------------------------------
A0A0B6WXT1      --KSAEDVERYLHLPTLALIPAPRT-----------------------------------
A0A3B9MEU8      --KSVDDVDRYLHLPALALIPSNRD-----------------------------------
A0A2V8MHG6      --RTSEDVENFLRLPALTVIPTIGNSA---------------------------------
A0A2V8P7N1      --RTSDDVENFLRLPALTVIPTVGNSA---------------------------------
A0A2V8M3M6      --RTSDDVENFLRLPALTVIPTVGNSA---------------------------------
A0A1Q7NJH5      --RTSEDVENFLRLPALTVIPTIGNSA---------------------------------
A0A2V8PJY0      --RTSEDVENFLRLPALTVIPTIGNSA---------------------------------
A0A1Q7Y6W9      --RTADDVEKVLRLPALGVIPSIEGKT---------------------------------
A0A2V8NC68      --RTVEDIERTLRLPSLAVIPAIGSLS---------------------------------
A0A399WK13      --RSTEEVESLLQLPALAAIPTIDSM----------------------------------
A0A352FLX4      --RSMEDVENLLRLPAIALIPQVGTVK---------------------------------
A0A2V8RTL7      --NTTEEVENLLQLPALTAIPTIDSI----------------------------------
A0A3E0PCJ6      --KTTEEAETYLQLPALAAIPTVEAS----------------------------------
A0A3M1S4R8      --KTAEDVENYLGLPVLVVIPSMNAA----------------------------------
A0A1Q7YFI6      --HSAAEVDEMLRLPTLAVIPAVGNA----------------------------------
A0A136KC10      --HSTEEVESLLHLPALAAIPTIQSM----------------------------------
A0A2V8SEX6      --RSTEEIETYLQLPALAAIPTIDSI----------------------------------
A0A3M2D6Y5      --KTVEDVETYLGLPALAVIPTIGVS----------------------------------
A0A0B6WWQ6      --QSAEEVERELHLPALAAIPTVS------------------------------------
A0A3B9MK99      --RSSEEVERLLQLPALGVIPSANASA---------------------------------
A0A352EX26      --HSTDEVERLLHLPALAVIPSANGMG---------------------------------
A0A2V8MM59      --HSTDDVERLLGLPALAVIPSMSGGST--------------------------------
A0A2V8PFE8      --HSTDDVEKFLRLPALAVIPSMSGGVA--------------------------------
A0A2V8PWS6      --HSTDDVEKFLRLPALAVIPSMSGGVA--------------------------------
A0A2V8LCT5      --HSTEDVEKFLRLPALAVIPAMGAASA--------------------------------
A0A352FTJ9      --HSTDDVERFLRLPALAVIPAMSSASA--------------------------------
A0A2V8G155      --KTPEEIQTHLRLASLGLVPAVRLKGS--------------------------------
A0A2V8HDM7      --KTPEEIQTHLRLASLGLVPAVRLKGS--------------------------------
A0A2V8DRT9      --KSPAEIKAHLGLPFIGMIPKMAVADG--------------------------------
A0A2V7VYF3      --KSPDEITAHLRMPCLGLVPAAPDKYA--------------------------------
A0A1F2SVH2      --KSPDEIKQHLGLPFLGMVPALFDKAL--------------------------------
A0A2V8AJG9      --KTPDEVKAHLGLPFLGMVPALFGDDV--------------------------------
A0A2G6PYV5      --HNTEVLEMVTVLPTLATIPKVSGFNK--------------------------------
A0A2V8F956      --KTPDEVTAHLQLPHLGLLPALNEKQF--------------------------------
A0A1F2S1W5      --KNPDEMKKHLGLPFLGMVPALFDKGA--------------------------------
A0A1F2T595      --KNPDELKKLLGLPFLGMIPALSGNRA--------------------------------
A0A2V8JQV5      --HAPAEAPVYLNVPELGVVLSAEADSS---------------------LGVPPESSPVR
A0A2V9AC41      --KSPEEAERFIQLPTLGVVPDFALLTG--------------------------------
A0A2V8K4L4      --QQPGDSSLYLGISELGVIPSDRPTML--------------------------------
A0A2V8NCZ3      --QQPGDSALYLGVSELGVIPSDRQG----------------------------------
A0A2V9MAM9      --REPGDVEARLNLVELGAIPSARSVVG--------------------------------
A0A2V9M454      --KNAQEIEKLTSLPTLSIVPLSHSSVL--------------------------------
A0A2V9IVR7      --KSIGQVERYLSTNALAVIPLARTVRS--------------------------------
A0A2V9ILE2      --KSIGQVERYLSTNALAVIPLARTVRS--------------------------------
A0A2V9LGY4      --KSIGQVERYLSTNALAVIPLARTVRS--------------------------------
A0A2V9J4D6      --KTMEDVQRLVGLPSLGLIPLWAPNHN--------------------------------
A0A2V9L9C5      --KTMEDVQRLVGLPSLGLIPLWAPNHN--------------------------------
A0A2N9M9N1      --KTAEDIENQIAIPTLAVIPLGTRSRG--------------------------------
A0A2V9JEC4      --RTPDDLEGSFSIRALTIVP--AVFSS--------------------------------
A0A2V9LPQ3      --RTPDDVERLLGIPALAIIPSASLLIR--------------------------------
A0A348V070      --KSSRDIAQATGWPTIGTIPAFEKEFK------PRGPRAEFRTLSGLLKGRPGILDKKK
A0A2Z5G3A3      --QDLDELELMLGGVPIGILPAFDRPAT--------------------------------
A0A2V7UGP8      --KSTSDVEKYVQLPTLGTIPMVVSSAL--------------------------------
A0A239MKT6      --YTIEDFQAAWSAPVIGVVPHFVENGQ--------------------------------
A0A3E0PCN7      --RADDNFELHEGVSVLGMVPGADRRLG--------------------------------
A0A2V8IYW3      --RTESQLLEALKIPVLAVLPVMESIDEKRRRMLRLAFTFTGGFLLVAARITETGVLMPE
G2LEI9          --KSVEDVDRLLNLPTLGLIPQVSPKEL--------------------------------
A0A317J121      --RTPGHSRTLLNVPELGVIPSIEPRGS--------------------------------
A0A2V7YW66      --KSPEEVERRLGLPPLAVIHDVTEMGK-----AYGYAGGYGYGYGYGEPGAGDKPRPVR
A0A2V7Z0V0      --KAPEEIERKLGLPTLAVIQDLSESGK-----AYGYS-----AYGYGETAADDKPR-AR
A0A2V8GFD4      --KTPDDIKVQLGLPFLGLVPQLRRREF--------------------------------
A0A2V8HSS5      --KTPDDIKVQLGLPFLGLVPQLRRREF--------------------------------
A0A2V8KP55      --KSPDDVTRHLGLLALGTVPRLHNLSL--------------------------WRGYKY
A0A399WNU1      --RVPVASQAQLGAPIVGMIPQSNGHRR-------------------------------S
A0A2V9CG11      --QSPGDAHVYLNISELGVITSAEIKHS--------------------------------
A0A2V2R0I6      --KSPDDVENLARLPSLAVVPHFTGSNG--------------------------------
A0A2V8XAR9      --KSPDDVETLARLPSLAVVPQFASSNG--------------------------------
A0A2V8VZA0      --KSPDDVETLSGLPSLAVVPQFAGSNG--------------------------------
A0A1Q7CB82      --KSPDDVETLSGLPSLAVVPQFAGSNG--------------------------------
A0A2V8WIU1      --KSPDDVETLSGLPSLAVVPQFAGSNG--------------------------------
A0A1Q6Y9F5      --KSPDDVETLSRLPSLAVVPQFASSNG--------------------------------
A0A2V9EVV8      --KSPDDVETLSRLPSLAVVPQFASSNG--------------------------------
A0A2V8YF91      --KSPDDIEALARLPSLAVVPQFSGSSG--------------------------------
A0A2V8XZK2      --KTPDDIESLARLPSLAVVPQFTGLNG--------------------------------
A0A2V8ZTX6      --KTPDDIETLARLPSLAVVPQFAGTNG--------------------------------
A0A2V9BT79      --KTPDDIETLARLPSLAVVPQFAGSNG--------------------------------
A0A1Q8B793      --KTPDDVEMLARLPSLAVVPAFIDTNG--------------------------------
A0A2V9BCA0      --KTPDDVEMLARLPSLAVVPAFIDTNG--------------------------------
A0A2V9BWU9      --KTPGDIEMLTRLPSLAVVPAFVTLNG--------------------------------
A0A2V9DKX2      --KTPGDIEMLTRLPSLAVVPAFVTLNG--------------------------------
A0A2V9JSI3      --KSVEDIERLTGMPTLAVIPLAASDRA--------------------------------
A0A2V9WI32      --RTPEEAQIISALPSLGIIPLSTKQIA--------------------------------
A0A2V8IVN9      --KTPDEIRAHLGMPALGMLPAVQEKEF--------------------------------
A0A1F2TPT3      --KLPEEIGQRLGLPVLGFLPEIKLKSGVTGPLATN------------------------
A0A2V8JTQ2      --NTVEQAQSLSSLPALGVLPLLEAKSQ--------------------------------
A0A2V8UZY0      --ITLEQARLLSPLPALGVLPLLKTMSR--------------------------------
A0A3N5YNR8      --KTPEDMEQSLGLPSLGVIPAMADLPA--------------------------------
A0A350UEK1      --REPSDIPFYLGARELGVVPSAGRVED------------------------------GK
A0A350UIQ4      --REPSDVPFYLGVRELGVVPSASLLEE------------------------------KK
A0A3N6A5T6      --KTPDDIEKTLDLPSLGVIPAFKMFET--------------------------------
A0A1F2Q9L4      --KTAEDVDRILSLPVLAVIPDVARSRN----------------------GYGYGGSYGY
A0A1H5SQF5      --STPEEVASLTSLPLLGLVPQAGKRRR--------------------------------
A0A2Z5G448      --RTSEDAEAISSLPSLAVVPRFTTAAK--------------------------------
A0A3E0NV31      --KSSDHITESIGLPVLGTVPSIGKQEG--------------------------------
A0A3N5M5V0      --KTPEDMEQSLGLPSLGVIPAISDLPA--------------------------------
A0A2V9AEW6      --SAPGEAQIYLDLPELGVIPLDDTAVS---------------------------RHGAN
A0A2V8WQK6      --SAPGDAQVYLDLPELGVLPLDQAAVS---------------------------WQIPN
A0A2V8XIF4      --TAPGDAQAYLDLPELGVIPFDQGGLA---------------------------GQIAG
A0A3N5XQP8      --HSPEDV-LALHIPALGIVPKSQELTN--------------------------------
A0A2Z5G7H4      --QTIEEIERDLELVPLGILPHLGEPNW--------------------------------
A0A2V9KCS3      --QSPGDGPTYLNLPELGVIPSAKADRG-----------------LNSYFKRLPALKGPK
A0A2U3KC61      --RNMEELSAISTLPALGTIPLQLSSNG--------------------------------
A0A2V9Y2R7      --RNMEQVSAISTLPALGMIPLQVSGNG--------------------------------
A0A372IT17      --TSLTEVERLTGAPLFSVIPLLEPSFH--------------------------------
A0A136JPP4      --RTSDDISRALGLPTLAMIPHHGINEK--------------------------------
A0A399WUJ8      --RTSDDVSRALGLPTLAMIPHHGINEK--------------------------------
A0A2V9L5B5      --KTPDEVERLLRLPSLGVLPRFTPNGA--------------------------------
A0A2V9L7I0      --KTPDEVERLLHLPSLGVLPRFTLNGN--------------------------------
A0A2V9LK56      --KSPSQVESLLRLPSLGVILEFDLFSA--------------------------------
A0A2V9YHT3      --RTPEQVQIVSALPSLGIVPMSISLSS--------------------------------
A0A2V9NGH6      --RTPEQAQAISGLPSLGIIPDGSKLSI--------------------------------
A0A2V9PYE6      --RTPEQAQAISGLPSLGIIPDGSKLSI--------------------------------
A0A2V9NL07      --RTPEQAQLISGLPSLGMIPLGSRTAA--------------------------------
A0A2V9QD92      --RTPEQAQLISGLPSLGMIPLGSRTAA--------------------------------
A0A2V9WPZ6      --RTPEQAQIISSLPSLGS-RTGVEGKN--------------------------------
A0A2V9ZLH4      --RTPEQAQMISALPALGMIPLGSKRPN--------------------------------
A0A2V9RQF1      --RTPEQAEAISGLPSLGMIPLGSKSSS--------------------------------
A0A2V9YDK8      --RTPEQAQIISGLPSLGMIPQGSKS-I--------------------------------
A0A2V9V8F7      --RTPEQAQLISSLPSLGMIPQGSRTGV--------------------------------
A0A2V9XGR9      --RTPEQAQIISSLPSLGMIPQGSRTGV--------------------------------
A0A2V9V3Q5      --RTTEQAQMISALPSLGMIPLGSKSRN--------------------------------
A0A2V9NWS3      --RTPEQAQAISALPSLGIIPMGSKAPT--------------------------------
A0A2V9USA9      --RTTEQAQTISGLAPLGMIPLGSKGIR--------------------------------
A0A2V9XW18      --RTTEQAQMIAGVASLGMIPLGSKSAR--------------------------------
A0A3M2BZG9      --KSPEELEKITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYGYGYGYGYGYGYGYYG
A0A1Q7N5R7      --RYPDQVTNGMGLRILGALPHVKNRKAGPDD----------------------------
A0A3M1SIV3      --RDVDDITRHLNLPTLALIPEAQEKKK--------------------------------
A0A3E0PHB0      --KSSDDIGRSLGLPTLGLIPHQKMMDR----------GKKQK-----------------
A0A3M2D491      --RTVDDVTKHLGLPTLAIIPEATASKK----------TKL-------------------
A0A357F267      --KESEDIGRHLGLPTLALIPHYFGSEK----------RKHR------------------
A0A353C9L6      --KTSEDIGRHVGLPTLALIPHYFGSEK----------RRLRLL----------------
A0A2V8RQV0      --RTSEDIGRHLGLPTLGLIPHHGIAER----------RRL-------------------
A0A2V8SJH5      --KTSDDIGRHLGLPTLALIPHHFGSEK----------RRLKLIA---------------
A0A2V9QB26      --RAPGEAQLWLNVPELQVIPTAVEESRRCLYTERCNKTTTLSLS---------------
A0A2V9VYY4      --RSMEEVRAVSTLPALGTIPLQLVTDE-------------RFRK---------------
A0A2V9KIE8      --KSPDEVEELVRLPSLAVLPSFALNDG--------------KGD---------------
A0A352F549      --KDSRDIESGLRLPSLAVIPIAGKSTQ--------------------------------
A0A3B9MLP9      --KSPGDIESGLRLPSLAIIPIAGRSAQ--------------------------------
A0A3D5SQ87      --KSPGDIESGLRLPSLAIIPIAGRSAQ--------------------------------
A0A2V8NW86      --RAPGEAQLWLNVPELQVIPTAVEESGRCLDTERCDKTTTLLPS---------------
A0A2V8ZHL8      --KSIEEAERVVNAPALAVVPLEREIPH---RPAL-------------------------
A0A2V9B240      --KSIEEAERVVNAPALAVVPLERELPH---RPAR-------------------------
A0A2V9CBM2      --TGADDVERLCGLSVLALIPAVQPSNG---DQHGGVHYKLLEHA---------------
A0A2V8XN17      --KGDDDVERLLGLPSLALIPVVASANG---NHLG--IHRFLPRD---------------
A0A2V8WX45      --KGDDDVERLFGLPSLALIPVVPPSNG---DQHG--IHRFLQQD---------------
A0A1Q6YR79      --KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD---------------
A0A1Q7VA32      --KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD---------------
A0A2V9EY85      --KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD---------------
A0A2V9H8K0      --KGDDDVERLFGLPSLALIPAVPPSNG---DLQG--IHRFLPRD---------------
A0A2V9FFE5      --KGDDDVERLFGLPSLALIPVVPPSDS---DQHG--IHRFLPRD---------------
A0A2V9GM43      --KGDDDVERLFGLPSLALIPVVPPSDS---DQHG--IHRFLPRD---------------
A0A1F2RFI7      --KTPEDVQRFLHLPTLGIIPAASANGR---AGLSYGYGYGYGYG---------------
A0A1F2RZS3      --KTPEDVQRYLRLPTLGVIPAANAASR---KKLA----YGYGYS---------------
A0A1F2USE2      --KTPEDVERFLHIPALALIPSVESLSG---RRGRAYGYGYGLYG---------------
A0A2V9C238      --KTSEDVERFLGLPALALIPAVESLNG---RRKGA----YRLYG---------------
A0A1F2Q9F5      --KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG---------------
A0A1F2QQH9      --KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG---------------
A0A1F2QXK7      --KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG---------------
A0A2V9DEM9      --KTSEDVERFLGLPALALIPAVESLNG---RRRGV----YRLYG---------------
A0A2V9CYQ5      --RGADDVERLFGLSVLGLIPAVQPSNG---DQHSI----HKLVE---------------
A0A2V9BWU8      --KGADDVERLFGLSALALIPSVHCLNG---DRPSV----RKLLD---------------
A0A2V8ZG48      --KGADDVERLFGLPALALIPAVHHLNG---NGPSV----RRLLD---------------
A0A2V8Y334      --KGADDVERLFGLPALALIPSVHHLDG---DRHGV----RKLLD---------------
A0A2V9AY68      --KGADDVERLFGLSALALIPSVHQLGG---NRNGV----RKLLR---------------
A0A257VBK0      --KSVEDLETRMGVALLTMVPKFEP-----------------------------------
A0A2V7XDY0      --KDPEEIERYLHIDLLAAVPQYDE-----------------------------------
A0A350UQT3      --RDPEQVSRTLKTHIIGTLPSVKN------------------------TREL-------
A0A2U3JZ71      --RDPEQVARTLSTEVIGTLPSVKE------------WHGRITAASEPGT----------
A0A2V8TTB0      --RDPDQVARLMNTNVVGSLPTVKD------------WRRRLSPISSSGSANG-------
A0A1F2TCR2      --KTPEDITKVLGLPLLGLVPAIRG-----------------------------------
A0A2N9LQU7      --RTSEEVEAASSIPALATIPLITR--------------------------RS-------
A0A2P6WFK7      --SNSEELETCLALPVLCTIP--TH--------------------------QQ-------
A0A1F2V330      --GNIVEFQTFTNLPAIAVLPSMSA-------DLDPGVKPLTGTIPLIPPCGG-------
A0A2V8U914      --RAPGEASFYLNLPELGTIPSAES---------------------------L-------
A0A2V7W309      --KTPEELERVTKFASLGVIPAAGT-----------ISRQYGYNYSYGRASGP-------
A0A2V8TLH7      --RTSEDVERYLKLNILAVVPRDND-----------------------------------
A0A1Q7ZJT1      --RTSDDVEQYLRLNLLAIVPKEAD-----------------------------------
A0A2V8VC99      --RTSEDVEQYLRLNLLAIIPKQSD-----------------------------------
A0A348UZU3      --KSAEDVERYSGWPTLGVVPIFDQ--------DATLNGHYYAYRSAEDEDGK-------
Q01XL7          LFESPGHTRTILGVPELGVIPSATI------------DRPKKLAAAQRALNGA-------
A0A2V8ERZ5      --KTPEDVTRRLKLPFLGLVPVVRG-----------------------------------
A0A2V8GTX0      --KTPEDVTWRLHLNFLGLVPKVHG-----------------------------------
A0A2V8J0X9      --KTPEDITKRLRLPLLGLVPAVRG-----------------------------------
A0A372IRG7      --RTSDDAEAVSLLPALAVIPHFQP-------------------FSKKAINAK-------
A0A1F2U158      --KTPEDVTRMLKMTFLGLIPSVRG-----------------------------------
A0A2V8F6S9      --KTPEDVTRRLKLPFLGLVPSVRG-----------------------------------
A0A1I6MH75      --RSIAEIESVIELPSLAIIPKARR-----------------------------------
E8WVF6          --RSVAEIEAITELPSLSIIPRARR-----------------------------------
A0A1H5Z7N3      --RDVMEIERITGLPSLAVIPKTRR-----------------------------------
A0A1G7JVV8      --RSVSEVEHITQLPSLSIIPRVRR-----------------------------------
A0A1H4T6W9      --RSVAEVEQITQLPSLSVIPRVRR-----------------------------------
I3ZEU5          --RSVAEVEQITQLPSLAVIPKVRR-----------------------------------
A0A428MDU2      --RSVAEIESITELPSLAVIPRSRR-----------------------------------
A0A239HDF6      --RSVTELEAITEMPSLAVIPRLRK-----------------------------------
A0A1Q3QQB6      --SSVAEIESLIELPSLAVIPKARR-----------------------------------
A0A3N1K1G7      --RSIAEIESITELPSLAIIPRARR-----------------------------------
A0A2W0BGU4      --KSPEEVEMLIATRALALIPMKRL------------------------TRAE-------
A0A2W0BVQ9      --KSPEEVEMLIATRALALIPMKRL------------------------TRAE-------
A0A3D1ASD2      --KDPEQIARTLKTQVIGTLPSMKS--------------------------WR-------
A0A2N9MK30      --RNTEQVARIVKAEVIGGLPQVKS-------------------------WKS-------
A0A2V9MN96      --GSLEELSAITALPMLGVIPLQLA------------------------ENGR-------
E8UZE1          --RTGEDIYRYSGLPLLSIVPHLSP----------------------AQRNMK-------
A0A2V7V2Z1      --KTPEDVRKQLAAPLLAVIPEIAN-----------------------------------
A0A2V7X2F7      --KTPDDVRNHLGAPLLGVVPETGQ-----------------------------------
A0A2V7V2I1      --KTPEEVRLHLGVPLLGVIPEHGQ-----------------------------------
A0A2V7U3M2      --KTPEDVRKQLGAPLLAVIPEISV-----------------------------------
A0A2V7UHT0      --KTPEDVRKQLGAPLLAVIPEIGS-----------------------------------
A0A2Z5FVL3      --ADIHGLESLMGEAPFGILPSFAA-------------------------KKK-------
A0A1V6HR88      --KSSEEVERLFGVPVLAVIPDVGAGGKGYGLRGRYGYGYGYGYGYGEKPAKA-------
A0A3E0P0A3      --KSPEELERRLGLPVLGVVPDLNR--------------------RGSSRRVY-------
A0A2V9KBD6      --RTVEQVQLLSPLPVLGALPLLEA------------------------NSKN-------
A0A2W0AJ66      --STLEQAQILSPLPALGVVPLLEG-------------------------SAN-------
A0A1Q7RBU1      --STLEQALALSPLPSLGVVPLLEA------------------------KSKS-------
A0A2V9JPV9      --STLEQAIALSPLPSLGVVPLLEA------------------------KGKS-------
A0A2V8EXP2      --KTPDEIKAHLGLPFLGLVPALFA-----------------------------------
A0A2W4RYA1      --RTPEEMQAVLGLTSLAMLPSVPA-----------------------------------
G8P0Y7          --RTPEQAETTSGLPVLGVIPMQPV------------------FDKAGTNAAR-------
A0A3D4VGU2      --RTSEEVESIGHLPALAIVPRFVS--------GA-----KRKTAYGSYGAEK-------
C1F294          --RTSEEVESIGHLPALAIVPRFVS--------GA-----KRKTAYGSYGAEK-------
A0A3P0X3W6      --RDPEQARRSLQVEVLGILPDVLQ------------------LKPAGRQLLL-------
A0A1E3Y9R6      --KLPEEIKTHLNLPFLGMIPVFPD-----------------------------------
A0A2W4TLP2      --KLPEEIKTHLGLPFLGMIPTFPG-----------------------------------
A0A3R9WF43      --RTPLDIEAASHLSILAYIPTKSR-----------------------------------
A0A317HKM4      --TSVEDVKRHLRIPVLGLMPQVPS-----------------------------------
A0A2W0C122      --RDPADVESFTAMPSLAIIPQHRG-----------------------------------
A0A2W0AUU7      --RDPAEVESFTAMPSLAIIPQHHP-----------------------------------
A0A2W0BQL1      --RDPAEVESFTAMPSLAIIPQHHP-----------------------------------
A0A3P0XH15      --RTSDDAESVVGLPSLAVIPHFEPAQKKGVSA-------------AGTAAAE-------
A0A3M1WQW8      --KSTEDVDRLLGLPSLGVVPALE----------------------SLERKKR-------
A0A3N1JHC1      --RNPGESEQYVERPELAVIPRDRL---------------------IAKKSKA-------
A0A2V9KA79      --ENAEQFQSFFDFPVLCIIPSMNLHNLRRKVRSE-----EISPRAPARRHTG-------
G8P085          --QSVDQIERALGYQLLAIIPHISI---------------------AQRTDNK-------
Q1ILD9          --KTPDDVELITSLPVIGVIPNTAV---------------------GRSSNGR-------
Q1IJZ6          --ATTTDAEELTGIAVLGVIPIVNE---------------------NPRVLRA-------
A0A2V8TCE6      --RTQEEIERFLGTPTLARIPSASL---------------------DPQ-----------
Q1ITG0          --SSPEDAEEMAGISTIGLIPHFSM---------------------EGLNALA-------
A0A3N5PCI5      --QTPSAVRAL-GIPFLGMLP---------------------------------------
A0A3M1Q0S9      --KTPDDVRDVLQLPVLGMIPAQEP---------------------ATRRERR-------
A0A3M1VZ38      --KSPDDVRDILDLPLLGMVP-------------------------APRPVKK-------
A0A3M1PY35      --RSVEQLGELGGLPVLGSVPHVEG---------------------PPRPRLV-------
A0A3M1VMP2      --RTASQMREITGLPLLGSIPRASA---------------------PPRPRLV-------
                                                                            

A0A2V7YYV7      --------------------------------LAGKGNRGELITL---------------
A0A2V7Z0J5      --------------------------------VAGKGKRGELVTL---------------
A0A2V7Z3M4      --------------------------------PAGKGKRGELVAL---------------
A0A3M2D9H8      ------------------------------NGKLPREDYPPHVVA---------------
A0A399Y5V2      ------------------------------QSWNDRRSAMLLSVK---------------
Q01X01          ----------------------KFAVLGFLSESNGKSQVERASLE---------------
A0A2V7VMF7      ------------------------------------------------------------
A0A2V8JK38      ----------------------KKEQNEPANAEKSDNRSIELAPH---------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      -----ASKLLPS----------RKLFLQPRNG---NKNGRPLIMY-D-------------
A0A321LPW6      -----GKRGLGPKRRA------YALAAAGPAARALLASQ--AEIVEC-------------
A0A2V9R9V4      -----NKSLLNGRRRKDNTPELLALGSGDKASAIMQRA----RLMEF-------------
A0A321LE75      -----SRPKLLTAKGQGA----LGANGSAPAAAGLQRAA--STLATL-------------
A0A2V8R8U7      -----EKRLRGA----------EPL----KPS---DTTA--LAMV-T-------------
A0A2V8QMP4      -----SRRLLAR----------SGHEA--EPA---TTTA--LALI-E-------------
A0A2V8R4S3      -----SRRLLAR----------GSHEP--EAG---TTTA--LALI-E-------------
A0A2V8NJ55      -----ERSLLKS----------KNPPPN-TGK---ESTA--LALI-E-------------
A0A2V8Q7I0      -----DRGRLKG----------VVPATAGGPS---ETTA--LAMI-D-------------
A0A2V8S6K4      -----ARRLAFG----------RTAHVH-DHT---ESTA--LALI-E-------------
A0A317I2L9      -----IGGRLKG----------MTSANV-GPS---ESTA--LAMV-D-------------
A0A2V8LLF9      -----EKTKL------------IAGDAA-APA---ATTA--LTMV-N-------------
A0A352FRF4      -----DRTRLRG----------GEAALA-GPN---DTTA--LAMV-K-------------
A0A2V8MKV0      -----EKRL-------------REGEAP-TAG---ASTA--LAMV-E-------------
A0A2V8PYY8      -----EKRL-------------REGDAP-AAG---ASTA--LAMV-E-------------
A0A1Q7YKQ8      -----EQRL-RL----------KGGAQA-EHG---ESTA--LALV-A-------------
A0A352F3R7      -----RGRLIG-----------TGPSPE-GPS---DTTA--LALV-H-------------
A0A0B6WXT1      -----ERLLLKG----------KASEPE-GVA---EKTA--LALI-S-------------
A0A3B9MEU8      -----RGRLIGI----------SGGPPS-APS---DTTA--LAMI-T-------------
A0A2V8MHG6      -----RRRLLSA----------MPGSKRNGHQ---GGPE--LLLY-G-------------
A0A2V8P7N1      -----RRRLLSA----------MPGSKRNGHQ---GGPE--LLLN-G-------------
A0A2V8M3M6      -----RRRLLSA----------MPGSKRNGHQ---GGPE--LLLN-G-------------
A0A1Q7NJH5      -----RRRLLSA----------MPGSKRNGHQ---VGPE--LLLN-S-------------
A0A2V8PJY0      -----RRRLLSA----------MPGSKRNGHQ---VGPE--LLLN-S-------------
A0A1Q7Y6W9      -----RRKLLPS----------VGSLQIRNGKGGINQPE--LIFS-T-------------
A0A2V8NC68      -----KRRLLRN----------VSALQKRNGN---HPAE--LLLSHT-------------
A0A399WK13      -----PKRRLQL----------VAENGEPADD-N-LGSE--LLIH-A-------------
A0A352FLX4      -----PKRNLAA----------SGKKGALVSSNG-SGSGEVLLTN-I-------------
A0A2V8RTL7      -----PKRKLLL----------VGGKGEEVEEDR-LNSE--LLIF-A-------------
A0A3E0PCJ6      -----SKRRLLL----------VGVNESE-EP-E-PGNA--LLIS-N-------------
A0A3M1S4R8      -----QKRRLLL----------VGSSDNE-PAFK-NRSE--LLIY-D-------------
A0A1Q7YFI6      -----SRRFLPK----------MTALQKSD---N-GDHG--SLLE-P-------------
A0A136KC10      -----PKRRLQL----------VGEGGETPED-R-PGSE--LLIH-A-------------
A0A2V8SEX6      -----PKRRLLL----------VGASNEEVEDPG-NNSE--LLIS-A-------------
A0A3M2D6Y5      -----QRRKLLP----------VGTGEENGSQGK-AGSE--ILIY-N-------------
A0A0B6WWQ6      -----SRRSLSK----------AVALQT---DGT-AHPE--LLVG-D-------------
A0A3B9MK99      -----RRRLIGA----------SGALQKRNGH-S-DSPE--LLMN-V-------------
A0A352EX26      -----RRKLLGG----------PGALQKRNGH-S-GNHE--LLMN-V-------------
A0A2V8MM59      -----RRRLLSP----------GTSLQKRNGNGT-GSPE--LLLH-V-------------
A0A2V8PFE8      ----RRRRLLSS----------ATALQKRNGNTS-GTPE--LLLN-V-------------
A0A2V8PWS6      -----RRRLLSS----------ATALQKRNGNPG-GNPE--LLLN-V-------------
A0A2V8LCT5      -----PRRLLSS----------ATALQKRNGNNG-GNPE--LLLN-I-------------
A0A352FTJ9      -----PRRLLSS----------AASLQKRNGSNG-SNPE--LLLN-I-------------
A0A2V8G155      ------------------------------------MS--PSLYK---------------
A0A2V8HDM7      ------------------------------------IS--PSLYK---------------
A0A2V8DRT9      ------------------------------------ES-APLLDK---------------
A0A2V7VYF3      ------------------------------------TGGAPLINN---------------
A0A1F2SVH2      ------------------------------------EN--PLISD---------------
A0A2V8AJG9      ------------------------------------KD--PLMNN---------------
A0A2G6PYV5      ---------GKI----------TKNKVKQKAMATKLRQEIGLLTH-L-------------
A0A2V8F956      ------------------------------------ANTYPLISK---------------
A0A1F2S1W5      --------------------------------------HTPLIGR---------------
A0A1F2T595      --------------------------------------SPPLISE---------------
A0A2V8JQV5      SLRNAIEFGKRI----------AGSDRSTPYGKDRPKPKIELMAW-E-------------
A0A2V9AC41      ---TRTGYVSKL----------VNSAKAELPAPTRDEDRPSVLDH---------------
A0A2V8K4L4      ------RRGQRP----------SALIPSVSGNNSNAGNPVELVTW-Q-------------
A0A2V8NCZ3      -------RGQGT----------AAVIPIGNGNTK---NPVELVTW-Q-------------
A0A2V9MAM9      -------------------------ASPGRSLRSDSHNATELTGW-E-------------
A0A2V9M454      --------RRPG----------LFHSKAANGANGDGGYAVELAVL-K-------------
A0A2V9IVR7      --------R--------------SLDRGGNGSADRRE-AVELTLL-K-------------
A0A2V9ILE2      --------R--------------SLDRGGNGSADRRE-AVELTLL-K-------------
A0A2V9LGY4      --------R--------------SLDRGGNGSADRRE-AVELTLL-K-------------
A0A2V9J4D6      --------GRQY----------GLRRKKNSELPASNG-QTGLAAL-E-------------
A0A2V9L9C5      --------GRQY----------GLRRKKNSELPASNG-QTGLAAL-E-------------
A0A2N9M9N1      --------RYG------------RYFARGALKPPGNG-SPGLAIM-N-------------
A0A2V9JEC4      --------RLPY----------SRLPRLRSKHPLPPS-RIELAVL-E-------------
A0A2V9LPQ3      --------RYGS----------SKRGGAQGEAQKRSE-SVAVMML-T-------------
A0A348V070      KKKHDTPRPKSV----------SLKTEEGAPENDKNNHQIELIIQ-R-------------
A0A2Z5G3A3      ---------FLR----------LTSSSGLDRIDAVDPVTRNVIAL-Q-------------
A0A2V7UGP8      -----------A----------GESAGGRRLRREPVSPAVDLVTL-R-------------
A0A239MKT6      -------------------------SKNVPASPDKQEDAAWLIR----------------
A0A3E0PCN7      ----------NG----------FVGSLIRKTQTKLVGENFYSLDR---------------
A0A2V8IYW3      TAEIGVFVPLKN----------PIGVSEELFDPALTGKVAAP------------------
G2LEI9          ---SKSSGYYSY----------GGETRALAKLADGRPLPADFNVG-LSAFA---------
A0A317J121      -RPAWRLLLGRE----------SRNAGEMVGSEVSLDTRVGFWDS-A-------------
A0A2V7YW66      PARSAAEKRGDR----------KERKERKRAAAAAGAPQIELVPH-E-------------
A0A2V7Z0V0      PGKAPAGGW---------------REKKKAPAAALPPSQIELVPH-E-------------
A0A2V8GFD4      ------------------------------------AKPSPMINH---------------
A0A2V8HSS5      ------------------------------------AKPSPMINH---------------
A0A2V8KP55      KYGYGYGFRFGR----------KKEQNEPANAEKSDNRSIELAPH-D-------------
A0A399WNU1      NHFLAKFNRHRN----------GDGDPDPAESRSAYADS---------------------
A0A2V9CG11      ----RQIANHKQ----------ANPALAMEAGSSELVLESHLDDR-PELAAWN-------
A0A2V2R0I6      --------NGKR----------RALLQ--TVAANGHEKRIELVAQ-H-------------
A0A2V8XAR9      --------SSKR----------QGLLQ--GFAANGQDKRIELVAQ-H-------------
A0A2V8VZA0      --------NGKR----------HGLLQ--GLSSNGHDKRIELVAQ-H-------------
A0A1Q7CB82      --------NGKR----------HGLLQ--GLSSNGHDKRIELVAQ-H-------------
A0A2V8WIU1      --------NGKR----------HGLLQ--GLSSNGHDKRIELVAQ-H-------------
A0A1Q6Y9F5      --------RSKR----------HGFFQ--GLSSNGHDARIELVAQ-H-------------
A0A2V9EVV8      --------SSKR----------HGFFQ--GLSSNGHDARIELVAQ-H-------------
A0A2V8YF91      ---------GNR----------RGFLP--SFSGNGHEKRMELVAQ-H-------------
A0A2V8XZK2      ---------SKG----------RGVLP--GLSSNGHERRIELVAQ-H-------------
A0A2V8ZTX6      ---------SKR----------RSMLQ--GFSENGHNKRIELVAQ-H-------------
A0A2V9BT79      ---------HKR----------RGMLP--DFSQNGHDKRIELVAQ-H-------------
A0A1Q8B793      --------RNGR----------RRFLRGLAAATNGREARVELVSH-H-------------
A0A2V9BCA0      --------RNGR----------RRFLRGLAAATNGREARVELVSH-H-------------
A0A2V9BWU9      --------RNRV----------PKMLK--SGSGNGTESRVELVSH-T-------------
A0A2V9DKX2      --------RNRV----------PKMLK--SGSGNGTESRVELVSH-T-------------
A0A2V9JSI3      ----RRAWRKGA----------GEKAASSTTPVGLAVLK---------------------
A0A2V9WI32      -------RDRKN----------GHPRLSLGSRSSESADSLQLITF-A-------------
A0A2V8IVN9      ------------------------GGSYPMVGA---------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------NGAHRELAGGSGHVDHALVSL-L-------------
A0A2V8UZY0      ------------------------NGAARQLTGVGGDVKPELVSL-L-------------
A0A3N5YNR8      ----GSSRLLAS----------RNESGDSKTGLPAPIS----------------------
A0A350UEK1      KHRLLTGRSKKA----------DAETQSLTLATNGLSEKLELVTL-Q-------------
A0A350UIQ4      GRKLL-----------------GEESQSLVLTNVGLGEKLELVTV-Q-------------
A0A3N6A5T6      ----PVGTRLLT----------AASTQSTDASVDAVLQGSQ-------------------
A0A1F2Q9L4      GYGQRRGKGQPG----------RPTLAGQRPGGDSGAGQIELVSH-F-------------
A0A1H5SQF5      -------WAYAY----------PYAPTKKADAAAESEGKFAWVLK---------------
A0A2Z5G448      --------EARS----------TYGQQAKPITPADSQFPSDLVSY-L-------------
A0A3E0NV31      ----NWLAAKLK----------LPRRKPSRTPPKLLEPKGD-------------------
A0A3N5M5V0      ----GGSRLLAE----------KSTSGADKTELPARIA----------------------
A0A2V9AEW6      LLNMRRLTPSVP----------SGVESDSS-DKSPELATWK-------------------
A0A2V8WQK6      RLPPHRAASSRP----------PESALRSSLGDCPELATWK-------------------
A0A2V8XIF4      RLHSHRPTRTLT----------SDTAPDSS-ANWPELATWK-------------------
A0A3N5XQP8      --GANPLVLALP----------EQVQADHRSASDQDRMGSALARS-A-------------
A0A2Z5G7H4      ---------YRR----------PGGPSLSRARSPSSGVNSLAIFA---------------
A0A2V9KCS3      DSEQTLGSALVK----------KNGRRNGNGNHEIELVTWY-------------------
A0A2U3KC61      ----YLRKRLKT----------VSAETEKPESPALVAYA---------------------
A0A2V9Y2R7      ----NLRKRLKT----------VPAADGELQSPTLVTYA---------------------
A0A372IT17      ------LPRLLR----------GGGSSGVTAAASWELQGTGS------------------
A0A136JPP4      ----KRRSRRGL----------GSETNAKA-ASNTALITLE-------------------
A0A399WUJ8      ----KRLSLRGI----------AGESNGKSTAASTALITLE-------------------
A0A2V9L5B5      ---------GEV-----------RQDSLEAVEPGVATALAPAI-----------------
A0A2V9L7I0      ---------GKV----------PEEEDSLAAVPEVEMAVAPAI-----------------
A0A2V9LK56      ---------RK------------SGEARLTKGSEAGGKSDIVI-----------------
A0A2V9YHT3      ----------QA----------QGRNGKGIVLRPGKRERVEMIAH-S-------------
A0A2V9NGH6      -----------------------ESSARRRLSLTSSREAIELVTQ-S-------------
A0A2V9PYE6      -----------------------ESSARRRLSLTSSREAIELVTQ-S-------------
A0A2V9NL07      -----------------------EANP-TGLSVAASKEAVELITI-S-------------
A0A2V9QD92      -----------------------EANP-TGLSVAASKEAVELITI-S-------------
A0A2V9WPZ6      -----------------------EN----RLIVASSKESVELVTK-S-------------
A0A2V9ZLH4      -----------------------EDGS-RRLAVAASKESVELVTQ-S-------------
A0A2V9RQF1      -----------------------DSKS-KRLSLASSREVVELVTQ-S-------------
A0A2V9YDK8      -----------------------EASNQKRLTVASSKEAVELVTQ-A-------------
A0A2V9V8F7      -----------------------EGKNENRLIVASSKESVELVTK-S-------------
A0A2V9XGR9      -----------------------EGKNENRLIVASSKESVELVTK-S-------------
A0A2V9V3Q5      -----------------------NGTGIGRLTLTSSREVVELVTQ-V-------------
A0A2V9NWS3      -----------------------ESNGRQRLSLASSKEPVELVTQ-S-------------
A0A2V9USA9      -----------------------EGSTGKRLALAASNEAVELITQ-V-------------
A0A2V9XW18      -----------------------EGPNPKRLVIASSKEAVELVTQ-V-------------
A0A3M2BZG9      AEGRKRRKLKGA----------SSDEPEPDRQIELLPHR---------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ---------VKS----------LGSEINGNTSAALITLR---------------------
A0A3E0PHB0      ---------LLT----------GGSNGRGP-STEFVALE---------------------
A0A3M2D491      ---------LPA----------GEKEQSS--SVALVTLS---------------------
A0A357F267      ---------LAA----------ANGSEAVA-STALVTLD---------------------
A0A353C9L6      ---------AAN----------GNGNGGAP-STGLVTLE---------------------
A0A2V8RQV0      ---------MAA----------GNGAALSPHAAALITLE---------------------
A0A2V8SJH5      ----ANGNGLAN----------GNGNGNSATATGLITLA---------------------
A0A2V9QB26      ----RQQRDSGL----------PKRTSKQVDSPSVELVTWY-------------------
A0A2V9VYY4      ----RRLTISPD----------GERSGMLALVT----------------YE---------
A0A2V9KIE8      ----ASKQLAKA----------APGDRVVAPAI---------------------------
A0A352F549      ----RFFPISRA----------LQRTNGNGASP------ELLING---------------
A0A3B9MLP9      ----RLLPITRA----------LQRTNGNGSGP------ELLINS---------------
A0A3D5SQ87      ----RLLPITRA----------LQRTNGNGSGP------ELLINS---------------
A0A2V8NW86      ----RQQRDPGL----------PKRTSEHADSLSVELVTWYRKAS-LIAESYRSLLTSIL
A0A2V8ZHL8      --------SRAR----------NNGNSKPSETA------LALLKQ---------------
A0A2V9B240      --------SLTR----------NNGNSKSSGAE------LALLKE---------------
A0A2V9CBM2      ----GALSL--R----------ENGGARKLVPS------WYRIDV----HA---------
A0A2V8XN17      ----KSLVL--A----------GNGSGKNSRS-------WHLIDR----DG---------
A0A2V8WX45      ----KALVL--K----------GNGTGKDARSS------WHRIDL----DG---------
A0A1Q6YR79      ----KSLSLAGN----------GNGSGKDRRPS------WHLIDR----DG---------
A0A1Q7VA32      ----KSLSLAGN----------GNGSGKDRRPS------WHLIDR----DG---------
A0A2V9EY85      ----RFLSLAGN----------GNGPGKDPRPS------WHLIDR----DG---------
A0A2V9H8K0      ----KALIL--E----------GNAAGKNSRSF------WHRIDR----DG---------
A0A2V9FFE5      ----KAFEF--K----------GNGAGKNSRSC------WHRIDR----DE---------
A0A2V9GM43      ----KAFEF--K----------GNVAGKNSHSY------WHRIDR----DE---------
A0A1F2RFI7      ----SRKSLPED----------TSAPDGEKKLH------PELI------AG---------
A0A1F2RZS3      ----SRQTLAEV----------TSEAANGKPLS------LELI------GA---------
A0A1F2USE2      ----QTRQLESG----------AEGTTEKGLARGGTPHGWYRIDE----LD---------
A0A2V9C238      ----GSKPL-------------ANGKPQTSALPSTTPR-WYRIDV----EA---------
A0A1F2Q9F5      ------LPT-------------PKRLASRSVVPAAAPL-WHLVSG----NG---------
A0A1F2QQH9      ------LPT-------------PKRLASRSVLPAAAPL-WHLVSG----NG---------
A0A1F2QXK7      ------LPT-------------PKRLASRSVVPAAAPL-WHLVSG----NG---------
A0A2V9DEM9      ----GSKPL-------------ANGKPRTLALPSTTPR-WYRIDA----EA---------
A0A2V9CYQ5      ----HPGSLSLR----------ENGCARKLVAS------WYRIDV----HA---------
A0A2V9BWU8      ----RTLPLKSA----------HNGTASNPAAR------WHRIDQ-VDRGE---------
A0A2V8ZG48      ----HSNLLRSR----------QNGTASNPCAC------WHRIDQ----GG---------
A0A2V8Y334      ----RTNHPGNG----------HNGTASNPGAR------WHRIDQ----SG---------
A0A2V9AY68      ----RTNGLRHG----------HNGTASNPGVR------WHRIDQ----GG---------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ----------------------MLPAKLLTAGETHVEDPSARPKD---------------
A0A2U3JZ71      -----------------------------------DLIPHDPSRG---------------
A0A2V8TTB0      ----------------------HRNGNGAIPAPPNGAVPAADNTD---------------
A0A1F2TCR2      -------------------------------------ERVPLLSE---------------
A0A2N9LQU7      ----------------------LRKDMRGRNHQPGLGGLGTMAVQ---------------
A0A2P6WFK7      ----------------------QPPATSNSREAPKAVPLAPILLG---------------
A0A1F2V330      ----------------------DLSPTLLAFADLHRNHIVMV--T---------------
A0A2V8U914      ----------------------EPALQKLIGTENGKQPVERITWD---------------
A0A2V7W309      ----------------------QLRAVDAPPEEKPSPGIELLPHL---------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ----------------------KKRKEEKGETENEPRSIELISHF---------------
Q01XL7          ----------------------TSIHPLGTLVEDGQKTLEFATWQ---------------
A0A2V8ERZ5      ----------------------------------DKHPLLAS--S---------------
A0A2V8GTX0      ----------------------------------ERHPLLSG--P---------------
A0A2V8J0X9      ----------------------------------ERVPVLTE--T---------------
A0A372IRG7      ----------------------DEAADRNGSLAKVSPDLLAY--N---------------
A0A1F2U158      ----------------------------------DKHPVLAS--S---------------
A0A2V8F6S9      ----------------------------------DKHPLLAS--S---------------
A0A1I6MH75      -----------------------TAAEQVGSLTTAQRNINVL--T---------------
E8WVF6          -----------------------ATPEQLAAMSTVERNINVL--T---------------
A0A1H5Z7N3      -----------------------TSAE-QNATGLVARNIGVL--A---------------
A0A1G7JVV8      -----------------------MQSDGSGSATVAQTNIGVL--A---------------
A0A1H4T6W9      -----------------------LSSD-TGTMSVAQNNIGVL--A---------------
I3ZEU5          -----------------------LSSD-TGSMSVAQSNIGVL--A---------------
A0A428MDU2      -----------------------AGV-SEAAMSTAQRNISVL--T---------------
A0A239HDF6      ---------------------------PAGAAVPDTSPLPVI--S---------------
A0A1Q3QQB6      -----------------------LSVEQSSTLTPTQKNLSVL--S---------------
A0A3N1K1G7      -----------------------SSAEQAGNLTTAQRNISVL--T---------------
A0A2W0BGU4      ----------------------RLLATNRSINARENGTAILNVAA---------------
A0A2W0BVQ9      ----------------------RLLATNRSINARENGTALLNVAA---------------
A0A3D1ASD2      ----------------------ARLGPIAKGGAKAELVPLGELGD---------------
A0A2N9MK30      ----------------------RPALVAAGGAASTPVLLRHPDDD---------------
A0A2V9MN96      ----------------------RHLHPAGGSLITASTVDGPVAHV---------------
E8UZE1          ----------------------LGKKEVAGTADSLGLEPRVL--Q---------------
A0A2V7V2Z1      -----------------------------------PAE-VIIKSG---------------
A0A2V7X2F7      ----------------------------------SPADLLIQKGG---------------
A0A2V7V2I1      ----------------------------------DSGSPVLSNSH---------------
A0A2V7U3M2      -----------------------------------PGDIVIIQGG---------------
A0A2V7UHT0      -----------------------------------PTD-VVIKSG---------------
A0A2Z5FVL3      ----------------------GLRLSGHSFALPGREAIAAL--K---------------
A0A1V6HR88      ----------------------RARKPGKGGGNGEPTQIELLPHL---------------
A0A3E0P0A3      ----------------------GARAPAKRVDRGADLAIDLLPHS---------------
A0A2V9KBD6      ----------------------GAPANLPALSIYRNRALVSL--L---------------
A0A2W0AJ66      ----------------------QSLVEGNVPQTASKPELVSF--L---------------
A0A1Q7RBU1      ----------------------RARAQLNGVNGDLKPEMVSF--L---------------
A0A2V9JPV9      ----------------------RAPAQLNGVNGDLKPELVSV--L---------------
A0A2V8EXP2      -----------------------------KDLH--DPLIS----K---------------
A0A2W4RYA1      -----------------------------SSLRSGDPLMT----G---------------
G8P0Y7          ----------------------SRLLNKMPGTGTGPQPLISY--L---------------
A0A3D4VGU2      ----------------------RPKEPVAEKEDQISRDLLTL--L---------------
C1F294          ----------------------RPKEPVAEKEDQISRDLLTL--L---------------
A0A3P0X3W6      ----------------------KSGSDVPAPVAGKQPLDW----S---------------
A0A1E3Y9R6      -----------------------------AGRDGEAPLLQ----P---------------
A0A2W4TLP2      -----------------------------GDESGEAPLLS----A---------------
A0A3R9WF43      ------------------------AETVTAGTVGECALI-----T---------------
A0A317HKM4      -----------------------------------KNGRVPLLVQ---------------
A0A2W0C122      ------------------------SPRLLTSKVGEAPQVLSL--T---------------
A0A2W0AUU7      ------------------------SPRLLTPRVGEAPQIMCL--T---------------
A0A2W0BQL1      ------------------------SPRLLTPRVGEVPQIMCL--T---------------
A0A3P0XH15      ----------------------AERERMARV----SPDLISY--T---------------
A0A3M1WQW8      ----------------------LALPRWSRERRTTKPILILD--D---------------
A0A3N1JHC1      ----------------------HPQMRLNGAGSKDVHPILEHWKE---------------
A0A2V9KA79      ----------------------EQRVSIASVPDRPGKHSLTS--Q---------------
G8P085          ----------------------GDAPAFDA-----SQMLVAY--N---------------
Q1ILD9          ----------------------PGRTAVKQE----AMGIDVL--T---------------
Q1IJZ6          ----------------------AGRAKANGSNGSKPGRPTAM--V---------------
A0A2V8TCE6      -------------------------RRGGPAWGTGEIDLMSH--H---------------
Q1ITG0          ----------------------TENQSVL------ARVPLAA--D---------------
A0A3N5PCI5      ----------------------YVGKRALKG----RSLLLTH--G---------------
A0A3M1Q0S9      ----------------------RSASRGEQAAEIEDPSLISA--R---------------
A0A3M1VZ38      ----------------------AHGEEPVRC----DPAVITA--E---------------
A0A3M1PY35      ----------------------FSRKRREGA----SPVVAPG--A---------------
A0A3M1VMP2      ----------------------FSRKGRSRS----RPVIPEE--Q---------------
                                                                            

A0A2V7YYV7      --------------------------DAHSHA-SEAYRALRTSLLF--SAIDRE-L-KEI
A0A2V7Z0J5      --------------------------DAQSHA-AEAYRALRTGILF--SGVERS-V-KQL
A0A2V7Z3M4      --------------------------DAQSHA-SEAYKALRTGILF--SGINHR------
A0A3M2D9H8      --------------------------QPRSPV-TEAFRSVRTNLEF--VEIDRP-L-KTL
A0A399Y5V2      --------------------------DPASTT-AEAYRSVRTNLQF--SLLDSG-S-RVV
Q01X01          --------------------------QPASHV-SESFRATLASILS--SSHNGDHP-HVL
A0A2V7VMF7      --------------------------DAEHLV-TEAYQNLRTALLF--ARKDDA-G-QVV
A0A2V8JK38      --------------------------DEPSSVIAESYRSVRTSFFL--SSGSAP-T-RSV
A0A2V9IXG5      --------------------------FGLHQI-RESYNVLRTELLF--NKNLRQ-H-KVI
A0A2V9J2P4      --------------------------FGLHQI-RESYNVLRTELLF--NKNLRQ-H-KVI
A0A192WQ77      --------------------------KLASGVIKEAYQSLRTSLIF--SSKNRT-R-KVV
A0A1Q7RLS4      --------------------------GTHSAF-KEAYQTLRTSLLF--SRKSRG-A-NTV
A0A2V2R525      --------------------------DAHSRL-AEVYRKLRTTVLL--SRPGKT-P-KTL
A0A321LPW6      --------------------------DSASSA-AEAYRVLRTSVLL--CAAGSP-P-RTI
A0A2V9R9V4      --------------------------DGRSPA-SEAYRALRTALLL--SAAGNP-P-KTI
A0A321LE75      --------------------------DTRSSA-AEAYRVLRTSVLL--STAGNP-P-KTI
A0A2V8R8U7      --------------------------DVRSPI-AESYRHLRTSLLL--SSAGTP-P-KTI
A0A2V8QMP4      --------------------------DVRSPV-AEAYRHLRTSLLL--SSAGQP-P-KTV
A0A2V8R4S3      --------------------------DVRSPV-AEAYRHLRTSLLL--SSAGQP-P-KTV
A0A2V8NJ55      --------------------------DVRSPI-AEAYRHLRTSLLL--SSAGQP-P-KTI
A0A2V8Q7I0      --------------------------DVRSPI-AESYRHLRTSLLL--SSAGQP-P-KTI
A0A2V8S6K4      --------------------------EVRSPV-AEAYRHLRTSLLL--SSAGQP-P-KTM
A0A317I2L9      --------------------------DVRSPV-AESYRHLRTSLLL--SSAGQP-P-KTI
A0A2V8LLF9      --------------------------DVRSPI-AESYRHLRTSLLL--SSAGMQ-P-RTI
A0A352FRF4      --------------------------DIRSPI-AESYRHLRTSLLL--SSAGTA-P-RTI
A0A2V8MKV0      --------------------------DVRSHV-AESYRHLRTSLLL--SSAGQA-P-KTI
A0A2V8PYY8      --------------------------DVRSHV-AESYRHLRTSLLL--SSAGQA-P-KTI
A0A1Q7YKQ8      --------------------------DARSSI-AEAYRHLRTSILL--SSAGQP-P-KTI
A0A352F3R7      --------------------------DARSPI-AESYRHLRTSLLL--SSAGQP-P-KTI
A0A0B6WXT1      --------------------------DVRSPI-TEAYRHLRTQLLL--STAGQP-P-RTV
A0A3B9MEU8      --------------------------DVRSPI-AEAYRHLRTSLLL--SSAGQP-P-KTI
A0A2V8MHG6      --------------------------SQRSAL-AESYRQLRTLVLL--SSAGGA-P-KTL
A0A2V8P7N1      --------------------------SQRSAL-AESYRQLRTLVLL--SSAGGA-P-KTL
A0A2V8M3M6      --------------------------SQRSAL-AESYRQLRTLVLL--SSAGGA-P-KTL
A0A1Q7NJH5      --------------------------SQRSAL-AESYRQLRTLVLL--SSAGGA-P-KTL
A0A2V8PJY0      --------------------------SQRSAL-AESYRQLRTLVLL--SSAGGA-P-KTL
A0A1Q7Y6W9      --------------------------DGRSSL-AEAYRQLRTSVLL--STAGRA-P-KSL
A0A2V8NC68      --------------------------DGQSPL-AEAYRQLRTSVLL--SSAGGA-P-QTL
A0A399WK13      --------------------------DPRSSL-AEAYRQLRTSILL--STAGHA-P-KSL
A0A352FLX4      --------------------------EKRSPV-AEAYRHLRTSILL--STAGRP-P-RTL
A0A2V8RTL7      --------------------------DPRSSL-SESYRQLRTSILL--STAGHA-P-KSL
A0A3E0PCJ6      --------------------------DSRSST-AEAYRQLRTSILL--STAGHA-P-KSL
A0A3M1S4R8      --------------------------NSRSSSLSEAYRQLRTSILL--SVAGHA-P-KSL
A0A1Q7YFI6      --------------------------DTRSPM-AEAYRQLRTSVLL--SSAGGA-P-QAL
A0A136KC10      --------------------------DPRSSL-AEAYRQLRTSILL--STAGHA-P-KSL
A0A2V8SEX6      --------------------------DSRSAL-AEAYRQLRTSILL--STAGHA-P-KSL
A0A3M2D6Y5      --------------------------SSNSSL-SEAYRQLRTSILL--SVAGHA-P-RSL
A0A0B6WWQ6      --------------------------GGESGL-AETYRQLRTSVLL--STPGHA-P-KTL
A0A3B9MK99      --------------------------DGHSPL-AEAYRHLRTSVLL--STAGRA-P-RSL
A0A352EX26      --------------------------DSRSPL-AESYRHLRTSLLL--STAGRA-P-RSL
A0A2V8MM59      --------------------------TGRSPL-AESYRQLRTSVLL--STAGRA-P-KTL
A0A2V8PFE8      --------------------------NGRSAL-AESYRQLRTSVLL--STAGRA-P-KTL
A0A2V8PWS6      --------------------------NGRSAL-AESYRQLRTSVLL--STAGRA-P-KTL
A0A2V8LCT5      --------------------------TGRSAL-AEAYRQLRTSVLL--STAGRA-P-KTL
A0A352FTJ9      --------------------------NGRSAL-AEAYRQLRTSVLL--STAGRA-P-KTL
A0A2V8G155      --------------------------RAPGNF-AEALRTIRTNVLF--ALPEEA-A-RCI
A0A2V8HDM7      --------------------------RAPGNF-AEALRTIRTNVLF--ALPEEA-A-RCI
A0A2V8DRT9      --------------------------GATPNF-AEAMRTVRTNVLF--SSTADG-G-QSI
A0A2V7VYF3      --------------------------GVPAHF-SEAFRTIRTNVLF--SSVEEG-S-RTI
A0A1F2SVH2      --------------------------GVPSNF-SESFRNIRTNLLF--SSADEG-G-RSV
A0A2V8AJG9      --------------------------GVPANF-AEAFRAIRTNVLF--SSAEEG-S-KTI
A0A2G6PYV5      --------------------------KPNDAF-SESYRHLRTNIQL--SKTTD--N-KVL
A0A2V8F956      --------------------------TAPPNF-SEAIRDLRTNVLF--SSAEKG-S-RSV
A0A1F2S1W5      --------------------------GVSALF-TESFRSIRTNVLF--SSTEEG-G-RLV
A0A1F2T595      --------------------------GVPGVF-SECFRSIRTNVLF--SSTDEG-G-RMI
A0A2V8JQV5      --------------------------KPFSLF-AECFRTTAASVLF--SEHGGTVP-QIL
A0A2V9AC41      --------------------------HPLSLV-AEAYRSLRSSLLL--SQAGGP-P-HTM
A0A2V8K4L4      --------------------------RQGSLI-AESFRAVLTSIMF--SEQR---P-RVV
A0A2V8NCZ3      --------------------------RQGSLI-AESFRTVLTSIMF--SEQR---P-RVL
A0A2V9MAM9      --------------------------NKFNAL-SESFRCLVTSILRLGGDEGQSPP-RVL
A0A2V9M454      --------------------------KPGAAI-SEAFRTLRTSVLL--STAERP-P-KVL
A0A2V9IVR7      --------------------------RPASEL-AEAYRSMRTAILL--ATSPRP-P-QVI
A0A2V9ILE2      --------------------------RPASEL-AEAYRSMRTAILL--ATSPRP-P-QVI
A0A2V9LGY4      --------------------------RPASEL-AEAYRSMRTAILL--ATSPRP-P-QVI
A0A2V9J4D6      --------------------------HPASSV-AESYRALRTSIMF--STSPKP-P-QVV
A0A2V9L9C5      --------------------------HPASSV-AESYRALRTSIMF--STSPKP-P-QVV
A0A2N9M9N1      --------------------------APGSEM-AESFRVLRTSILL--SSSPQP-P-QVL
A0A2V9JEC4      --------------------------NSSLDV-AEAFRILRTSILL--SMTPRP-P-QLL
A0A2V9LPQ3      --------------------------EPASAV-AESYRALRSAILF--SSTPEP-P-KVL
A0A348V070      --------------------------EPRCIQ-SEAFRSIRTSLLL--SFDSPT-R-KAL
A0A2Z5G3A3      --------------------------QPNSGY-VEALRAIRTSLYL--SKGGSP-P-QVV
A0A2V7UGP8      --------------------------DPASPA-SEAYKTLRTSLLL--STADAP-P-KII
A0A239MKT6      --------------------------APKSKS-AESYRQIRTAILF--SRIDDP-P-KVI
A0A3E0PCN7      --------------------------FARPVM-VEAFNQIRTSLML--STAGGP-P-KSV
A0A2V8IYW3      --------------------------GMLPVA-TEQYRRLAAILHH--AQADTG-M-RVV
G2LEI9          --------------------------LSASPI-GEAYRQLRTSILL--SSSEDVRN-RII
A0A317J121      --------------------------PASQLL-ADSFRVTLASLML--GNGTRRPP-RVI
A0A2V7YW66      --------------------------RPRTLI-SEAYRSLRTGLLL--SSARE--L-KTV
A0A2V7Z0V0      --------------------------RPRTLI-SESYRSLRTALML--SSARE--L-KAI
A0A2V8GFD4      --------------------------HVPGMF-PEALRAIRTNVLF--SFAEGS-A-KTL
A0A2V8HSS5      --------------------------HVPGMF-PEALRAIRTNVLF--SFAEGS-A-KTL
A0A2V8KP55      --------------------------EPSSVI-AESYRSVRTSFFL--SSGSAP-T-RSV
A0A399WNU1      --------------------------FNNPLI-AEAFHQLRTSLLL--STAGGS-P-KTV
A0A2V9CG11      --------------------------RKSSLS-ADCYRATVTSILL--ANQNGDLP-QVI
A0A2V2R0I6      --------------------------LPKSQM-SEAFRALRTSILL--SQADHP-P-QVI
A0A2V8XAR9      --------------------------LPKSQI-SEAFRALRTSILL--SQADHP-P-QVI
A0A2V8VZA0      --------------------------LPKSQM-SEAFRALRTSILL--SQAGHP-P-QVI
A0A1Q7CB82      --------------------------LPKSQM-SEAFRALRTSILL--SQAGHP-P-QVI
A0A2V8WIU1      --------------------------LPKSQM-SEAFRALRTSILL--SQAGHP-P-QVI
A0A1Q6Y9F5      --------------------------LPKSQM-SEAFRALRTSILL--SQADHP-P-QVI
A0A2V9EVV8      --------------------------LPKSQM-SEAFRALRTSILL--SQADHP-P-QVI
A0A2V8YF91      --------------------------LPKSQI-SEAFRALRTSILL--SQADHP-P-QVI
A0A2V8XZK2      --------------------------LPKSQM-SEAFRALRTSILL--SQADHP-P-QVI
A0A2V8ZTX6      --------------------------LPKSQV-SEAFRALRTSILL--SQAEHP-P-QVI
A0A2V9BT79      --------------------------LPKSQM-SEAFRVLRTSILL--SQAEHS-P-QVI
A0A1Q8B793      --------------------------LPKSQM-SEAFRALRTALLL--SQADHP-P-QVI
A0A2V9BCA0      --------------------------LPKSQM-SEAFRALRTALLL--SQADHP-P-QVI
A0A2V9BWU9      --------------------------LPQSQI-SEAFRALRTSLLL--SQAEHP-P-QVI
A0A2V9DKX2      --------------------------LPQSQI-SEAFRALRTSLLL--SQAEHP-P-QVI
A0A2V9JSI3      --------------------------HPASPL-AESYRALRTSVLL--STPGHP-P-QVI
A0A2V9WI32      --------------------------RPRSEL-AESYRALRTSIML--SSLGSP-P-KVI
A0A2V8IVN9      --------------------------HVTTNF-NEAFRAVRTNIIF--SSAEEG-S-RIL
A0A1F2TPT3      --------------------------GVPPEF-SEELRRIRTNLVF--SFAGDA-T-RSV
A0A2V8JTQ2      --------------------------QPMSLA-AESYKTVLTSLLL--SQPTP--P-RVI
A0A2V8UZY0      --------------------------QPLSLA-AESYRAMLTPLML--SAATP--P-GII
A0A3N5YNR8      --------------------------PARFRV-WEAYRSLRTSILL--SHSGKP-P-KVI
A0A350UEK1      --------------------------RRLSAT-AESFRAVLTSILF--SGNGHGPP-RMI
A0A350UIQ4      --------------------------RRLSAV-AESFRAALTSIMF--SGNGSGPP-RMI
A0A3N6A5T6      --------------------------DMRSRV-WEAYRSLRTSLLL--SNSGKP-P-QII
A0A1F2Q9L4      --------------------------KPRLAV-SEAYRSLRTALLL--STTNR--L-KSV
A0A1H5SQF5      --------------------------APRSVV-AEACRQIRTAILL--SRAEQ--P-RTL
A0A2Z5G448      --------------------------TPQTVG-AEAFRTLRSSILL--SSADNE-A-RLI
A0A3E0NV31      --------------------------RRSNIV-RESYRSVRTSLLL--SSASEP-P-RTI
A0A3N5M5V0      --------------------------PTRFRV-WEAYRSLRTSILL--SHSGKP-P-KVI
A0A2V9AEW6      --------------------------RKPSLI-AECVRTTLTSILL--PNQDGDPP-QVV
A0A2V8WQK6      --------------------------RKPSLL-AECTRTTLISILS--PNQNGEGP-RII
A0A2V8XIF4      --------------------------RKPSFL-AECARTTLTSILL--PSQNGDCP-GVV
A0A3N5XQP8      --------------------------ALDSPM-WEAYRRLRTCLLL--SHPDQP-P-VRI
A0A2Z5G7H4      --------------------------HPNSPY-TEALRGLRTALLL--AKSSAP-P-QLL
A0A2V9KCS3      --------------------------RKPSLL-AESFRTTLASILF--FEADGNRP-RIL
A0A2U3KC61      --------------------------RPKSEA-AEAYRALRTSILL--SSFGAP-P-KVI
A0A2V9Y2R7      --------------------------RPKSQA-AESYRALRTSILL--SSFGAP-P-KVI
A0A372IT17      --------------------------ASGSPF-SESLRTLRASLML--SRSSAP-P-QVL
A0A136JPP4      --------------------------ERHSPM-AEAYRHLRTSLLF--SSAGKP-P-QSI
A0A399WUJ8      --------------------------DRHSPM-AEAYRHLRTSLLF--SSAGKP-P-QSI
A0A2V9L5B5      --------------------------QTHAEV-LEAFRSLRTSILL--SA--SPVP-RVI
A0A2V9L7I0      --------------------------QSHADA-VEAFRSLRTSILL--SA--SPVP-RLI
A0A2V9LK56      --------------------------RRDPAA-VEAFRSLRTSILL--SA--NPSP-KIV
A0A2V9YHT3      --------------------------HPKSEI-AESYRALRTSILL--SSLGAP-P-QVI
A0A2V9NGH6      --------------------------RPQSQM-AEAYRALRTALLL--SSVGAA-P-KVV
A0A2V9PYE6      --------------------------RPQSQM-AEAYRALRTALLL--SSVGAP-P-KVV
A0A2V9NL07      --------------------------RPQSQM-SESYRALRTSLLL--TSLGAP-P-KTI
A0A2V9QD92      --------------------------RPQSQM-SESYRALRTSLLL--TSLGAP-P-KTI
A0A2V9WPZ6      --------------------------RPQSQM-AESYRALRTSLLL--SSLGAP-P-KII
A0A2V9ZLH4      --------------------------RPQSQM-AESYRALRTSLLL--SSSGAP-P-KVI
A0A2V9RQF1      --------------------------RPQSQM-AESYRALRTSLLL--TSLGAP-P-KII
A0A2V9YDK8      --------------------------RPQSQM-AESYRALRTSLLL--SSSGAP-P-KII
A0A2V9V8F7      --------------------------RPQSQM-AESYRALRTSLLL--SSLGAP-P-KII
A0A2V9XGR9      --------------------------RPQSQM-AESYRALRTSLLL--SSLGAP-P-KII
A0A2V9V3Q5      --------------------------RPQSQM-AESYRALRTSLLL--SSLGGP-P-KVI
A0A2V9NWS3      --------------------------RPQSQM-AESYRALRTSLLL--TSIGAP-P-KVI
A0A2V9USA9      --------------------------RPQSQM-AESYRALRTSLLL--TNLGAP-P-KVI
A0A2V9XW18      --------------------------RPQSQM-AESYRALRTSLLL--SNLGAP-P-KVI
A0A3M2BZG9      --------------------------KPRLAV-CEAYRSLRTALLL--SSAEE--L-RSV
A0A1Q7N5R7      --------------------------EQVLQV-IETMRSVRLSLLH--AYGTAG-P-MVI
A0A3M1SIV3      --------------------------ETSSAT-AEAFRHLRTSLLF--SSAGRP-P-QTI
A0A3E0PHB0      --------------------------DNRSGM-AEAYRHLRTSLLF--SSAGKP-P-ETI
A0A3M2D491      --------------------------SKQSPL-AEAFRHLRTSLLF--SSAGKP-P-QTI
A0A357F267      --------------------------ERNSPM-AEAYRHLRTSLLF--SSAGKP-P-QSI
A0A353C9L6      --------------------------ERHSPM-AEAYRHLRTSLLF--SSAGKP-P-QTI
A0A2V8RQV0      --------------------------ERNSPM-AEAYRHLRTSLLF--SSAGKP-P-QSI
A0A2V8SJH5      --------------------------ERRSPM-AEAYRHLRTSLLF--SSAGKP-P-QSI
A0A2V9QB26      --------------------------RKASLI-AESFRSLLTSILF--SGSNGACP-RVL
A0A2V9VYY4      --------------------------RPKSEA-AEAYRALRTSILL--SSFGAP-P-KVI
A0A2V9KIE8      --------------------------QTTAVG-KESFRTLRTSILL--SA--HPVP-RTI
A0A352F549      --------------------------TGSSVQ-AEAYKHLRTSILL--STAGRP-P-KTL
A0A3B9MLP9      --------------------------RGPTLQ-AEAYKHLRTSILL--STPGRS-P-KTL
A0A3D5SQ87      --------------------------RGPTLQ-AEAYKHLRTSILL--STPGRS-P-KTL
A0A2V8NW86      FSGSNGLPERTSKQADSLSVELVTWYRKASLI-AESYRSLLTSILF--SGSNGDCP-RVL
A0A2V8ZHL8      ---------------------------PSSAL-AESFRTLLTSVVL--STAPRP-P-QAL
A0A2V9B240      ---------------------------PSSAL-AESFRTLLTSVVL--STAPRP-P-QAL
A0A2V9CBM2      --------------------------TRHAPL-VEAFRSLRASILL--SAAEGP-R-NSF
A0A2V8XN17      --------------------------AQHAAL-GEAFRSLRTSVLL--STPDRP-P-SSL
A0A2V8WX45      --------------------------TQHGAL-VEAFRSLRTSVLL--STPDRP-P-GSL
A0A1Q6YR79      --------------------------TQHAAL-GEAFRSLRTSVLL--STPDRP-P-SSL
A0A1Q7VA32      --------------------------TQHAAL-GEAFRSLRTSVLL--STPDRP-P-SSL
A0A2V9EY85      --------------------------TQHAAL-GEAFRSLRTSVLL--STPDRP-P-SSL
A0A2V9H8K0      --------------------------TQHAAL-VEAFRSLRTSVLL--ATPDRP-P-GSL
A0A2V9FFE5      --------------------------TQHASL-VEAFRNLRTSVLL--STPDRP-P-SSL
A0A2V9GM43      --------------------------TQHASL-VEAFRNLRTSVLL--STPDRP-P-SSL
A0A1F2RFI7      --------------------------DGTNPL-SEAYRSLRTSVLL--STSGRP-P-RVI
A0A1F2RZS3      --------------------------NGNAAL-SEVYRSLRTSVLL--STSGRP-P-RVM
A0A1F2USE2      --------------------------PQRSTL-AEAFRSLRTSVLL--STAERP-P-RIL
A0A2V9C238      --------------------------TQQSAL-AEAFRSLRTSVLL--STADRP-P-RTL
A0A1F2Q9F5      --------------------------EGSTKL-GEAFRSLRTSVLL--STPEQA-P-RLL
A0A1F2QQH9      --------------------------EGSTKL-GEAFRSLRTSVLL--STPEQA-P-RLL
A0A1F2QXK7      --------------------------EGSTKL-GEAFRSLRTSVLL--STPEQA-P-RLL
A0A2V9DEM9      --------------------------TQQSAL-AESFRSLRTSVLL--STADRP-P-RTL
A0A2V9CYQ5      --------------------------TRHAPL-VEAFRSLRASILL--SAAGGP-P-NSF
A0A2V9BWU8      --------------------------KPQAAL-VEAFRSLRASVLL--STADHP-P-GSL
A0A2V8ZG48      --------------------------KRHAAL-VEAFRSLRASVLL--STADHP-P-GSL
A0A2V8Y334      --------------------------KPQPAL-VEAFRSLRASVLL--STADHP-P-GSL
A0A2V9AY68      --------------------------KPQAAL-VEAFRSLRASVLL--STADHP-P-GSL
A0A257VBK0      --------------------------ETQKVS-AEAFQTLRTAMVF--ATDNHQ-N-NAI
A0A2V7XDY0      --------------------------ANVHFV-TEAYQNLRTALIF--GRKDER-G-QIV
A0A350UQT3      --------------------------RQFSTY-EEAVRTIRSSVLL--TDFDRR-L-RTL
A0A2U3JZ71      --------------------------TSLNSF-QEAIRTLRNSILL--TDFDRR-I-RSL
A0A2V8TTB0      --------------------------QALSNY-EEAIRTLRTSILL--TDFDRS-L-RSV
A0A1F2TCR2      --------------------------QVPHDF-GEAFRSLRTSLVF--TGKSEG-P-RVI
A0A2N9LQU7      --------------------------RPASLL-AESYRVLCNSLLL--TAADRP-P-QLL
A0A2P6WFK7      --------------------------SPRSQA-AEAFRGLRTSLLL--SSPDHE-P-KII
A0A1F2V330      --------------------------DPHSVA-SEQCRMLALKTRQ--QLSGVR-S-PLL
A0A2V8U914      --------------------------KRFSKM-SEAFRATVASILS--AEQNGD-HHDVL
A0A2V7W309      --------------------------DARSPV-SEAYRAFRTSLLL--ASANSP---KII
A0A2V8TLH7      --------------------------ATRRAV-REAYQTLRTSLLF--SRKART-A-NAV
A0A1Q7ZJT1      --------------------------GTHSAF-KEAYQTLRTSLLF--SRKSRG-A-NTV
A0A2V8VC99      --------------------------ETLSAV-KEAYQTLRTSLLF--SRKNRS-A-NTV
A0A348UZU3      --------------------------APDSTF-AESYRSLRTALLL--SGPLSS-L-KSL
Q01XL7          --------------------------NKSSIL-AESFRQTLTSILR--AQPKGE-C-PVY
A0A2V8ERZ5      --------------------------HVPHDF-GESFRSLRTSLLS--KYQGDA-T-KII
A0A2V8GTX0      ---------------------------VPHDF-GEAFRALRTALVA--SSGTDA-T-RLV
A0A2V8J0X9      ---------------------------VPHDF-GEAFRSLRTSLVF--TSGAQS-T-RII
A0A372IRG7      --------------------------EPQSIV-AEGFRSLRSSILL--SAVDRE-P-KLL
A0A1F2U158      --------------------------HAPHDF-SEAFRSLRTSIAS--RYPGEG-A-KTM
A0A2V8F6S9      --------------------------RVPHDF-GESFRALRTSLVS--KYPGAG-T-KVL
A0A1I6MH75      --------------------------QPKSQF-SESFRALRTSLLL--SSTGHP-P-KFV
E8WVF6          --------------------------QPKSQF-TEAFRSLRTALLL--ASTGKE-P-RLL
A0A1H5Z7N3      --------------------------APKSQF-AESFRGLRTSLLL--ATAGKE-P-KVV
A0A1G7JVV8      --------------------------TSKSQF-SEAFRSLRTALLL--ATTGHP-P-KFI
A0A1H4T6W9      --------------------------TSKSQF-SEAFRSLRTSLLL--ATTGHP-P-KVI
I3ZEU5          --------------------------TSKSQF-SEAFRSLRTSLLL--ATTGHP-P-KII
A0A428MDU2      --------------------------QPKSQF-AEAFRSLRTALLL--SSAGHP-P-KFI
A0A239HDF6      --------------------------QPKSQF-TESFRALRTALLL--STAGRE-P-KLL
A0A1Q3QQB6      --------------------------QPKSQF-TESFRALRTSLLL--ATTGHP-P-KFI
A0A3N1K1G7      --------------------------QPKSQF-AESFRALRTSLLL--STTGHP-P-KFI
A0A2W0BGU4      --------------------------QATSEQ-SEAYRALRTSVLL--SVASRA-P-QTV
A0A2W0BVQ9      --------------------------QTTSEQ-SEAYRALRTSVLL--SVASRA-P-QTV
A0A3D1ASD2      --------------------------RYASGY-DEAVRTLRNSILL--TDFDRR-L-RSV
A0A2N9MK30      --------------------------RLLAGF-GEAVRTLRNSILL--SSFDRQ-I-KSL
A0A2V9MN96      --------------------------RPKSEA-AESYRALRTSILL--SSFGAP-P-KVV
E8UZE1          --------------------------FPQSHF-AESFRVLRSALLL--SHAGNP-P-QLI
A0A2V7V2Z1      ---------------------------VESPL-ADGYRLLRTSLSY--SWPEAA-S-RIL
A0A2V7X2F7      --------------------------STQSTF-AEAYRVIRTSLNY--SWPNTV-P-RII
A0A2V7V2I1      ---------------------------QQGPF-MEGYRVLRMALSY--SWPGQD-S-RVL
A0A2V7U3M2      ---------------------------VESPL-ADGYRLLRTSLTY--SWPESS-P-RIL
A0A2V7UHT0      ---------------------------AETPL-ADGYRLLRTSLTY--SWPDSS-S-RIL
A0A2Z5FVL3      --------------------------DPHSAY-VEALRALRTTLLS--TRGGAP-P-QVL
A0A1V6HR88      --------------------------RPRMPV-AEAYRALRTALLL--STASEL---KVI
A0A3E0P0A3      --------------------------QPRLPA-SEAYRALRTATLL--SKADEP---RLL
A0A2V9KBD6      --------------------------EPMSLA-AESYRSVLTSLLL--SQPTPP-V--VI
A0A2W0AJ66      --------------------------QPLSPA-AESYRALLTSILL--SRPTPP-A--VI
A0A1Q7RBU1      --------------------------QPLSLA-AESYRALLTSILL--SQSTPP-A--VI
A0A2V9JPV9      --------------------------QPLSLA-AESYRAILTSILL--SQPTPP-A--VI
A0A2V8EXP2      --------------------------GVPANF-SEAFRAVRTNVLF--SSADEG-P-KVI
A0A2W4RYA1      --------------------------PVPAGF-AEALRMLRTNLLF--ARADPD-M-RSV
G8P0Y7          --------------------------EPRSEI-AEAYRALRTSILL--SSVSHP-P-RSI
A0A3D4VGU2      --------------------------EPQSIV-AEGFRTLRSSILL--SSVDRE-P-KAI
C1F294          --------------------------EPQSIV-AEGFRTLRSSILL--SSVDRE-P-KAI
A0A3P0X3W6      --------------------------RTQDAY-TEAIRTMRSLVLL--ERTREK-L-RSV
A0A1E3Y9R6      --------------------------DAPAAF-SEAIRAVRTAVLF--SSAEDG-A-RSV
A0A2W4TLP2      --------------------------DAPPAF-AEAIRAVRTAVLF--SSAEEG-A-RSV
A0A3R9WF43      --------------------------NPYSPF-SESFRTLRTSILH--SHSVTR-L-QTL
A0A317HKM4      --------------------------GAPARL-TELFQAARTNLIM--APELAR-P-HIL
A0A2W0C122      --------------------------EPRTAI-AEAYRSLGTSILL--ASRDL----KSL
A0A2W0AUU7      --------------------------EPRTAA-AEACRALGTSVLL--ASADL----KSL
A0A2W0BQL1      --------------------------EPRTAA-AEACRALGTSVLL--ASADL----KSL
A0A3P0XH15      --------------------------EPQSYV-SEGFRTLRSSILL--SAVDRE-P-KLI
A0A3M1WQW8      --------------------------QRRSSF-AEAFRSLRTSVLL--SHAERP-P-RTI
A0A3N1JHC1      --------------------------ADKTFL-TETYRSAGASILF--SRNGGM-APKVL
A0A2V9KA79      --------------------------PPPSIA-TDQYNILAMKIRS--QLGDEN-G-RVL
G8P085          --------------------------SPLSVN-AEAFRNLRNALLL--SSIDRP-A-KML
Q1ILD9          --------------------------RPNSQF-SESFRTLRTSIML--SFPSRP-P-KSL
Q1IJZ6          --------------------------YEQAMA-TEAFRSLRTTLLL--SQAGSA-P-KSL
A0A2V8TCE6      --------------------------HPSSPL-AESFRDLRTALSL--SSAGST-P-RSL
Q1ITG0          --------------------------RPQSKL-AEAFRALRTSLLL--ANAGAP-P-KVI
A0A3N5PCI5      --------------------------VP-APY-AEACRALRTNVLA--SAGGGT-TGRSL
A0A3M1Q0S9      --------------------------APLSPV-AEAYRELRTAVLL--AMPDHP-P-RTL
A0A3M1VZ38      --------------------------MPLSPA-AEAYRELRTAVLL--ATPGHP-P-RDL
A0A3M1PY35      --------------------------HSVE----EAFRTLRSSLLL--SHPGGP-P-RVL
A0A3M1VMP2      --------------------------MDVE----EAFRALRSSILL--AQPQHP-P-RSL
                                                  :  .                      

A0A2V7YYV7      VVTSAEVGEGKSRTAANLAIVLAQ-A-GHWTLLIDADFRRPAQHRMF---------ARIR
A0A2V7Z0J5      IVTSAEMGEGKSRTAANLAVVLAQ-A-GYKTLLMDADFRRPAQHRIF---------ARVR
A0A2V7Z3M4      -LXXXGSGEGKSRTAANLSVVLAQ-A-GHQTLLIDADFRRPSQHRMF---------GRVR
A0A3M2D9H8      LIGSPGPDEGKTTVAVNLAIVMAQ-G-GNRVLLMDTDLRQPQVHERL---------RLPN
A0A399Y5V2      LVTSPSASEGKSTTAANIAVVLAQ-S-GKSVIIVDCDLRRPRVHKFF---------ELRN
Q01X01          VVTSSRPMEGKTTVVSNLGIALAE-I-GNRVLLIDGDLRRPRLHKVF---------DQAN
A0A2V7VMF7      LITGTAPQEGKTTTLVNLAKLLAG-S-GERTIVIDCDLRRAQIHQRL---EI-----S-R
A0A2V8JK38      VITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKIF---------KCAN
A0A2V9IXG5      MVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSIL---------STGK
A0A2V9J2P4      MVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSIL---------STGK
A0A192WQ77      LVTSSGPQEGKSTTISRLGRALAT-G-GEKVVIIDCDLRRPTQQVHN---EV-----P-R
A0A1Q7RLS4      LITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTRL---NL-----G-R
A0A2V2R525      LVTSSMPAEGKTTTAVNMATILAQ-T-GASVLIIDADMRQPTLHEIF---QL----DN-S
A0A321LPW6      LVTSGQQGEGKTTTVINTAVSLAQ-L-GAKVLIIDCDLRRPSAHKLF---KL----PN-T
A0A2V9R9V4      LVTSVRMEEGKTTTATNTAIALAQ-L-GASVLLIDCDMRNPSVHDVF---GT----SR-T
A0A321LE75      LITSGQPGEGKTFTAINTAISLAQ-L-GASVLIVDCDLRKPSTHKAL---GI----DH-S
A0A2V8R8U7      LVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHSHF---NL----SN-T
A0A2V8QMP4      LVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAHF---GL----PN-S
A0A2V8R4S3      LVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAHF---GL----PN-S
A0A2V8NJ55      LVTSSQPSEGKTTTAVNTAVMLAQ-T-GAEVLIIDCDLRRPRIHTHF---NI----SN-V
A0A2V8Q7I0      LVTSSQPSEGKTTTAINTAFMLAQ-T-GVDVLIIDCDLRRPRLHAQF---EI----SN-A
A0A2V8S6K4      LVTSSQPSEGKTTTAVNTAMMLAQ-T-GAEVLILDCDLRRPRVHMHF---NL----PN-T
A0A317I2L9      LVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHAQF---EV----SN-A
A0A2V8LLF9      LVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSQF---NL----PN-S
A0A352FRF4      LVTSSQPSEGKTTTAINTAFILAQ-T-GAEVLIIDCDLRRPRLHAHF---NI----SN-A
A0A2V8MKV0      LVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSNF---NI----SN-V
A0A2V8PYY8      LVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSNF---NI----SN-V
A0A1Q7YKQ8      LVTSSQPSEGKTTTAVNTAVMMAQ-T-GADVLIVDCDLRRPRLHAQF---NI----PN-A
A0A352F3R7      LVTSSQPSEGKTTTTINTAFMLAQ-T-GAEVLVVDCDLRRPRLHAHF---NA----PN-N
A0A0B6WXT1      LLTSSQPSEGKTTTAVNMAMMLAQ-M-GAEVLLLDCDLRRPRVHVHF---NL----AN-A
A0A3B9MEU8      LVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHAHF---GA----PN-S
A0A2V8MHG6      LVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---DV----DN-D
A0A2V8P7N1      LVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVIIVDGDMRRPRLHSIF---DV----DN-D
A0A2V8M3M6      LVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---DV----DN-D
A0A1Q7NJH5      LVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---NV----DN-D
A0A2V8PJY0      LVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---NV----DN-D
A0A1Q7Y6W9      LVTSSQPAEGKTTTATNIAISLAQ-T-GASVLIIDADMRRPRLHTIF---ET----EN-R
A0A2V8NC68      LVTSSQPAEGKTTTVVNTATILAQ-T-GATVVVIDADMRRPRLHSIF---GL----KN-E
A0A399WK13      LITSSLPSEGKTTTATNTAISLAQ-T-GASVVIIDADMRRPRLHSVF---GI----SN-A
A0A352FLX4      LITSSVPSEGKTTTAVNTAISLAQ-T-GAKVLIIDADMRRPRLHSIF---NL----SN-D
A0A2V8RTL7      LITSSLPSEGKTTTATNTAISLGQ-T-GAKVLIIDADMRRPRLHSVF---NV----SN-N
A0A3E0PCJ6      LITSSLPAEGKTTTAVNTAISLAQ-T-GAKVLVIDADMRRPRVHSFF---NL----GN-A
A0A3M1S4R8      LVTSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADMRRPRIHSIF---NI----SN-R
A0A1Q7YFI6      LVTSGVPSEGKTTTALNMAQIMAQ-T-GATVLLIDADMRRPMLHTLM---NL----DN-A
A0A136KC10      LITSSLPSEGKTTTATNTAISLAQ-T-GAQVLIIDADMRRPRLHSVF---GI----GN-A
A0A2V8SEX6      LITSSLPSEGKTTTATNTAISLAQ-T-GAKVLIIDADMRRPRLHSVF---NI----EN-G
A0A3M2D6Y5      LVTSSLPSEGKTTTAVNTAISLAQ-T-GAKVLIVDADMRRPRVHSIF---NV----QN-R
A0A0B6WWQ6      LVASSAEAEGKSTVAVNVALILAQ-T-GAQVLLIDADMRRPKLHELF---GL----KN-E
A0A3B9MK99      LVTSSLPGEGKTTTAVNTAVSLAQ-T-GASVVIIDADMRRPRLRSIF---GL----SD-R
A0A352EX26      LVTSSLPGEGKTTTAVNTAVSLTQ-T-GASVVLIDADMRRPRMRSIF---GF----SE-R
A0A2V8MM59      LVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDADMRRPRLRSIF---DL----AE-Q
A0A2V8PFE8      LITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSIF---DL----PE-R
A0A2V8PWS6      LITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSIF---DL----PE-R
A0A2V8LCT5      LVTSSLPGEGKTTTAVNTAISLAQ-T-GANVLIIDADMRRPRLRSIF---DL----SE-R
A0A352FTJ9      LVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDGDMRRPRLRSIF---DL----PE-R
A0A2V8G155      LVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHELL---------GGPQ
A0A2V8HDM7      LVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHELL---------GGPQ
A0A2V8DRT9      VVTSSGPGEGKTVVSSNLALALAQ-T-GQRVLLIDADMRRPRVHQVF---------AERQ
A0A2V7VYF3      VVTSTGPGEGKTVVSSNLALALAQ-A-NQRVLLVDADMRRPQIHSYF---------SHPQ
A0A1F2SVH2      LITSTGPSEGKTVVATNLAVALAQ-A-GQRVLLMDADMRKSRVHIVF---------DRSQ
A0A2V8AJG9      VITSTAPGEGKTTVASNIGIALAQ-A-SQRVLIVDADMRKPRVHSVF---------GQTQ
A0A2G6PYV5      LLSSALSGEGKTVSSLNLAISFAQ-L-EKKTLIIDCDLRRPKLHKIF---NL----PN-A
A0A2V8F956      VVTSTGPGEGKSLVAANLAISLAH-A-TQRVLVLDADLRKPQVHDIF---EV----AQ-E
A0A1F2S1W5      VITSSAPGEGKTMVVTNLAVALAQ-A-GHRVLLMDADMRKPRVHEVF---GV----PS-S
A0A1F2T595      AVTSSAPGEGKTVVSTNLSIALAE-A-GHRVLLLDADMRKPRVHEIF---------SRRV
A0A2V8JQV5      VVTSANPQDGKSTMASNLAVALAE-T-QRRVLVIDSDLRRPDLHRIF---------HAEN
A0A2V9AC41      LMTSATRGEGKTTTLVNTAIVFSQ-L-GIRVLVIDADLRRPRCHMLL---KM----EN-T
A0A2V8K4L4      VISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRLF---DL----KN-D
A0A2V8NCZ3      VISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRLF---DM----KN-D
A0A2V9MAM9      VITSTLPAEGKTTVATNLGITLAS-I-QRRVLLIDGDMRQPRIHHIF---DL----PN-T
A0A2V9M454      LITSAQPSEGKTATTLNLAVTLAQ-K-GSRVLLIDSDLRRPGLAKAL---KL----RN-Q
A0A2V9IVR7      VMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM---GM----SN-E
A0A2V9ILE2      VMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM---GM----SN-E
A0A2V9LGY4      VMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM---GM----SN-E
A0A2V9J4D6      LVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKLM---GI----SN-S
A0A2V9L9C5      LVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKLM---GI----SN-S
A0A2N9M9N1      LVTSAHPSEGKTFASVNLALALAQ-R-GGRVLLVDGDLRKPTVLRAL---GMGNGESE-A
A0A2V9JEC4      LITSPLPCEGKTSCSINLAASLAQ-R-GGRVLLLDADLRRPGVARAL---SL----DG-K
A0A2V9LPQ3      LVASSQPKEGKTCTSINLALSLAQ-N-SVPVLIIDADLRKPGVTREL---NL----PS-T
A0A348V070      IFSSPLSKDGKSSVISNLGLALAQ-A-HKRVVIVDSDLRKPRQQEIF---NV----DY-T
A0A2Z5G3A3      LITSSIEGEGKSTLAANFAVLLAR-Q-GKKVLLVDGDLRRPKLHTTF---DV----AM-E
A0A2V7UGP8      VVTSSEPQEGKTVTTLNTAISLTQ-S-GKKVLLVDGDMRRPRLHKAL---GS----GN-G
A0A239MKT6      LFTSGISGEGKSTTAYNMAVAFAL-Q-TKRVLLIDADMRRPTIRERV---NL----QQ-G
A0A3E0PCN7      LVTSGQPFEGKTINSLCLAKSMAE-L-GKKVLLIDADMRCPKMHLIN---DL----SN-T
A0A2V8IYW3      MVTSAISGEGKSLTITNLALTLTR-SYERRVLLIDADLRRPTLHTIF---KL----ES-P
G2LEI9          LITSSQPGEGKTTTSFNTAISLAQ-T-GASVLLIDCDLRRPQLQKLFDSYGQ----ERTF
A0A317J121      LVTSPGAGEGKTTIVSNLGTALAE-T-GRSVLILDGDFRRPRLHKVF---DL----AD-T
A0A2V7YW66      AVTSAMAGEGKTATAVNLAIVLAQ-L-GRQVLIVDCDLRKPRLHQVL---RV----SN-R
A0A2V7Z0V0      AVTSAVAGEGKTATASNLAVVLAQ-L-GRQVLLVDCDLRKPRLHQVF---RV----SN-R
A0A2V8GFD4      VITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQLF---AL----DQ-E
A0A2V8HSS5      VITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQLF---AL----DQ-E
A0A2V8KP55      VITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKIF---KC----AN-A
A0A399WNU1      LVTSGEPSEGKTITSLNLAKSLAQ-L-GGKVLLVDADLRCPKMHLIN---NI----DN-S
A0A2V9CG11      VVTSPCQGEGKTTVASNLSIAIVE-L-GRRVLLIDGDLRRPRLHKVF---GL----CN-N
A0A2V2R0I6      LVTSALPREGKTTAAANLAVTLAQ-L-GDSTVVVDADLRKPGVGRLL---NL----SNNK
A0A2V8XAR9      LVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----GSGK
A0A2V8VZA0      LVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AGGK
A0A1Q7CB82      LVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AGGK
A0A2V8WIU1      LVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AGGK
A0A1Q6Y9F5      LVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AAGK
A0A2V9EVV8      LVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AAGK
A0A2V8YF91      LVTSALPREGKTTVAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----GPGK
A0A2V8XZK2      LVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----GTGK
A0A2V8ZTX6      LVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIARLL---NL----GGGK
A0A2V9BT79      LVTSALPREGKTTAAANLAVTLAQ-L-GDRTVLVDADLRKPGIGRLL---NL----GAGK
A0A1Q8B793      LVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRAL---SL----GEGK
A0A2V9BCA0      LVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRAL---SL----GEGK
A0A2V9BWU9      LVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRAL---SM----SDGK
A0A2V9DKX2      LVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRAL---SM----SDGK
A0A2V9JSI3      LITSSQPNEGKSCTCLNLALTLAQ-R-GGRVVIIDGDLRKPGVASVL---GL----AN-G
A0A2V9WI32      LVTSALPQEGKTTTSINSAIVLAQ-R-GGRVLLVDADLRRPGVHKAL---GL----RN-T
A0A2V8IVN9      VVTSTGPGEGKTTFASNLAVSLAQ-T-GQRVLLIDGDMRKPKLQEAF---GM----TQ-E
A0A1F2TPT3      VITSASPTEGKTVVGSNLAVALAQ-A-GERVLLMDADLRRPMIHTHF---AF----PQ-E
A0A2V8JTQ2      QVTSALPGGGKTTVSTNLAILLAR-L-RRRVLLVDADLRRSQIHLAM---RL----SG-N
A0A2V8UZY0      LVTSAVPGEGKTTVCTNTAILLAR-L-HRRVLLVDADLRRPSIHRAM---RL----SC-N
A0A3N5YNR8      MVTSSVPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALASTF---GY----NG-N
A0A350UEK1      VVTSASPSEGKTTVATNLALAMAE-T-GQRVLLVDGDTRRPRQHGIF---EV----PN-D
A0A350UIQ4      VVTSPNPSEGKTTVATNLAVAMAE-T-GQKVLLIDGDTRRPRIHGIF---EI----EN-E
A0A3N6A5T6      LVTSALPAEGKTTTALNAAIVLAQ-T-SARTLLIDLDMRRPKIGSHF---GL----NG-H
A0A1F2Q9L4      VVTSAIPGEGKTSTAVNLAVVLAQ-L-GRQVLLVDADLRKPRLHEIF---GV----SN-R
A0A1H5SQF5      LFTSSFSGEGKSTLTSNMAFAFGL-Q-GSRVLLMDADMRRPTLHTKL---GL----TN-G
A0A2Z5G448      LITSSLEAEGKSTIAANLAISFAR-R-DARVLLVDTDLRRGTLHLKF---RL----PN-R
A0A3E0NV31      LVTSALPAEGKSTTVANMAISFAN-N-NARTLIIDLDLRKPALAPLF---EV----DS-E
A0A3N5M5V0      MVTSSIPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALAGTF---GF----TG-N
A0A2V9AEW6      LLTSPCLGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRIHQVF---GM----TN-R
A0A2V8WQK6      VLTSACPGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRLHKIF---GV----AN-T
A0A2V8XIF4      VLTSPSSGDGKTTVACNLAIAMAE-I-GRKVLLIDGDLRRPRLHKVF---GA----PN-N
A0A3N5XQP8      LIASAMPGEGKTTTAAYTGVVLAE-T-GAPTVLIDLDLRRAGLTGLF---EI----EN-K
A0A2Z5G7H4      LITSSVAGEGKSILSANLAAVLAQ-S-GRRVLLVDADLRKPSLGDRL---GM----ES-R
A0A2V9KCS3      VMTSSAPGEGKTTVTSNLAIALAE-I-SRRVLVIDADMRRPRIHDIF---DV----AN-T
A0A2U3KC61      LVTSAMPQEGKTTVSANSALVLAQ-R-GSRVLLVDADLRRPSIAKLF---GF----QS-R
A0A2V9Y2R7      LVTSALPQEGKTTISANSAVVLAQ-R-GSRVLLVDADLRRPGIGKMF---GI----RS-G
A0A372IT17      LVTGTRDAEGKSTIALNLAAILAH-Q-GAQVLLVDGDLRRPALHRYL---NM----PE-S
A0A136JPP4      LVTSSQPSEGKTMTAINTAITLAQ-A-DADVVLIDCDLRRPRMHSHF---GL----SN-S
A0A399WUJ8      LVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVLIDCDLRRPRMHSHF---GL----SN-T
A0A2V9L5B5      LITSALPGEGKTTTAVNLGAALAS-L-GSKVVVIDCDMRRPSCHRSV---GV----KN-S
A0A2V9L7I0      LITSALPGEGKTTTTVNLGAALAS-L-GSRVVIVDCDMRRPACHRST---GV----RN-A
A0A2V9LK56      LVTSALPSEGKTTITVNMGATLAS-L-GSKVLVLDCDMRRPTCHRAT---GV----PN-R
A0A2V9YHT3      LVTSALPQEGKTTTAVNCGIVLAQ-Q-GSRVLLVDADLRRPAVHHSL---GI----RS-N
A0A2V9NGH6      VVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKTL---GM----GP-R
A0A2V9PYE6      VVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKTL---GM----GP-R
A0A2V9NL07      LITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKTL---GM----GP-R
A0A2V9QD92      LITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKTL---GM----GP-R
A0A2V9WPZ6      LITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL---GM----GP-R
A0A2V9ZLH4      LVTSAMPQEGKTTTSINCAIVLAQ-K-GTRVLLVDADLRRPGVHKAL---GM----GP-R
A0A2V9RQF1      LITSALPQEGKTTTSINTAVVLAQ-K-GTRVLLIDADLRRPSIHKTL---GM----GP-K
A0A2V9YDK8      LVTSALPQEGKTTTSINCAIVLAQ-K-GVRVLLIDADLRRPGVHKTL---GM----GP-R
A0A2V9V8F7      LITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL---GM----GP-R
A0A2V9XGR9      LITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL---GM----GP-R
A0A2V9V3Q5      MVTSARPQEGKTTTAINSAIVLAQ-K-GVRVLLVDADLRRPSVHKTL---GM----GP-R
A0A2V9NWS3      LVTSALPQEGKTTTSINTAIVLAQ-K-GTRVLLIDADLRRPSIHKAL---NI----AT-K
A0A2V9USA9      MVTSALPQEGKSTTSINCAIVLAQ-K-GVRVLLIDADLRRPSIHKTL---GM----GP-R
A0A2V9XW18      IVTSALPQEGKTTTSINTAVVLAQ-K-GVRVLLIDADLRRPSIHKTL---GM----GP-H
A0A3M2BZG9      AVTSAEPGEGKTATTTNLGVVMAQ-L-GRSVLIVDCDLRRPRMHQVF---KT----SN-R
A0A1Q7N5R7      TITSPAVGDGKSFVSTNLALACAQ-A-GQRTMLVDGDTRRGALHRVL---GG----VR-K
A0A3M1SIV3      LITSSQPSEGKTTIAVNTAVALAQ-A-GADVVLIDCDLRRPRIHQHF---SL----KN-S
A0A3E0PHB0      LVTSSQPSEGKTTTAINTAITLAQ-S-GAEIVIIDCDLRRPRLHSLF---DL----EN-T
A0A3M2D491      LITSSQPAEGKTTTAINTAIALAQ-S-GADVVLIDCDLRRPRIHEHL---SL----SN-K
A0A357F267      LVTSSQPSEGKTTTAINTAVTLAQ-S-DVDVILVDCDLRRPRLHSYF---DL----DN-T
A0A353C9L6      LITSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRLHSHF---DL----EN-T
A0A2V8RQV0      LVTSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRVHSYF---DL----DN-T
A0A2V8SJH5      LVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVIVDCDLRRPRLHTYF---DL----EN-T
A0A2V9QB26      VLTSAGPKEGKTMVASNLGIALAE-T-KRKVLIIDGDLRKPRMHELF---GL----PN-G
A0A2V9VYY4      LVTSAMPREGKTTISANSALVLAQ-R-GSRVLLVDADLRRPGVEKLF---GV----RA-H
A0A2V9KIE8      LITSALPGEGKTTTTVNLGVALAG-L-GSKVLIIDCDMRRPACHRAT---GV----EN-K
A0A352F549      LVTSSVPAEGKTTTVVNTATVLAQ-T-GAQVLIIDADMRRPRLHQVL---DM----SN-D
A0A3B9MLP9      LVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHVF---GL----SN-N
A0A3D5SQ87      LVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHVF---GL----SN-N
A0A2V8NW86      VLTSAGPKEGKTTVATNLGIALAE-T-KRKVLIIDGDLRKPRMHELF---DL----PN-G
A0A2V8ZHL8      LITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAESL---DL----ID-G
A0A2V9B240      LITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAESL---DL----VD-G
A0A2V9CBM2      LVTSTQPSEGKTTVASNLAIALAQ-L-GRRVLLVDADLRSPSLHRLF---GA----RE-S
A0A2V8XN17      LVTSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-S
A0A2V8WX45      LVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLVDADLRFPSLHKLF---GT----SG-S
A0A1Q6YR79      LITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-T
A0A1Q7VA32      LITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-T
A0A2V9EY85      LITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-T
A0A2V9H8K0      LVTSTQPAEGKTTVACNLAISLGQ-L-GHRVLLLDADLRFPSLHKLF---GT----SG-S
A0A2V9FFE5      LVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKLF---GT----SG-S
A0A2V9GM43      LVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKLF---GT----SG-S
A0A1F2RFI7      LVTSGQPGEGKTTTVVNLAIALVQ-L-GGRVLVVDSDMRRPRVGNLL---EL----PA-T
A0A1F2RZS3      LITSGQPGEGKTTTTVNLAIALVQ-L-GGRVLVVDSDMRRPRIGTLL---KL----PT-T
A0A1F2USE2      LVTSAQPGEGKTTITLNLAISLAQ-L-GQRVLLIDGDMRRPCLHKVF---QL----YE-S
A0A2V9C238      LVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKAF---DI----DN-S
A0A1F2Q9F5      LTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF---KM----AG-G
A0A1F2QQH9      LTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF---KM----AG-G
A0A1F2QXK7      LTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF---KM----AG-G
A0A2V9DEM9      LVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKAF---DI----DN-S
A0A2V9CYQ5      LVTSTQPSEGKSTVATNLAIALAQ-I-GRRVLLVDADLRSPSLHRLF---GA----RE-S
A0A2V9BWU8      LITSTQAGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQRLF---CI----RE-S
A0A2V8ZG48      LITSTQPGEGKTTVATNLAISLAQ-L-GQRVLLVDADLRFPSLEKLF---CI----RE-N
A0A2V8Y334      LVTSTQPGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKLF---CI----RE-T
A0A2V9AY68      LVTSTQSGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKLF---CI----RE-C
A0A257VBK0      LVTSASPKEGKTSVSANLAKTLAA-G-GDRVLLMDCDLRRPSIHRIL---KA----PA-G
A0A2V7XDY0      LVTGTVPQEGKTTTIVNLGKLLAS-S-GEKAVLVDFDLRRGQLHSRL---GL-----T-R
A0A350UQT3      LMTSATASEGKSTTAGHLAFAHAE-Q-RKRTLLIDCDLRRPSQHKLF---GI-----P-L
A0A2U3JZ71      MITSSGPAEGKSTTAAHLALAHAQ-Q-GRKTLLIDGDLRRPSIHRRF---EV-----P-S
A0A2V8TTB0      LLTSASPSEGKSTVAAHLAATHAG-Q-HKRTLLIDGDLRRPSVHRLY---QV-----P-N
A0A1F2TCR2      AVTSSQPLEGKTTTACNLAMVLAL-G-GSRVLLIDADMRRPGLHKIV---GI-----P-N
A0A2N9LQU7      VVTSAFPSEGKSVSSCNLAITLAQ-R-GSRVLLVDADLRRSTLLRQL---GL----EAGT
A0A2P6WFK7      TVVSSVPAEGKTTVSVNLASAFAQ-R-GESVLLIDADLRRSTTHTHF---GL----PY-S
A0A1F2V330      AISSVVGGEGKTVTSLNLSLALAGTV-SGRVLLIDSDLRKPRVHEYL---GL-----K-P
A0A2V8U914      VITSPLAGEGKTTVSSNLGIALAE-V-RGRVLLIDGDMRRPRLHKIF---GL-----A-N
A0A2V7W309      VITSSFAREGKTTTSVNLATVLAQ-M-GKPVLLIDADLRRPRLQKVF---PG-----K-L
A0A2V8TLH7      LVTSAGPQEGKSCTSVNVARTLAN-A-GEKVVIIDCDLRRPTVHQWL---KL-----S-K
A0A1Q7ZJT1      LITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTRL---NL-----G-R
A0A2V8VC99      LITSAGPQEGKSCTTVNVARTLAT-A-GERVMILDCDLRRPAIHTRL---NL-----S-R
A0A348UZU3      IITSPLPNEGKSVTISNLAVSLAQ-T-EKKVLLMDADLRRPKQHRIF---NL-----K-N
Q01XL7          VITSGGPGEGKTTLSANLAIAMAM-I-GQRVLLIDADLRRARLHSVF---GL-----D-N
A0A2V8ERZ5      TVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRPL---RL-----T-N
A0A2V8GTX0      AITSTQPLEGKTTTAVNVALALAI-G-GARVLLIDADMRRPSLHKAM---RL-----P-N
A0A2V8J0X9      AVTSSQPLEGKTTTACNLAMALAF-G-GSRVLLIDADMRRPGLHKTV---GL-----R-N
A0A372IRG7      LLTSGFAAEGKSTCSSNLAVSFAQ-R-NARVLLVDTDLRKGTLHMKF---RL-----S-N
A0A1F2U158      IVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRSL---RL-----T-N
A0A2V8F6S9      LVTSAQPLEGKTTTAANVAMALAY-G-GSRVLLIDADMRRPGLHRPL---RS-----T-N
A0A1I6MH75      LFTSATPSEGKTTTACNLACILAQ-R-DTRVLLIDADLRRPNVHHRF---GL-----S-G
E8WVF6          LFTSATPSEGKTTAASNLAVILAQ-G-GTRTLLIDADLRRPNVHHRF---GL-----N-G
A0A1H5Z7N3      LVTSSTPSEGKTTVSTNLATVLAQ-R-DVKTLLIDADLRRPTVHHRF---GL-----N-G
A0A1G7JVV8      LITSSTPSEGKTTVSTNLAAILAQ-R-ETRVLLIDADLRRPNVHHRF---GL-----N-G
A0A1H4T6W9      LISSSTPGEGKTTVATNLAAILAQ-R-DTKVILIDGDLRRPNVHHRF---GL-----N-G
I3ZEU5          LISSSTPGEGKTTVATNLAAILAQ-R-ETRVLLIDADLRRPNVHHRF---GL-----N-G
A0A428MDU2      LFTSATPSEGKTTTASNLACILAQ-R-DARVLLIDADLRRPNVHHRF---GL-----N-G
A0A239HDF6      MFTSAAPGEGKTTTSINLAAILAQ-R-GARVLLIDADLRRPAVHVRL---GL-----E-G
A0A1Q3QQB6      LLTSATPSEGKTTLSTNLACILAQ-G-DARVLLIDADLRRPSVHHRF---GM-----S-G
A0A3N1K1G7      LFTSATPSEGKTTTASNLACILAQ-A-DTRVLLIDADLRRPNVHHRF---GL-----N-G
A0A2W0BGU4      LITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPVLARLL---GI-----Q-N
A0A2W0BVQ9      LITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPILARLL---GI-----Q-N
A0A3D1ASD2      LLTSASPSEGKSTVAAHLAVAHAE-Q-KHRTLLIDGDLRRPSLHKFF---DM-----P-M
A0A2N9MK30      MVTSATPGEGKSTVCVHLAMAHAQ-Q-NHRTLLIDCDLRRPSVHRRL---GL-----T-S
A0A2V9MN96      LVTSALPQEGKTTVSANSAVVLAQ-K-GGRVLLVDADLRRPGVARAL---GL-----K-T
E8UZE1          VICSAWTKEGKSTITINLATVLAQ-M-NRKVLLVDADLRRPSLHHKL---GL----PK-T
A0A2V7V2Z1      LVTSTSAGEGKTVTSVNLALILAS-L-GGRVLLVDCDLRRPQSHVLL---RG-----R-K
A0A2V7X2F7      VVTSTAPGEGKTLTSVNLSLTLAS-S-EGKVLLIDADLRRPQAHTLL---RG-----R-R
A0A2V7V2I1      VLTSTAPGEGKTLTSVNLALTLAT-M-DGQVLLLDADLRKPQAHELL---GL-----K-K
A0A2V7U3M2      LVTSTSAGEGKTVTSVNLALILAS-L-GGKVLLIDCDLRRPQSNTLL---HA-----K-R
A0A2V7UHT0      LVTSTSPGEGKTVTSVNLALILAS-M-GGKVLLIDCDLRRPQSHTLL---RG-----K-K
A0A2Z5FVL3      LVTSSTEGEGKSTLSSNLAVVLAQ-Q-GKRVLLVDADLRRPNLHVLF---NS-----S-L
A0A1V6HR88      VITSSIPGEGKTSTASNLAIVLAQ-L-GKNVLLIDGDLRKSRLHELF---GM-----S-N
A0A3E0P0A3      VVTSTEAQEGKTATALNLAIVMAQ-L-ARRTLLIDGDLRKPRIHEAL---GI-----S-N
A0A2V9KBD6      QVTSALAAEGKTTVSANLAILLAR-L-RRRVLLIDADLRRPRIHLAM---QL-----N-A
A0A2W0AJ66      MMTSALPSEGKTTVAMNTAIALAR-L-GRRVLLVDGDLRRPSVHRAM---QL-----T-S
A0A1Q7RBU1      LVTSALPREGKTTVSTNLAIAIAR-L-RKRVLLVDADLRRPSIHRAM---GL----KT-T
A0A2V9JPV9      LVTSALPREGKTTVSTNLAITLAR-L-RRRVLLVDADLRRPSIHRAM---GL-----S-T
A0A2V8EXP2      VVTSAGPGEGKTLVASNLAVAMAQ-A-AQRVLLMDADMRRPRVHSLF---GI-----A-Q
A0A2W4RYA1      MVTSTGVGEGKSVVAGNLAVAIAQ-T-GQRVLLVDADLRRPRAHGLF---GL-----A-Q
G8P0Y7          LVTSSVPEDGKTMTSINIAIVMAQ-Q-EKRILLVDADMRRPSVHTAF---KI-----K-G
A0A3D4VGU2      LLTSGLAAEGKSTCAANLAISFAQ-R-PARVLLVDTDLRKGTQHLKF---RV-----S-N
C1F294          LLTSGLAAEGKSTCAANLAISFAQ-R-PARVLLVDTDLRKGTQHLKF---RV-----S-N
A0A3P0X3W6      QVTSAVAGEGKSTCTAHLAIAHAM-Q-GRKTLLIDADLRRPSQHNHF---SL-----P-N
A0A1E3Y9R6      VVTSTGPHEGKTVVSSSLAITLAQ-A-GQRTIVVDADMRRPRMHEAL---DR-----S-Q
A0A2W4TLP2      VITSTGPHEGKTVVSSSLAIALAQ-A-GQRTVVVDGDMRRPRMHEAL---DR-----S-Q
A0A3R9WF43      LVTSPHGGDGKTTVAYNLAVAFAQ-Q-GSRVVLLDADLRNPDLHRLF---GC-----E-N
A0A317HKM4      LVTSSEPGEGKTVTAANLAASLAG-L-HQRVLLIDADLRKPGLHQLF---GE-----E-Q
A0A2W0C122      LVSSPLPAEGKTMTAANVAVVLAQ-Q-GKAVLLVDADLRKPGLDREF---GI-----A-G
A0A2W0AUU7      LVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDREF---RI-----A-S
A0A2W0BQL1      LVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDREF---RI-----A-S
A0A3P0XH15      LLTSSFATEGKSTCAANLAISFAR-R-SARVLLVDTDLRKGTLHMKF---RT-----S-N
A0A3M1WQW8      LFTSSSPGEGKTTTAVNTAISLTQ-T-GARVMLIDGDLRKPGLHKML---SI-----N-H
A0A3N1JHC1      LVTSPHPRCGKTVTIANLAISLAE-G-GRRVLLIDGDLRRPALPQLF---GV-----Q-N
A0A2V9KA79      TITSAAGGEGKTLTSVNLSLALASTF-EGQVLLVDADLRKPRIHHYL---DI-----R-P
G8P085          LVSSTIPGEGKSSTTANYGVVLAQ-K-GARVLLVDADLRRPALHSKF---GV-----E-N
Q1ILD9          VVTSALPGEGKSTISMNVAGTLVQ-R-GARVLLVDADMRRGRLASRA---GA-----Q-E
Q1IJZ6          LLTSSLPGEGKSTTTYGLGRCFGS-L-GTRVLLIDADLRRPTLHKHA---MK-----E-N
A0A2V8TCE6      TVASTRPEEGKSTIAINLATVLAQ-S-GKKVLLVDSDLRRPRLHRAF---GL-----R-N
Q1ITG0          MITSAQPGDGKSTVSVNISAVLAQ-S-GARVLLVDADLRRGVLARNL---KV-----M-P
A0A3N5PCI5      LVTSAAPGDGKSIVAVNLAVALGR-S-GGRVLVIDADLRRPVLHQVL---EC-----E-Q
A0A3M1Q0S9      AVTSCQPGEGKTTTAINLATTLAQ-L-GRRVLVVDTDLRRPRCHQIL---KA-----S-T
A0A3M1VZ38      TVTSCQPGEGKTTTAVNLAIALAQ-L-GRQVLLVDSDLRRPRCHDVL---GV-----E-K
A0A3M1PY35      MVTSALPGEGKSTFSANLARTLAA-F-GDRVVLLDADLRHPRLHRAF---KA-----P-R
A0A3M1VMP2      LVTSALPGEGKSTIAANLARTLGA-F-GRKVVLIDADLRHPRLHRVF---RV-----P-S
                         **:      .            :::* * *                     

A0A2V7YYV7      NVGLSNLI--LQDAAESEA-------IAT-VESVPNLCVLTSGPTPP-NPSELLGSGRMR
A0A2V7Z0J5      NIGLSNVI--IQDAAEEET-------ITA-VDAVPNLWLLTSGSIPP-NPSELLGSGRMR
A0A2V7Z3M4      NVGLSNVI--LGATTEEAT-------VIA-VDSVPNLWLLTSGPTPP-NPSELLGSGRMK
A0A3M2D9H8      RLGLSDIL--REHSTLDES-L---HHLTT-EG----IDVLTSGTLPP-NPAEVLSSERMA
A0A399Y5V2      TEGVTTAI--LAERPLVDL-L---QRPRI-AGAPPSLLALTSGPIPP-NPADLLGSARVS
Q01X01          SWGLSDLL--REKNAIEDLPL---DVLVK-KTAVPRLSLLPSGTGTD-NIFGLLCSGRMA
A0A2V7VMF7      APGFTDYF--VRHE----DLD---SLIQS--TRVPNLFALTAGPLPP-NPPAMLARKNVA
A0A2V8JK38      ANGLSSVL--EGHC----SLE---NAVSE--TNIKNLFLLPSGPVRP-NPGELILSPRFK
A0A2V9IXG5      QNGNSIFSPVEGLK----------LRVEQ--TQLPSLHLTVAESLPQ-NPPYLLSQPSLR
A0A2V9J2P4      QNGNSIFSPVEGLK----------LRVEQ--TQLPSLHLTVAESLPQ-NPPYLLSQPSLR
A0A192WQ77      SPGLTNFL--AAPE----SDKDWRPFAKE--TDTATLQIIPAGPTPP-SPPDMLTSDRFL
A0A1Q7RLS4      DGGVTNYILSSEGD----DWR---SYIKN--TDMPNLYAMTCGPIPP-NPADVFGHERFL
A0A2V2R525      -HGLSTLL--AGKN-NQAEML---SLIHQ--HEETGLYVLPAGPPPI-KPAELLSSGQMR
A0A321LPW6      -AGLSTYL--SREI-DVEALI---HTQ-----ELKNLSLLPCGPIPP-NPAELLSSQKMK
A0A2V9R9V4      -LGLSTYL--VRNV-EIDELT---QDL-----PGENLRMISSGPIPP-NPAELLSSERMK
A0A321LE75      -HGLSNYL--SRDV-AIDGLI---QKL-----PIPNLSILTCGPIPP-NPAELISSEKMK
A0A2V8R8U7      -RGLTNCL--SGES-EVADLL---QTY----DKLPKLKLLTSGPIPP-NPAELLGSEEMR
A0A2V8QMP4      -RGVTNYL--SGEA-QVSELV---QTY----DKLPNLKVITSGPVPP-NAAELLGSEEMR
A0A2V8R4S3      -RGVTNYL--SGEA-QVSELV---QTY----DKLPNLKVITSGPVPP-NAAELLGSEEMR
A0A2V8NJ55      -KGLTNCL--SGDL-NTDELI---QAY----EKLPNLKIMTSGPVPP-NPAELLGSDEMR
A0A2V8Q7I0      -RGLTTWL--SGEK-DLDGII---QTC----PRVPHLKILTSGPVPP-NPAELLGSEEMR
A0A2V8S6K4      -RGVTNYL--SGEI-NVSELI---QTY----DKQPNLKVITSGPVPP-NAAELLGSEQMR
A0A317I2L9      -RGLTTWL--SGEK-DLDGLL---QSL----PRNPNLKILTSGPVPP-NPAELLGSEEMR
A0A2V8LLF9      -RGLTNCL--SGDGKDLDALL---HVY----DKQPNLKLLTSGPIPP-NPAELLGSDEMR
A0A352FRF4      -RGLTNCL--SGEASEIDSVI---QSY----AALPNLKLLPSGPMPP-NPAELLGSEEMR
A0A2V8MKV0      -RGLTNFL--SGEL-PLDEVI---QPF----EKLPNLKLLPSGPIPP-NPAELLGSEQMR
A0A2V8PYY8      -RGLTNHL--SGEL-PLDEVI---QPF----DKQPNLKLLPSGPIPP-NPAELLGSEQMR
A0A1Q7YKQ8      -RGVTNYL--SGEA-GLDELI---RSY----DKLPNLKLMTSGPVPP-NPAELLGSDEMR
A0A352F3R7      -KGLTNWL--SGET-DIDNLM---QTL----PAQPNLKFLTSGPVPP-NPAELLGSDEMR
A0A0B6WXT1      -KGVANYL--AGER-NLDALM---QTY----APLPNLKIMTSGPVPP-SPAELLSSEEMR
A0A3B9MEU8      -KGLTNWL--SGET-DIDALI---QTY----EQHANLKFLTSGPVPP-NPAELLGSDEMR
A0A2V8MHG6      -KGLSGIL--ASKM-TEGEML---GCVQQ--HEESSLYLLPSGRLPP-NPAELLGSDQIR
A0A2V8P7N1      -KGLSGIL--ASKM-SEAEML---NCVQQ--HEESSLYLLPSGRLPP-NPAELLGSDQIR
A0A2V8M3M6      -KGLSGIL--ASKM-SEAEML---NCVQQ--HEESSLYLLPSGRLPP-NPAELLGSDQIR
A0A1Q7NJH5      -KGLSGIL--ASKM-SEREML---GWVQQ--HEESSLYLLPSGRLPP-NPAELLGSDQIR
A0A2V8PJY0      -KGLSGIL--ASKM-SEREML---GWVQQ--HEESSLYLLPSGRLPP-NPAELLGSDQIR
A0A1Q7Y6W9      -KGLSTYL--SSDM-SDAELL---DMIEQ--HGASGLHYLTSGPVPP-NPAELLGSEQMR
A0A2V8NC68      -SGLSTIL--ANKM-SEAEML---SLVEQ--HEESGLYMLSSGPIPP-NPAELLGSDQMR
A0A399WK13      -DGLSTIL--SNDL-SEAEIL---NIITQ--DESSKLHLLTSGPVPP-NPAELIGSDQMA
A0A352FLX4      -SGLSALL--SREA-SEAEII---SAIQH--DEASGLSVLTAGPVPP-NPAELVGSEQML
A0A2V8RTL7      -QGISTVL--SSEL-STKEIL---DVINY--DERTKVSVMTSGPIPP-NPAELIGSEQMV
A0A3E0PCJ6      -EGLSTVL--SSDL-AEKEIL---NLVKK--DEASGLYLMPSGPLPP-NPAELVGSEQMK
A0A3M1S4R8      -EGLSNLL--SSEI-KRDKVL---DSVYF--DMSSRLYLLPSGPVPP-NPAELIGSTQMS
A0A1Q7YFI6      -RGLSTIL--STDM-SAAEML---SLIEQ--QAGSGLYLLSSGPVPP-NPSELIGSEQMQ
A0A136KC10      -DGLSTIL--ANEL-SEAEIL---NLITQ--DPSSKLHLLPSGPIPP-NPAELIGSEQMA
A0A2V8SEX6      -DGLSTIL--STEM-TEKEIL---KVVKQ--DEGTKLNLLTSGPIPP-NPAELIGSEQMA
A0A3M2D6Y5      -EGLSNLL--SSEI-KADKVL---DKVQF--DSAAKLYILPSGPVPP-NPAELIGSKSML
A0A0B6WWQ6      -RGLSTLL--SSEI-RNGDAF---KCIH---DSARGVQVLTSGPLAP-HPAELLGSDQMR
A0A3B9MK99      -AGLSSIL--SSDV-SEADML---EMVST--DEATGLRVLTSGPIPP-NPAELLGSDQMR
A0A352EX26      -PGLSSIL--SSDV-SREDTL---AMISK--DEVTGLHVLTSGPIPP-NPAELLGSEQMR
A0A2V8MM59      -TGLSSIL--SSAM-TEAEML---GSVHQ--DEASGLHVLSSGPIPP-NPAELLGSDQMR
A0A2V8PFE8      -EGLSSIL--SSEI-KPEDML---HAIHR--DEATGLNVLASGPIPP-NPAELLGSEQMR
A0A2V8PWS6      -EGLSSIL--SSET-KPEDML---HAIHR--DEATGLNVLASGPIPP-NPAELLGSEQMR
A0A2V8LCT5      -EGLSSIL--SSEM-KPDQML---GAIVK--DPTTGLNVLTSGPVPP-NPAELLGSEQMR
A0A352FTJ9      -DGLSSIL--TSEA-TPEDML---RSVAR--DESSGLFVMSSGPVPP-NPAELLGSDQMR
A0A2V8G155      EPGLSNVI--VGET----KLA---DAVRR--TPIPSLWLLAAGKTPP-NPAELLGSERFR
A0A2V8HDM7      EPGLSNVI--VGET----KLA---DAVRR--TPIPSLWLLAAGKTPP-NPAELLGSERFR
A0A2V8DRT9      EPGLSNIL--VGDT----KTG---DAVRP--TSCSTLWILPAGHLPP-NPAELLGSKRFE
A0A2V7VYF3      EPGLSNFI--VGNS----EVG---DVVRP--SGVPELWLLPSGLIPP-NPAELLGSMKFK
A0A1F2SVH2      GPGLSNVL--VGNA----KAS---EAVHK--TAVPGLWVMPAGPHPP-NPAELLGSKRFK
A0A2V8AJG9      EPGLSNVL--VGNA----KAS---EAIRG--TAVSGLWTMTAGMLPP-NPSELLGSKRFK
A0A2G6PYV5      -KGLVTSL--VKGK----SPI---DFIQS--TKIPHLFLLSSGPLPP-NPAELVASQKMR
A0A2V8F956      -PGLSNLL--AGQA----KAS---ESVRK--TAIPGLWVLTSGRIPP-NPAELLGSQRFK
A0A1F2S1W5      -PGLSNLM--VANA----TAS---EVIQE--SSTPGLWVLSAGTHPP-NPSELLGSKRFK
A0A1F2T595      DPGLSNLL--VGNA----TAS---ESIFE--SEIPGLWLMPAGTHPP-NPAELIGSRRFR
A0A2V8JQV5      RWGLIDIL--QGDIEIRDYPL---DMLAR-QTEVPNVHLLTSGTASR-SVVHLLHSTRLP
A0A2V9AC41      -AGLADVL--AGQI----GME---EAIRP--TQAENLFLISAGTIPP-NPAELLGSRKMH
A0A2V8K4L4      -KGLSELL--LSKHALKTSEV---VGAVR-ESWIPGLHILTSGPWAA-NASTLLYSARLP
A0A2V8NCZ3      -KGLSELL--REKHSTKTSEV---LEAAR-ETWIPGLHVLTSGPWAA-NASTLLYSARLP
A0A2V9MAM9      -WGFSNLL--RGAD----ELP---MDTIVKRTTVPNLYVLSSGPGTE-DIFSLLFSPRLR
A0A2V9M454      -NGLAEIL--TGAC----EFD---ETLLEKVEGLDRLSLLPAGPYPP-NPAELLCSTKME
A0A2V9IVR7      -RGLSNIL--RGEQ----SVD---EVLLQ-AHTLPNLWVLPAGPVPS-NPTDLLSSPDMA
A0A2V9ILE2      -RGLSNIL--RGEQ----SVD---EVLLQ-AHTLPNLWVLPAGPVPS-NPTDLLSSPDMA
A0A2V9LGY4      -RGLSNIL--RGEQ----SVD---EVLLQ-AHTLPNLWVLPAGPVPS-NPTDLLSSPDMA
A0A2V9J4D6      -KGLSGIL--TGAY----SVD---EALQE-VKGQPGLWALPSGPPPP-NPAELLSSPEMQ
A0A2V9L9C5      -KGLSGIL--TGAY----SVD---EALQE-VKGQPGLWALPSGPPPP-NPAELLSSPEMQ
A0A2N9M9N1      -NGLSSYL--AGGQ----GID---SALMS-FTALPNLSVLPSGPVPA-NPAELVSSPAMG
A0A2V9JEC4      -KGLSTVL--TGGH----QIE---VALET-FQNLSTLSILCAGPVPP-NPSELVSSATME
A0A2V9LPQ3      -KGLSGVL--TGRY----SLD---EALRE-VEN-TSLSVLPAGPTPP-NPAEMLSSPAMR
A0A348V070      -WGLTHFL--SSIV----DAS---EIIRP--TAYTNLFVVPSGVTPS-DPLEVMFSEKMR
A0A2Z5G3A3      -GGLSSIL--SGSS-SEKDSS---QYSAP-VTSLPNLKLLVAGAPPT-EPTDLLSSTRML
A0A2V7UGP8      -HGLSSYL--SGNA----ELD---PIIQE--TEIPNLFLVSSGPVPP-NPSELLASEHFD
A0A239MKT6      -RGLSDLL--SLNL----ELD---EVLQQ-HPNQDNLFIIEAGTIPP-MPAELLGSKRFL
A0A3E0PCN7      -TGLSTLI--TADYLSDERID---NAIRK--EVDYCLDVLPSGPRVP-NPANLLGSIEMR
A0A2V8IYW3      -CGVNEYV--HSHG------A---KPLEL-LPVAPRLFLLPAGRPDS-DPIGALTSETMQ
G2LEI9          QPGLSRYL--SGQC----KIG---EIFTP--SPIPYLTLITCGQMPP-NPAELLGSQRMR
A0A317J121      -WGLTNIL--EEGS----AAP---ERFGL-LTTVPGLFVMPNGPKSG-SISKMLYGSEIR
A0A2V7YW66      -HGLVNQL--TATG----EE-----AIFP--TEVPNLWITPSGPIPP-NPSELLSSDRMR
A0A2V7Z0V0      -FGLVNQL--TATA----ESE---TVFLP--TEVPNLWLTPSGPIPP-NPSELLSSDRMR
A0A2V8GFD4      -AGLSNVL--IGSA----KAN---DAVKK--TTVPKLWVLPAGRVPP-NPPELLGSPRFA
A0A2V8HSS5      -AGLSNVL--IGSA----KAN---DAVKK--TTVPKLWVLPAGRVPP-NPPELLGSPRFA
A0A2V8KP55      -NGLSSVL--EGHC----SLE---NAVSE--TNIKNLFLLPSGPVRP-NPGELILSPRFK
A0A399WNU1      -CGLSTLL--TAEEVDQDLVD---RAVTK--SSEPDLDILPSGPRVP-NPASLFASTHMK
A0A2V9CG11      -RGLSSIL--SVND--IVHIK---QLLCE--TAISGLYVLPAGSSTT-NTTRLLHSRRMS
A0A2V2R0I6      YAGLSSYL--AGAS----SLD---LVTVP-HPAIPNLAAIPTGPLPP-NPADLLSSHKLS
A0A2V8XAR9      YAGLSSYL--AGVS----SLD---LVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLA
A0A2V8VZA0      YAGLSSYL--AGVS----SLD---LVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLV
A0A1Q7CB82      YAGLSSYL--AGVS----SLD---LVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLV
A0A2V8WIU1      YAGLSSYL--AGVS----SLD---LVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLV
A0A1Q6Y9F5      YAGLSSYL--AGVS----SLD---LVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLA
A0A2V9EVV8      YAGLSSYL--AGVS----SLD---FVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLA
A0A2V8YF91      YAGLSSYL--AGAS----SLD---LVSVP-HPSIPNLVAIPTGPLPP-NPADLLSSHRLA
A0A2V8XZK2      YAGLSSYL--AGVS----SLD---LVSVP-HPAIPNLVAIPTGPLPP-NPADLLSSHRLA
A0A2V8ZTX6      YAGLSSYL--AGVS----SLD---LVSIP-HPAIPNLVAIPTGPLPP-NPADLLSSHRLA
A0A2V9BT79      YAGLSSYL--AGVS----SLD---LVSIP-HPAIPNLVAIPTGPLPP-NPADLLSSHKLA
A0A1Q8B793      YAGLSSYL--AGVS----SLD---LVTVP-HPAIENLAAIPTGPLPP-NPADLLSSHRIT
A0A2V9BCA0      YAGLSSYL--AGVS----SLD---LVTVP-HPAIENLAAIPTGPLPP-NPADLLSSHRIT
A0A2V9BWU9      YAGLSSYL--AGVS----SLE---LVTVP-HPAITNLAAIPTGPVPP-NPADLLSSRRLS
A0A2V9DKX2      YAGLSSYL--AGVS----SLE---LVTVP-HPAITNLAAIPTGPVPP-NPADLLSSRRLS
A0A2V9JSI3      -KGLSSIL--TGAH----GLE---EALQQ-LDALPGLWVLPGGPRPP-NPADLLSSVSMK
A0A2V9WI32      -SGLSTLL--TGGD----GSQ---NAILS--TEIPNLFVLTAGPPPP-QPAELLGSILMK
A0A2V8IVN9      -PGLSNLL--VGTA----KAS---ESVRR--SKTAGLWLLPAGKIPP-NPAELLGSQRFR
A0A1F2TPT3      -PGLSNVL--VSGA----KAG---EVVRR--SAVANLWVLPAGRCPP-NPSELLGSYQFR
A0A2V8JTQ2      -TGLGPLL--RNTV----TFE---EAVVS-WANVPNLFILPAGPVFL-PGDTELLMWSFQ
A0A2V8UZY0      -TGLGALL--RKSV----TFD---EAVIQ-RAEVPNLYILPAGPVML-PDDTELLVSGFK
A0A3N5YNR8      -QGISAYL--SGNG----DLS---SQIRQ--TNYPNLFLLPAGFRPP-NPAELIGSERME
A0A350UEK1      -AGLTDLL--KPGD---GDWK---KLIHE--SGAPGLWVLPAGPGVA-APSHLLYSKKLR
A0A350UIQ4      -AGLSDLL--KPDC---GEWK---KLIHQ--TPVPNLSVMTAGPGVA-AASNMLFSKRLL
A0A3N6A5T6      -QGMSYFL--TGNS----DLT---SQVRK--TSVPNLFVVSAGYVPP-NPAELIGSDRMD
A0A1F2Q9L4      -LGLVNFL--TGSA----DET---GIFLR--TSVPNLYLTPTGPVPP-NPSELLSSERMM
A0A1H5SQF5      -SGLSQCL--TSDI----DPA---SVIQV-HPDMDKVHVMTSGPVPP-APSELLGSPRFV
A0A2Z5G448      -EGLSTLL--VRES----GSS---AYQSP-IDDLPNLFVLTRGPIAP-NPGEILASRHME
A0A3E0NV31      -NGMSKFL--AGRA----EFA---DLLQQ--TKHKNLALVSAGPCPP-NPTELLGSKRMR
A0A3N5M5V0      -QGISSYL--SGNA----DLS---SQIRQ--TSYPNLFLLPSGFRPP-NPAELIGSERME
A0A2V9AEW6      -WGLNDVL--LSDTPFEEFPM---SHLAR-KTEVAGLSVLPSGNCGV-TPTNLFYSPRMS
A0A2V8WQK6      -WGLSDLL--WADNPLETVPI---SHLVR-ETEVSSLSLLPGGSCGI-TPSNLFYSPRMS
A0A2V8XIF4      -WGLSDVL--WGDTPLETLPI---SHLVR-ETEVAGLSLLPGGSCGI-TPTNLFYSPRMA
A0A3N5XQP8      -WGMSVYL--SGHS----DLE---QEIQP--TGVPNLSILPAGLRPP-NPAALLSSKRLP
A0A2Z5G7H4      -TGLSQYL--TDER----SPE---DILEV--GRLPKLHLLTSGPVPP-YPADLLGSLRMM
A0A2V9KCS3      -WGLSDLL--REKDAVDDYPF---EALSR-KTLIPGLYVLPSGPGTV-SISNLLYSPRLA
A0A2U3KC61      -GGLSTLI--SGSD----KVE---DVVIP-CPEVPNLWVLPAGPIPP-QPAELLGSAVMK
A0A2V9Y2R7      -GGVSTVI--SGVE----KFE---DVVVP-FTQVPKLWILPAGPIPP-QPAELLSSTVMK
A0A372IT17      -PGLSEAL--AGSA-----AP---PEPQP-LTALPSLALLHAGRKPP-FPSELIASRRME
A0A136JPP4      -QGLTNYL--SGEK----STE---NLIKA-APGLPHLKIITSGPIPP-NPAELLSSNEMR
A0A399WUJ8      -QGLTNYL--SGEK----STE---NLIKA-APGLPHLKIITSGPIPP-NPAELLSSNEMR
A0A2V9L5B5      -PGFVQCL--TGHV----ELA---EAVLP-APGVPNLSVIPCGPIPP-NPAEVLSSSLAA
A0A2V9L7I0      -PGLVQCL--TGKG----DLA---QAVLP-VPGVANLNVIPCGPIPP-NPAEVLSSPLAA
A0A2V9LK56      -PGFVQCL--AGRV----ELK---QAIFP-VPGTENLFVIPCGPIPP-NPAELLSSQLSM
A0A2V9YHT3      GGGLSTLL--AGQH----SAE---EVLVR-SNQLSNLYVLPAGPPPP-QPAELLSSALMK
A0A2V9NGH6      -TGLSSVL--TGSA----NVQ---QTIVR-SALLPSLFILPAGPPPP-NPAELLSSGNMK
A0A2V9PYE6      -TGLSSVL--TGSA----NVQ---QTIVR-SALLPSLFILPAGPPPP-NPAELLSSGNMK
A0A2V9NL07      -AGLSNVL--TGGT----TLQ---QATVR-STLLPNLFILPAGTPPP-NPAELLASSQML
A0A2V9QD92      -AGLSNVL--TGGT----TLQ---QATVR-STLLPNLFILPAGTPPP-NPAELLASSQML
A0A2V9WPZ6      -SGLSNIL--TGSA----TLQ---QAITR-SPLLPNLFVLPAGTPPP-NPAELLASSDMR
A0A2V9ZLH4      -SGLSNVL--TGSA----DVQ---QTITR-SQVVPSLFVLPAGTPPP-NPAELLASANMR
A0A2V9RQF1      -IGLSNVL--TGNA----PLQ---QAIVR-SNVLPSLFVLPAGPPPP-NPAELVASSNMR
A0A2V9YDK8      -SGLSNVL--TGSA----TLQ---QTITR-SPLVPSLFVLPSGTPPP-NPAELLASSNMK
A0A2V9V8F7      -SGLSNIL--TGSA----TLQ---QAITR-SPLLPNLFVLPAGTPPP-NPAELLASSDMR
A0A2V9XGR9      -SGLSNIL--TGSA----TLQ---QAITR-SPLLPNLFVLPAGTPPP-NPAELLASSDMR
A0A2V9V3Q5      -SGLSNVL--TGNA----TLE---QAISP-SPILPNLFILTAGSPPP-NPAELLASSNMK
A0A2V9NWS3      -IGLSNVL--TGNA----TMS---QATVR-STILPTLFVLPAGPPPP-NPAELLASAQMK
A0A2V9USA9      -SGLSNVL--TGST----TLQ---QAITR-TPILPNLHVLPAGTPPP-NPAELLASTNMK
A0A2V9XW18      -SGLSNVL--TGST----TLE---QAISD-TTILPNLFVLPAGTPPP-NPAELLASSNMR
A0A3M2BZG9      -LGVVNHL--TGTE----RAE---DLVLP--TAVPNLYLCPSGPIPP-NPSELLASERMR
A0A1Q7N5R7      -PGLTDFL--AGRV----PLE---AVKQA--LPYPLLHFIGAGSRLR-ESPELLGSPAMV
A0A3M1SIV3      -VGLTNYL--SGDQ----ELQ---DLLKS-PEGLPKLKIITSGPLPP-NPAELLGSTEMK
A0A3E0PHB0      -HGLTNYL--SGER----NTD---NLLKP-YPKLPNLKVITSGPIPP-NPAELLSSNEMK
A0A3M2D491      -TGLTNYL--SGDQ----SLE---GLLKP-IPELPNLKVITSGPIPP-NPAELLGSDEMK
A0A357F267      -HGLTNYL--SGER----NTD---NLIKS-CRDLPRLKVITSGPIPP-NPAELLSSNEMR
A0A353C9L6      -QGLTNYL--SGER----NTQ---NLIKT-CRDLPRLKVITSGPIPP-NPAELLSSNEMR
A0A2V8RQV0      -QGLTNYL--SGER----NTE---NLIKS-SRELPRLKVITSGPIPP-NPTELLSSNEMK
A0A2V8SJH5      -QGLTNYL--SGER----NTE---HLIKT-CRELPRLKVITSGPIPP-NPAELLSSNEMK
A0A2V9QB26      -RGLSSLL--RDPQRALAKLS---RIVQE--TNIPGLFVLTSGPLTE-SAADLLHSANLS
A0A2V9VYY4      -GGLSTLI--SGSS----NVE---EVILP-SSEVPNLWILPAGPIPP-QPTELLGSTVMK
A0A2V9KIE8      -PGFVQCL--TGRV----QIS---EAILP-VPGVANLWVIPCGPIPP-NPAEVLSSPVAG
A0A352F549      -DGLSAIL--SSEV-SEADVL---SKIRK--YQDSNVYLLSSGAIPP-NPAELLGSTQMK
A0A3B9MLP9      -EGLSAIL--SSET-SEAEIL---AKINR--YLETDIYLLSSGAIPP-NPAELLGSAQMK
A0A3D5SQ87      -EGLSAIL--SSET-SEAEIL---AKINR--YLETDIYLLSSGAIPP-NPAELLGSAQMK
A0A2V8NW86      -HGLSSLL--RDPQRAVAKLS---RIVQE--TKIPGLFVLTSGPLTK-NAADLLHSADLS
A0A2V8ZHL8      -EGLAGFL--TGAH----SIE---AALIQ-FSPVPALRVLPAGPKPP-NPAQLLSSSAME
A0A2V9B240      -EGLAGYL--TGAH----SIE---AALRQ-FSPVPTLWVLPAGPKPP-NPAQLLSSSAME
A0A2V9CBM2      -SGLVSYL--TDPQ----DWR---TLVRH--SGSSGLDLLFCGPVPP-NPSELLSSQSME
A0A2V8XN17      -LGLVSYL--TGQQ----DWR---AVVHP--SGSRGLDLLLCGPVPP-NPSELLSSQSMG
A0A2V8WX45      -LGLVSYL--TGQQ----DWH---AAVRP--CGSHGLDVLVCGPVPP-NPSELLSSQSMG
A0A1Q6YR79      -LGLVSYL--TGQQ----DWR---AAVHP--SGSRGLDLLVSGPVPP-NPSELLSSQSMG
A0A1Q7VA32      -LGLVSYL--TGQQ----DWR---AAVHP--SGSRGLDLLVSGPVPP-NPSELLSSQSMG
A0A2V9EY85      -LGLVSYL--TGQQ----DWR---AAVHP--SGSRGLDLLVSGPVPP-NPSELLSSQSMG
A0A2V9H8K0      -LGLVSYL--TGQE----DWR---AVVRP--SGSRGLDLLVCGPVPP-NPSELLSSQSMG
A0A2V9FFE5      -LGLVSYL--TGQQ----DWR---AVVRP--SGSRGLDLLVCGPVPP-NPSEMLSSQSMS
A0A2V9GM43      -LGLVSYL--TGQQ----DWR---AVVRP--SGSRGLDLLVCGPVPP-NPSEMLSSQSMS
A0A1F2RFI7      PAGLSTYL--TGQF----GLD---DVVTP--TQIPNLFAIPCGPIPP-NPAELLSSELMR
A0A1F2RZS3      PAGLSTYL--TGQF----PLE---DVLVG--THVPNLYAVSCGPVPP-NPAELLSSKLMR
A0A1F2USE2      -GGLSSYL--TGQA----EWR---RYALS--TGVPHLDLMACGPIPP-NPAELLSSERMR
A0A2V9C238      -LGLVSYL--TGQQ----DWR---AAVRP--TGLESLDALVCGPVPP-NPAELLSSERMR
A0A1F2Q9F5      -RGLVSYL--TGQQ----EWE---AVVHP--SPVENLDLVICGPIPP-NPAELLSSERLR
A0A1F2QQH9      -RGLVSYL--TGQQ----EWE---AVVHP--SPVENLDLVICGPIPP-NPAELLSSERLR
A0A1F2QXK7      -RGLVSYL--TGQQ----EWE---AVVHP--SPVENLDLVICGPIPP-NPAELLSSERLR
A0A2V9DEM9      -LGLVSYL--TGQQ----DWR---AAVRP--TGLESLDALVCGPVPP-NPAELLSSERMR
A0A2V9CYQ5      -SGLVSYL--ADHQ----DWR---TLVRH--SGLSGLDLLFCGPVPP-NPSELLSSQSME
A0A2V9BWU8      -LGLVSYL--TGQQ----DWR---TAVCP--SASPGLDLLLCGPVPP-NPAELLSSKSMG
A0A2V8ZG48      -LGLVSYL--TGQE----DWR---TAVCP--SGSPGLDLLPCGPVPP-NPAELLSSKSMG
A0A2V8Y334      -LGLVSYL--TGQQ----DWR---AAVCP--SGSPGLDVLLCGPVPP-NPAELLSSKSMG
A0A2V9AY68      -PGLVSCL--TGQQ----DWH---AAVCP--SGSPGLDLLLCGPVPP-NPAELLSSKSMG
A0A257VBK0      VRGLTNYL--AERT----AQI---EDFVV-PGPQPNLFVLYSGPTPP-NPPELFSMKRFR
A0A2V7XDY0      EPGVTNFF--VNHE----DLD---ALVRP-TR-VPNLFALTTGPLPP-NPPAILTRPNMQ
A0A350UQT3      GAGLSNVL--NGET----GWR---DVLVR-PANNEYLEIITAGPPSR-RAADMIG-QLLG
A0A2U3JZ71      TRGLSNVL--TSGI----PWR---TVLVR-PDGHPNLDILPAGPPSR-RAADLVGAE-LT
A0A2V8TTB0      SVGLSNVL--LQQI----SWR---DVVIR-MDDPKGLDVLPAGPPTR-RASDLIGSG-VA
A0A1F2TCR2      SVGLSHLL--VGQV----RVR---EAVQR-TS-EANLFVMTAGRTPP-NPSELLASERMK
A0A2N9LQU7      SAGLSSMI--SGND----ASE---AVRKP-FPQLPTLEVIAAGPQTP-WPAELLASKKMG
A0A2P6WFK7      RYGTSTVL--TRGM----DER---AIVTP-LKSLPSLKLMPAGPHPP-NPAELLGSKRMI
A0A1F2V330      GKGFSDLL----RA----PED---EIGKY-VSKLGDLYIMPGGSSLA-NPVSLLASQSVR
A0A2V8U914      SWGLSDIL-RERNA----TEDLPLDALVK-KTGVPRLYLLPSGPCTD-SIFSLLYSERMA
A0A2V7W309      NLGIVNYL--AANI----PFE---DTVQP-TQ-VPNLSVVLSGPIPP-NPSELLASDRMK
A0A2V8TLH7      DQGITNYILSTEGD----DWR---TYLKT-TD-QSNLYALTSGPIPP-NPADVFGHERFK
A0A1Q7ZJT1      DGGVTNYILSSEGD----DWR---SYIKN-TD-MPNLYAMTCGPIPP-NPADVFGHERFL
A0A2V8VC99      DHGVTNYILSSDGD----DWR---NYIKA-SD-LPNLYALTCGPIPP-NPADVFGHERFL
A0A348UZU3      HDGLSNYL--TMGL----ELK---KLVKT-TM-VPSLYFINSGPIPP-NPAELLGSERMK
Q01XL7          CPGLSDLLTSTESL----EEADLAPYLSP-TK-VDNLRVMTHGLAQVGTPATLFFSPRVK
A0A2V8ERZ5      DRGLSQVL--TGQA----RVR---DVIQR-TV-DPNLLAITAGRSPL-NPSELLSSERMK
A0A2V8GTX0      DRGLAELL--SGKA----RMR---EVVQR-CG-DPNLLVIPAGHTPS-NPSELLASDRMR
A0A2V8J0X9      ETGLSHLL--VGQA----RVR---EAVQR-TS-EPNLVVITAGRTPP-NPSELLSSERMS
A0A372IRG7      RTGLSTYL--SRES----KEE---SFEYP-IPGLPNLAVMTRGPIAP-NPGEMLASRMME
A0A1F2U158      DRGLSQIL--TGQA----RVR---DVIQR-TV-DPNLLAITAGRTPA-NPSELLSSERMK
A0A2V8F6S9      ERGLSQVL--IGQA----RVR---DVIQR-TV-DPNLLAITAGKTPP-NPSELLSSERMK
A0A1I6MH75      KVGLSTLL--TGTT----GLE---ESLQR-VPEVPNLDIMASGPVPP-FPTEMLSSAAMT
E8WVF6          KLGLSTIL--SGQT----TLE---NSVQT-LKEVPTLDILASGPVPP-FPTEMLSSASMA
A0A1H5Z7N3      KIGLSSVL--TGSA----TLE---QALQR-VPELPNLDVLVSGPVPP-FPTEMLSSQVMR
A0A1G7JVV8      RVGLSTVL--SGGA----TLE---EAVKN-VPEVPNLDVLCSGPVPP-FPTEMLSSESMK
A0A1H4T6W9      RVGLSTVL--SGGS----TLE---DAVKN-VPEVPNLDVLCSGPVPP-FPTEMLSSEAMH
I3ZEU5          RVGLSTVL--SGGS----TLE---EATKN-VAEIPNLDVLCSGPVPP-FPTEMLSSEAMH
A0A428MDU2      KVGLTTLL--TGAS----KLK---DTVQN-IPNVPNLDILPSGPVPP-FPSEMLSSEAMD
A0A239HDF6      RLGLSTYL--SGSS----TLE---ESLQH-LDELPSLDILTSGPVPP-FPTELVSSTAMR
A0A1Q3QQB6      KTGVTTVL--TGAA----PLE---EAVQT-VPEVPNLDILPAGPMPP-FPTEMLGSEAMD
A0A3N1K1G7      KVGLTTVL--TGAT----TLE---DTVQH-IPDAPNLDILPSGPVPP-FPTEMLSSEAMN
A0A2W0BGU4      ERGMSTHL--TGHD----SIN---DVIQP-YKEQPNLWLIPSGPIPP-NPAELLCSEAME
A0A2W0BVQ9      ERGMSTHL--TGHD----SID---DVIQQ-YGEQPNLWLIPSGPIPP-NPAELLCSEAME
A0A3D1ASD2      NAGLSSVV--LQSA----NWR---EVVVP-AENVAGLDVLPAGPPSR-RAADMVG-NRLP
A0A2N9MK30      ETGLSAVL--LHGL----AWR---DCVMQ-APGVPNLDVLPAGPTSR-RASDLIG-RALP
A0A2V9MN96      SGGLSTLL--SGVD----TME---NVMVP-FPGLPFLQVLPAGPIPP-NPVELLGSSVMK
E8UZE1          EKGLSNLLAVSQSP----PLV---EYLHP-AAVFPGLDFLPAGPLPP-SSSELLMSPRMS
A0A2V7V2Z1      SPGVSDLL--VGQA----RPS---EAIQR-PA-GTTLSLLASGTRAP-SPADLMTLQTMR
A0A2V7X2F7      TPGLSDVL--VGKA----KPS---EAIQV-FA-GGH-SLLPAGTTVP-SPADLVTGQAMR
A0A2V7V2I1      SPGLSDIL--VGLA----DTA---ECVER-VK-GTNLSLLPSGSHAP-SPAELMSPQLLR
A0A2V7U3M2      SPGLSDLL--VGRA----RPS---EAIQR-PA-GTTLSLLAAGTRAP-SPADLMTLQTMR
A0A2V7UHT0      SPGLSDLL--VGKA----RPS---EAIQR-PS-GTTLSLLAAGTRAP-SPADLMTLQTMR
A0A2Z5FVL3      EVGLSTIL--AGQL----SVDAMGQAFLQ-VEAVPGLDILLSGPIPA-YSAELLGSSKMR
A0A1V6HR88      RAGLVSYL--TGQV----PPE---QIVLR-TD-IPNLYAIPAGPSPP-NPSELLSSERMR
A0A3E0P0A3      RVGLVNCL--VHQT----ELE---NVVQA-TP-VPNLWVLPSGPLPP-NPSELLSSGHAR
A0A2V9KBD6      TAGLGALL--KKSV----AFE---EAVCS-FPNLPDLFILPAGPVTQ-PEDTELLLSTFK
A0A2W0AJ66      TIGLTALL--SNSA----PFE---DAVIR-CAELPNLFILTAGKVSL-PEDTELLVARFK
A0A1Q7RBU1      NAGLGALL--RKST----AFE---EAVMG-CTDVPNLFILPAGPVNL-PDDTELLVSGFK
A0A2V9JPV9      NTGLGALL--RKST----VFE---KAVSD-CAKIPNLFILPAGPITL-PDDTELLVSGFK
A0A2V8EXP2      EPGLSNVL--VGNA----KPS---DAVRI-TS-VPGLWAMPAGMIPP-NPAELLGSKRFK
A0A2W4RYA1      EPGLSNLL--VGTA----ESR---ECVHE-TP-VEGLYVLPAGHIPP-NPAELLGSARFR
G8P0Y7          HVGLSNVL--TGGA----KVR---DAIQS-TV-QPNLFVLPAGLVPP-HPSELLSSSLMR
A0A3D4VGU2      RVGLSTYL--SRES----GEE---SIVFP-LPELPNLGVLPRGPVAP-NPGEMLASRMMA
C1F294          RVGLSTYL--SRES----GEE---SIVFP-LPELPNLGVLPRGPVAP-NPGEMLASRMMA
A0A3P0X3W6      EEGLADVI--MDGR----SLA---DVLHT-IEGIENLHVVTAGASAM-RAAHLVG-NKMA
A0A1E3Y9R6      EPGLSNVL--VGEA----SLA---DAART-TA-VPNLTLLAAGHIPP-NPAELLSSPRYA
A0A2W4TLP2      EPGLSNVL--VGEA----ALA---DALRP-TS-VPNLTLLAAGHIPP-NPVELLCSPKYA
A0A3R9WF43      SPGLGDVSAADTHI----EVS---NLIQH-SS-IKTLYILPAGNRPD-LPSEFFSSATFD
A0A317HKM4      QPGLADVL--AGKT----TSR---DFRQT-K--ISRLWLLPAGTASR-HPADLLGSERFS
A0A2W0C122      TPGLSDLL--SGGA----GEE---CVIHK-IEGVANLSIVAAGSSPA-MTAEMLGSDRMR
A0A2W0AUU7      TPGLSDLL--SGSA----GEE---PVIQQ-IERVSGLSIVSAGSSQA-RTAETLGSARMR
A0A2W0BQL1      TPGLSDLL--SGSA----GEE---PVIQQ-IERVSGLSIVSAGSSQA-RTAETLGSARMR
A0A3P0XH15      RFGLSTLL--VREN----EES---SYENP-LPDLPNLTLVTRGPVTV-NPGEALASRSME
A0A3M1WQW8      QPGLSTYL--TRGI----TID---SVIVP-NR-IDNLWIIPSGPVPP-NPSELLSSRKMR
A0A3N1JHC1      IEGLSNTLDEAECA----DPN---SLIQT-TA-FPGVSILTSGTTKG-NIVRLLHSSRLA
A0A2V9KA79      GTCFDDLL--VQPR----LAI---EDCLT-TV-RTLHVMLGRRSLAN-NPVQALAAKRMH
G8P085          KRGLSNLI--LGDD----TAE---PFTNP-LPDLDNLFLLTAGKKVA-LPSEALGSNKFY
Q1ILD9          GDGLTECL--SGLR----RWT---DVVQD-ASGIAGLRILSAGVRPP-NPAELLSSDKLK
Q1IJZ6          DRGLSNLL--TSVA----EPS---DFIQK-DSSAPNLDILCAGPIPP-NPAELLASNVFS
A0A2V8TCE6      GSGLSTFL--CGKA----SLE---EAVQM-TL-VARLWLLASGPVPP-NPAELLDSACFD
Q1ITG0          EGGLSECL--AGRK----SWR---DLIIP-VNGVANMWVLPAGHRPP-SPADLFTSNKME
A0A3N5PCI5      RPGLAEVL--TGKR----KPS---EAIVA-TR-SPGVWLLPSGAGIA-SPSEQLGSRRFS
A0A3M1Q0S9      GRGVSTYL--TGMS----DLP---ALVQT-SD-LERVAVIPAGPIPP-NPAELLDSERFR
A0A3M1VZ38      DRGVSTFL--TGLN----DLD---PLIQQ-TR-IDRLSLIAAGPVPP-NPADLLDSPRFA
A0A3M1PY35      DRGLANVL--AGAT----GLD---DVLFE-TR-YDNLALVPGGPCPP-DPATLLDPERVR
A0A3M1VMP2      ERGLTNLL--ASHD----PAD---GFVVP-TR-YANLHLLPGGPCPP-DPATLLDPDRFR
                                                                     .      

A0A2V7YYV7      ELMARLRT--SFSYVIVDTPPVNAVTDASILSASANGTILVVEHGQTSFPALERAKQM--
A0A2V7Z0J5      ELIGHLLA--NFNYVIIDTPPVNAVTDAAILAAYANGTILVVEQGRTTFPAVGRAKQL--
A0A2V7Z3M4      DLMSRLSD--AFVYVIIDTPPVNVVTDAAILSAQASGTVLVVEQGRTTFPVVNRAKQI--
A0A3M2D9H8      TLLSEVAT--RYDKVILDGPPFL-ISDAIVLASRVDGVLLTLRARSTSQSVTLEVLEQ--
A0A399Y5V2      ELIETLGT--LADYVVIDSPPIVPLSDAAVLAPKTDGAIIVAKAGQSSRRASAQAAEK--
Q01X01          RLLPRFRQ--EFDYVIVDAPPCLEFADARIISRYTERLLLVVRADYTDRKTAQAAVQR--
A0A2V7VMF7      DLFSHLRR--QFEWILVDSPPLASVTDALLLARHADLAVMVVQHNNVDKKLVKRSVVA--
A0A2V8JK38      EVLKSLKK--DFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQH--
A0A2V9IXG5      DFISYLSD--RYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSLSA--
A0A2V9J2P4      DFISYLSD--RYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSLSA--
A0A192WQ77      WLVNELQK--EYDWVLIDSPPAAALSDAPLLATLAHMVVMVVRHNHTDRDVAIRAMTQ--
A0A1Q7RLS4      SLLKELRA--EFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIRRCVTN--
A0A2V2R525      RLLEITSP--SFTHVVIDSTPVVSFTDSVLIANLVDGVILVVQGGKSPKEIVQLSRKE--
A0A321LPW6      DLLSAMSE--RFDHVLIDSPPLINVTDPIILSTIVDGVILVVHGGRSTRDVARRARQE--
A0A2V9R9V4      RLLAQLSE--RYDHIVLDSPPLASVTDAVILSTMVNGVILVVHGGRNSRQAVQRACHE--
A0A321LE75      NMLAMLCE--RYDHIVIDSPPLMHVTDPVILSTLVDGVILVVHGGKSTREVLKRGRQE--
A0A2V8R8U7      KLLVSLSE--KFTHIIVDSPPAISFTDSSILSTFVDGVILVVHGGRSSRAVVRRAKQQ--
A0A2V8QMP4      RLLYVLSE--NFTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--
A0A2V8R4S3      RLLYVLSE--NFTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--
A0A2V8NJ55      KLLNSVSE--RFTHVIIDSPPSISFTDASILSTMVDGVMLVVHGGKSSRAVVRRAKQQ--
A0A2V8Q7I0      RLLGQLGE--RYAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--
A0A2V8S6K4      RLLQLLGE--QFTHIIIDSPPAISFTDASILSTMVDGVVLVVHGGRSSRAVVRRAKQQ--
A0A317I2L9      RLLGTLSE--RFAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--
A0A2V8LLF9      KLLILLSE--RFTHIIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVRRAKQK--
A0A352FRF4      NLLLSLRE--KFTHVIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVRRAKQQ--
A0A2V8MKV0      RLLTLLGE--KFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVRRAKQQ--
A0A2V8PYY8      QLLTSLGE--RFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVRRAKQQ--
A0A1Q7YKQ8      KLLSELSE--RFTHVIIDSPPAISFTDASILSTLVDGVILVVHGGKSSRAVIRRAKQQ--
A0A352F3R7      KLLGILSE--RFSHIVLDSPPAISFTDASILSTMVDGVVLVVHGGKSSRAVVRRAKQQ--
A0A0B6WXT1      RLIDEASA--RFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGGHSSRAIVRRAKKL--
A0A3B9MEU8      KLLGILSE--RFTHIVIDSPPAISFTDASILSTMVDGVVLVVHGGRSSRAVVRRAKQQ--
A0A2V8MHG6      SLMSVLEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--
A0A2V8P7N1      SLMSVLEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--
A0A2V8M3M6      SLMSVLEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--
A0A1Q7NJH5      TLMSVLGN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--
A0A2V8PJY0      TLMSVLEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSRQL--
A0A1Q7Y6W9      KLLSCIEK--TFTHVIIDSPPIASFTDGVLISTIVDGVLLVVHGGKSSRHVVRRARQV--
A0A2V8NC68      RLIAALEN--TFTHVIIDSPPVASFTDGVLLSSIADGVLLVVHGGRASRAVVRRARQL--
A0A399WK13      KLLKMLQG--HFTHVVVDSPPIASFTDGVLIASMVDGVVLVVNSGKSSRQVVRRSRQL--
A0A352FLX4      KLLSVVAD--NFAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHSGKSSRKIVGRARKL--
A0A2V8RTL7      GLLKTLQS--EFTHVVIDSPPITSFTDGVLLASLVDGVILVVHSGKSSRQVVRRARQL--
A0A3E0PCJ6      RLLVTLEK--NFTHLVIDSPPIASFTDGVLMASLVDGVIMVVHSGKSSRSVVRRSTQF--
A0A3M1S4R8      TLMEIFQK--EFTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSRQIVRRSCQL--
A0A1Q7YFI6      RLLATMRT--SFTHIVIDSPPIASFTDGVLMSTMVDGVLLVVQGGKSSRIVVQRAKQY--
A0A136KC10      KLLKTLEG--HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQL--
A0A2V8SEX6      NLLKLLSQ--NFTHVVVDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVRRARQL--
A0A3M2D6Y5      NLMEILHN--EFTHVVIDSPPIASFTDGVLIASMVDGVIMVVHSGKSSRHVVRRSKQL--
A0A0B6WWQ6      ALLEELRA--RFDYIIVDSPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKI--
A0A3B9MK99      RLMATLQS--QFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVRRSRQL--
A0A352EX26      RLMTLLQA--EFTHVVVDSPPINSFTDGVLISSLVDGVLLVVHGGKSSRHVVKRARQL--
A0A2V8MM59      KLIAVLSA--QFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVYGGKSSRGVVRRSRQL--
A0A2V8PFE8      KLIAVLSG--AFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQL--
A0A2V8PWS6      KLIAVLSG--SFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQL--
A0A2V8LCT5      KLIAVLSI--PFTHIVIDSPPVSSFTDGVLIASIVDGVLLVVHGGKSSRGVVRRSRQM--
A0A352FTJ9      KLLATLSE--KFTHVVIDSPPVNSFTDGVLLGSMVDGVLLVVHGGKSSRDVVRRSRQL--
A0A2V8G155      DLLLSLQT--RFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQ--
A0A2V8HDM7      DLLLSLQT--RFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQ--
A0A2V8DRT9      DFIETLKD--HFAFVIIDSPPIMAVSDSAIVAHMADGVLFVIGSEMTSRGVARTAVEQ--
A0A2V7VYF3      EFLATLKE--RFDWVIIDSPPVMAVTDACILAH---------GAEMTNRKAARRALKQ--
A0A1F2SVH2      DFMASLVE--HFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSRHAAQRALEQ--
A0A2V8AJG9      DFISTLGQ--HFDWVIIDTPPVMAVTDSCIAAHRTHGTIFVVGAEMTSRFATRRAVEQ--
A0A2G6PYV5      EVLTELKA--NFDFIIIDTAPLLAVTDASILGNIVDSLIFVTKASATSRDEVARALHM--
A0A2V8F956      DFLVSVKE--HFDWVIVDTPPVMAVTDARLVAHHATGVLFVVGAEMTSWHAAKRALDH--
A0A1F2S1W5      EFAAFLMQ--YFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTSRRVAQRAVEQ--
A0A1F2T595      DFTAFLLQ--HFDWIIVDTPPVMVVTDATIAANFAHGVLFVVGAEMVSRRVAQRAVEQ--
A0A2V8JQV5      ELLQRLRK--DYDLILIDAPPVLQMADARVLGRLADGVVFVIRSGRTTRDMALSACRR--
A0A2V9AC41      ELLQQLRE--QFEFIFIDSSPVMAVSDAVFLSTMVEGTLMVVNR-RTPKPLVRKTRTR--
A0A2V8K4L4      EIIEITRQ--SFDTVIIDSPPMLHIADARLLAKHSDSVLLVLRAGKTTRTAGSMAIQK--
A0A2V8NCZ3      EIIEIARQ--NFDTVIIDSPPMLHIADARLLAKHCDSVLLAVRAGKTTRTAAVMAIQK--
A0A2V9MAM9      RLIERFRE--EFDHVIIDAPPSLEFADARLLGLTADGVLMVVRANHTDNKTVQLAIQR--
A0A2V9M454      NLIKHLRD--QYDHLVLDSPPVLPITDATILSSLVDGVIMVVECEATTRAALSRACRV--
A0A2V9IVR7      RLVEELKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRI--
A0A2V9ILE2      RLVEELKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRI--
A0A2V9LGY4      RLVEELKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRI--
A0A2V9J4D6      SVMQNLRQ--RFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQI--
A0A2V9L9C5      SVMQNLRQ--RFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQI--
A0A2N9M9N1      RLVSELRQ--RFEHIVLDSPPLLLVTDGVLLSTLADGVVLVVESGSTSRGALHRVRQI--
A0A2V9JEC4      QVIGELRR--RFDHIVIDSPPALVFTDATILSALVDAVVLVVESDVTTRAALRRARQT--
A0A2V9LPQ3      QLITELVE--RFKHVVIDSPPLLMVTDATILSTMVDGTVLVAESGVTSPGALARCHRI--
A0A348V070      AFITFLKQ--QFDFVLFDSPPVLAVSDALVLGKQVDGLILVVRAGQTPVNALKQARNK--
A0A2Z5G3A3      EALAAWRR--EYSFVIIDAAPVLSATDSVILSGLVDTTLLLGRYKYTDRQLLARSYRL--
A0A2V7UGP8      FLLAALKSSARFDHVLIDSPPLLSVADPVIMASKAGATILVVQCGRTSRPAVIRGRQK--
A0A239MKT6      AILEKARK--EFDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRSGRSTKQVVRATASM--
A0A3E0PCN7      SLLDRLGA--RYSHIIIDSPPILYFADSVILAANVEAVVIVSRANFSSYEVHSQAKKK--
A0A2V8IYW3      RIVKEGRE--QFDWVLIDTPPIGLLPDAGLLGGIADGALLVVRAGHSPFDLIKRAVDT--
G2LEI9          SLLAYAVE--KFDYVILDTPPMLSFADATILAAMADSVILVVNCQRSKREIVKRTCRK--
A0A317J121      RFFQMVRE--KYDIVLIDAPPILEVADGRLLAEFADGVLLVLRSGVTDRVAALQAYQQ--
A0A2V7YW66      DWLRTMRS--RFDFVVLDTPPALAVTDATIVGLLVDGVVLTLRSGKVTREEARLCRDR--
A0A2V7Z0V0      DWLKAVRA--RFDFVVLDTPPALAVTDATIVGMLADGVVLTLRSGKVTREEARLCRDR--
A0A2V8GFD4      ELMAAFRE--NFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAAKTALEQ--
A0A2V8HSS5      ELMAAFRE--NFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAAKTALEQ--
A0A2V8KP55      EVLKSLKK--DFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQH--
A0A399WNU1      GLIERLSA--TYSYIVIDSPPILYFADSVILSTQVDAVVAVARVNFSSRDVLTRARQK--
A0A2V9CG11      ELLALLRR--EFDMVIVDAPPVTQLADARVLGHLADGVILVVRAGQTTLESALFATEC--
A0A2V2R0I6      DAIAELRT--KYKFVVIDSPPVMAATDAVIVSVQTDGVLLVVRSGETPKEAFTRTRDL--
A0A2V8XAR9      DAIAELRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--
A0A2V8VZA0      DAIAELRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--
A0A1Q7CB82      DAIAELRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--
A0A2V8WIU1      DAIAELRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--
A0A1Q6Y9F5      DAIAELRA--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--
A0A2V9EVV8      DAIAELRA--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--
A0A2V8YF91      EGIAELRT--KFKFVVMDSPPIMAATDAVIVSVHSDGVLLVVRSGETPKAAFARTRDL--
A0A2V8XZK2      DAIAELRT--KFKFIVIDSPPIMAATDAVILSVLADGVLLIVRSGETPKAAFTRTRDL--
A0A2V8ZTX6      DAIVELRS--KFKFIVLDSPPIMVATDAVILSVQADGVLLVVRSGETPKVAFTRTRDL--
A0A2V9BT79      DAIVELRT--KFKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGETPKVAFTRTRDL--
A0A1Q8B793      DAIAELRA--KYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDL--
A0A2V9BCA0      DAIAELRA--KYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDL--
A0A2V9BWU9      EAVSILRQ--EYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFMRARDQ--
A0A2V9DKX2      EAVSILRQ--EYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFIRARDQ--
A0A2V9JSI3      EVLAELRG--RFDHVVIDSPPVLLVTDATILTPLVDGIMLVVESGMTVRGAIQRTHKI--
A0A2V9WI32      DYLCRLRK--EFDHIVIDTPPALSVTDAVLLSVEADSVLVVVRSGQTTKAALRRVRDL--
A0A2V8IVN9      ELLASLKD--HFDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGAEMTSRHTAKAAIRQ--
A0A1F2TPT3      KFLAALGQ--HFDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGADMVSRRTARRAVEQ--
A0A2V8JTQ2      DWVKRWRE--QFDHIIIDTPPVLSVADAVRISVEADSVILVIRSGQTARDAFLRAQDL--
A0A2V8UZY0      DLVDHWRD--QFDHIIIDTPPVLAMTDAVRMSVEADSVILVIRSGQIARDTFLRAQDL--
A0A3N5YNR8      SALRLLGD--YFKYILIDTPPILSVTDGLLLSPHVDGVVMVIKGGSTPKEAARKAGNH--
A0A350UEK1      AALEWFRE--EFDMVVIDTPPMLQIPDARLFGKLVDGVVLVVRANSTTRDAALAARMR--
A0A350UIQ4      SALEWCRS--EFDMVVIDTPPVLQIPDARLFAKVADGVVLVVRANSTTRDAAMACRMR--
A0A3N6A5T6      KALKLLRD--YFQYVVIDSPPILSVTDALVLSPKVDGVVMVVRGGETPREAVRRASEH--
A0A1F2Q9L4      DLVAVAYQ--RFENVVFDSPPILPVTDATLLGAMSDGVVLCVGSGMVLREDARTCRQR--
A0A1H5SQF5      KLLEQMKK--EYDYVFIDSPPVLLVTDAVLTSTLVDGVILVVRSGVTRRTPLRRALEQ--
A0A2Z5G448      SLMEGWKT--EYDHVILDSAPVLPVADSLSLAPGADSTIIVVRAAITRKKALLRVRSL--
A0A3E0NV31      WCLGVASE--HFDVVLIDSPPSLELSDALTVSPYVDGVVIVARAGQTPREAVRRTSLR--
A0A3N5M5V0      AGLRLLGD--YFKYILIDTPPLLSVTDGLLLSPHVDGVVLVIKGGSTPKETVKKASNH--
A0A2V9AEW6      KLLARLRR--EFDMVLIDAPPMIQLADARVLGRLADGVILVVRAGQTTTESARFAIQR--
A0A2V8WQK6      RLLRRLRS--EFDMVMIDAPPVIHLADARVLGRLADGVILVVRAGQTTTESALFASQR--
A0A2V8XIF4      RFLKRMRK--EFEMVMIDAPPMIHLADARVLGRHADGVILVMRAGQTTTESALYASQR--
A0A3N5XQP8      NALERLTK--QFRFIVIDTGPLLCYTDALIISTVVDGVVLVGRADQTPIRNLKLASEQ--
A0A2Z5G7H4      EALDRWRG--YYDFIVLDSPPVLLVTDPVVLASLADATLLVARYGMTNRLSLARSHRTL-
A0A2V9KCS3      ELLNRFRK--EFDTVLFDTPPMLQISDARVVGRLADGVILVLKAGQTTRDMALAATQR--
A0A2U3KC61      DHIAHWRN--VFDHVIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTKAALRRACDL--
A0A2V9Y2R7      DYIARWRN--EFDHIIIDTPPCLSVTDAVVLSPEADRVILVARSGQTTKPALRRACDL--
A0A372IT17      ELLGGWRH--QYDFIVLDSPPVLPFADALVLSQMSDATLLVARPGVTAKPAIARSYRALS
A0A136JPP4      NLLQFLRG--RFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQTRTR--
A0A399WUJ8      NLLQFLRG--RFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQFRTR--
A0A2V9L5B5      ESLRKLRA--DFDYVLVDSPPLLSVADGRILATMVDGAVLVARAFETPYDLVRRARAL--
A0A2V9L7I0      ELLRKLRT--EFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFETPYDLVQRARSL--
A0A2V9LK56      DLLNALRS--QFDYVLLDSPPLLSVSDGRILATLTDAVVLTIRAGHTPIEAVRQACAS--
A0A2V9YHT3      QWISTWRK--HFDHVVIDTPPCLSVTDAVALSVVADSVVLVIRSGVTRKEALRRAREL--
A0A2V9NGH6      KVLDELRE--QYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQALRRARDI--
A0A2V9PYE6      KVLDELRE--QYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQALRRARDI--
A0A2V9NL07      DLLAELRE--QYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDI--
A0A2V9QD92      DLLAELRE--QYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDI--
A0A2V9WPZ6      DLLAQLRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDI--
A0A2V9ZLH4      DLIESLKR--DYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSGKTTKQALRRAREL--
A0A2V9RQF1      DVLAELRD--QYDHIIVDTPPTLSVTDAVVMSTRADTVVLVIRSGQTTKQALRRSRDI--
A0A2V9YDK8      DALAELRD--QYDHIVIDTPPTLSVTDAVVLSTKADAVVLVIRSGVTTKGALRRSRDI--
A0A2V9V8F7      DLLAQLRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDI--
A0A2V9XGR9      DLLAQLRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDI--
A0A2V9V3Q5      DVLDELRE--QFDHVVIDTPPTLSVTDAVVLSPRVDAIVLVIRSGQTTKQALRRARDI--
A0A2V9NWS3      DSLAELRE--QYDHIVIDTPPILSVTDAVVMSIRADTVLLVIRSGQTTKQALRRSRDI--
A0A2V9USA9      DVLAQLRE--EYDHIVLDTPPTLSVTDAVVLSPRADAVVLVIRSGQTTKQALRRSRDV--
A0A2V9XW18      DVLNQLRE--QFDHIVIDTPPSLSVTDAVVLSPRADAVILVIRSGQTTKQALRRARDI--
A0A3M2BZG9      ELLATLRS--RFDFILLDTPPALPVVDAAIIGQLVDGIVICARAGVLVREHARACRER--
A0A1Q7N5R7      DLLVRLRA--DYQVILVDSPPLGAGVDPYTLGTLTGAMMLVLRTGTTNLELARTRLAM--
A0A3M1SIV3      ALLTYLKT--NFKHVIIDSPPAISFADAAILSTLVDGVVIVAMAGKSSMHLLKRFKQR--
A0A3E0PHB0      NLLQFLKG--KFAHVVIDSPPAISFTDAAIIATLVDGVVLVAMAGKSSVHLMRRFKHR--
A0A3M2D491      ALLNFLKT--NFKHVILDSPPAISFADAAILSTIVDGVVIVAMSGKSSMNLMKRFKQR--
A0A357F267      NLLQFLRG--RYKHVIIDSPPAISFTDAAILSTQADGVILVAMAGKSSIHLMRRFKQR--
A0A353C9L6      NLLQFLRG--KYKHIIIDSPPAISFTDAAILSTQVDGVVLVAMAGRSSIHLMRRFKQR--
A0A2V8RQV0      NLMQFLRG--KFKHIIVDSPPAISFTDAAILSTVVDGTILVAMANRSSMHLMRRFKQR--
A0A2V8SJH5      NLLQFLRG--RYKHVIIDSPPAISFTDAAILATLVDGVVLVAMAGKSSIHLMRRFKHR--
A0A2V9QB26      GLLAKIKI--EFDLVIIDTPPMLQMADARVLGRVADAIILVTRAGQTTRDAAEAATQR--
A0A2V9VYY4      DYISRWRN--EFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTRPALRRACDL--
A0A2V9KIE8      ALLNSLRS--EYEYVIMDSPPLLSVSDSRILATMTDAVVLIARANSTPYQVIQRAKNL--
A0A352F549      RLLEIVGE--SFNYVVIDSPPIASFTDGVLISSLVDGVLLVVHGGKTSRQVVKRARQM--
A0A3B9MLP9      RLLDVAGE--TFAYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQI--
A0A3D5SQ87      RLLDVAGE--TFAYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQI--
A0A2V8NW86      GLVAKIKL--EFDFVIIDTPPMLQMADARVLGRMADAIILVTRAGQTTRDAAEAATWR--
A0A2V8ZHL8      SLLKELRQ--RFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARKV--
A0A2V9B240      SLLKELRQ--RFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARRV--
A0A2V9CBM2      TLIQSAGE--QYEFVILDSAPMLALADSRILAPLVSGVLLVVKSRTIPREQVLHAQSS--
A0A2V8XN17      ALIRSASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGTTPREQLLHAQSG--
A0A2V8WX45      ALVRSAKT--EYGFIILDSSPMLALADSRILAPLVDGVLLVVKSGTTPREQILHAQSG--
A0A1Q6YR79      ALIRSASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPREQLLHAQAG--
A0A1Q7VA32      ALIRSASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPREQLLHAQAG--
A0A2V9EY85      TLIRSASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPREQLLHAQAG--
A0A2V9H8K0      ALIRSASA--EYSFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQLMHAQSG--
A0A2V9FFE5      ALIRSASA--EYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQFMHAQSG--
A0A2V9GM43      ALIRSASA--EYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQFMHAQSG--
A0A1F2RFI7      QFLEQARQ--KFDYVILDSPPVLHVSDARILAARVEAVILVAHGAATPREAVNHAKQH--
A0A1F2RZS3      QFLEQAAQ--KFDYVLLDSPPVLHVSDARILASQVEAVVLVAHGAVTPREAVKHAKEQ--
A0A1F2USE2      TFLQEALG--EYSFLVIDSPPVLHVTDARILARLAEGTVLVVKGAATPRELARRAQLH--
A0A2V9C238      TLLREAKV--EYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPRELAQRAGAY--
A0A1F2Q9F5      AFLRQALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPRELVQRAYVY--
A0A1F2QQH9      AFLRQALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPRELVQRAYVY--
A0A1F2QXK7      AFLRQALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPRELVQRAYVY--
A0A2V9DEM9      TLLREAKV--EYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPRELAQRAGAY--
A0A2V9CYQ5      TLIKSAGK--QYEFVILDSAPMLALADSRILAPLVSGVLLVVKSRTIPREQVLHAQSS--
A0A2V9BWU8      AFLGAAKS--EYGFVILDSSPLLTLADSRILAALVDGVLLVVKSGATPREQVIQSQTS--
A0A2V8ZG48      AFLGSAKS--EYAFVILDSSPLLMLADSRILASLVDGVLLVAKSGATPREQIRQSQSG--
A0A2V8Y334      AFIASAKS--EYGFVILDSSPLLTLADSRILASLVDGVLLVVKSEATPREQVLQSQSS--
A0A2V9AY68      AFLTSAKS--EYGFVILDSSPLLTLADSRIIASLVDGVLLVVKSGATPRQQVMQSQSS--
A0A257VBK0      DLIERFKG--EYSWVIMDSPPCLSISDAFILGGMADRTILVARYKKTRKPLLERILVT--
A0A2V7XDY0      DFLDRLRG--HFSWILIDSPPLASVTDAQLLARYADLTTFVVQYNTADKKLIRRNLSA--
A0A350UQT3      PVMEEMAR--GYDLVILDAPPLLGFAESLQMASSADGVIVVTRAGETSRKAVAAALTT--
A0A2U3JZ71      TLLEDACG--DYDLVVLDSPPLLGFPEPLQMAASVDGVLMVALAGQTNRKALGSAVNT--
A0A2V8TTB0      ELIEEATR--EYDLVVLDAPPLLGFAEPLQMATAVDGVIVVARAGDTSRKALSSVIGT--
A0A1F2TCR2      GFLTNLAG-GPFDWVIIDTPPVLAVTDAVIVSRLVSNVVFVVGSEMTRRGHAERALQT--
A0A2N9LQU7      DLLEQWRT--EYDHVVVDTTPLLFFADTMPLAAKADGVLLVVLAGRSRRKAMIRTLDL--
A0A2P6WFK7      ELLESLSG--EYERIIIDTPPVLSVADSLALSNIADAVVLVVRSRIARKRAVLRVRNL--
A0A1F2V330      SVFERLRG--EFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRREVLERGLES--
A0A2V8U914      RLMQRFRQ--EFDYVIVDAPPCLEFADARILARYAEGVLLVLRANYGDKKTALAAANR--
A0A2V7W309      HLIQELRE--KYAFVIFDSPPVLAVTDAIVLAASADGVVLTVHGGYTPRELVQRSAER--
A0A2V8TLH7      RLLKELRQ--EFDWVFVDSPPAVSLADAMILASLCDMVAFVVKHNENDKDLIRRCVGD--
A0A1Q7ZJT1      SLLKELRA--EFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIRRCVTN--
A0A2V8VC99      ALLKELRS--QFDWVFIDSPPVVSLADSMILASLADMVAFVVRHNENDKELIRKCVTN--
A0A348UZU3      ELLGRLKG--SFDFILIDTPPVLSVTDSQVLGKMVDGLILVVQADRTPKEALRQTREI--
Q01XL7          ELVKKLRG--QFDYILLDTAPVLLFPDARLWGRHSDGVVLVVRAGVTTREGATSACQR--
A0A2V8ERZ5      TLLTNLAH-GPFNWIIIDTPPVLAVTDAVILAPMVTGVTFVVGAEMTRRRLAERAIET--
A0A2V8GTX0      AFLHQLTT-GPFDWVIIDTPPVLAVTDAVVLAPLVHSVSFVVGAEMTRWRLAERAIET--
A0A2V8J0X9      NFLANLAT-GPFDWVIIDTPPVLAVTDAVIIAPKVSGVVFVIGSEMTRRVHAERALET--
A0A372IRG7      DTLARWRQ--EFDHVILDSSPILAVSDTLSLAPQADAVLIVLRSGITRKKALSRVREQ--
A0A1F2U158      TLITNLRH-GPFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRRRLAERALET--
A0A2V8F6S9      TLLTNLSH-GPFDWIIIDTPPVLAVTDAVILAPWVSGVTFVIGAEMTRRRLAERAVET--
A0A1I6MH75      SLLERCAT--LYTHVVIDSPPILSVTDGVILARQADAVVLVVRHGKSSKQIVRRARDL--
E8WVF6          ELIRHASE--IYTHIVIDSPPILSVTDGIILSRQVDVCVLVVRHGKSSKHVVRRARDL--
A0A1H5Z7N3      NLVEQCRG--IYTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRHGKSGKQAVRRARDL--
A0A1G7JVV8      NLLQECGE--LYTHVVIDSPPILSVTDAVILAHYADAIVMVVRHGKSSRNVVRRARDL--
A0A1H4T6W9      DLLLYCCS--IYTHIVIDTPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDL--
I3ZEU5          DLLLHCCT--LYTHVVVDSPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDL--
A0A428MDU2      AFLNHCGD--LYTHIVIDSPPILSVTDGVILARRADAVVLVIRHGKSSKHVVRRARDM--
A0A239HDF6      ELLRYAGE--IYTHVVIDSPPILSVTDGVELGGMVDAVILVLRHGKSNKHVVRRARDL--
A0A1Q3QQB6      QLLRQCGD--LYAYVVIDTPPILSVTDGVILARHADAVVMVVRHGKSSKHVVRRARDL--
A0A3N1K1G7      TLLRHCGE--VYTHVVIDSPPILSVTDGVILAREADAVVLVVRHGKSSKHVVRRARDL--
A0A2W0BGU4      SLFGELRR--RFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNI--
A0A2W0BVQ9      SLFAELRQ--RFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNI--
A0A3D1ASD2      QILEEAAL--EYDLIVLDAPPLLGFPEPLQMAVNVDGVIVVSVAGQTSRKAVASVLST--
A0A2N9MK30      QILEEAAG--DYDLVMVDSPPALGFPEPLQMATAVDGVALIALAGQTDRKALASVVSM--
A0A2V9MN96      DCIARWRN--EFDHIIFDTPPCLSVTDSVVLSVEADRAILVARSGQTPKGAVRRASEL--
E8UZE1          ELFEEWRK--AYDFIVVDTAPLLAVSDTTALVATADTTVVVVRDDATRKQSLQAVRDT--
A0A2V7V2Z1      DFLDGLRG--FYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPRNGLRQTLER--
A0A2V7X2F7      GFLEGLRG--VYNWIVIDTPPVGAVSEPLILGPLADGVIVVVGAEMVPRKAVATTIER--
A0A2V7V2I1      GFLHGLRA--AYSWVLIDTPPVGAVADALILSSACDGVLIVAQAERVPRKAVLHTLER--
A0A2V7U3M2      DFLEGLRG--FYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPRNGVRHTLER--
A0A2V7UHT0      DFLEGLRG--FYDWIVLDTPPVGPVAEALILGPLTDGVVVVVGAEMVPRNGVRHTLER--
A0A2Z5FVL3      QLLDLWRG--YYDFIILDGAPVLPVTDSVVLSSQVDATLLVARYQSTQQQSLDLSLRT--
A0A1V6HR88      DLVRQLRL--RFDYVVIDSAPTLAVTDATILGSIADGVVLTACAGRVQRQEAKACRDR--
A0A3E0P0A3      ELFAQLRQ--QYDTILIDTPPVLAVTDAVTVAVRSDGLLLCVRSQRAPREAIQRCVEQ--
A0A2V9KBD6      ELVESWRQ--RFDHIIIDSPPLLPVADALRLSVVADSVILVIRAGEVGKDTFQRAQDA--
A0A2W0AJ66      DLLEGWRG--QFDHIIVDTPPVLPLTDAVRMSVEADSVILVVRSGHIVKDAFLRAQDL--
A0A1Q7RBU1      DLVERWRD--QFDHIIIDTPPVLPMTDAVHMSVEADSVILVIRSGQIARDEFLCAQDL--
A0A2V9JPV9      DLVERWRE--QFDHIIIDTPPVLPMTDAVHMSVEADSVILVMRSGQIARDEFLCAQDL--
A0A2V8EXP2      EFLGTLGQ--HFDCVIVDTPPVMAVTDSSIAAHVATGLIFVIGAEMTTRHTAQRAVEQ--
A0A2W4RYA1      RVLDSATR--QFDWVVVDSPPVMPVADAAIVGHMVSGVLFVVHSEKTSRHAANQALGQ--
G8P0Y7          DLLKKWCE--EYDHVIIDSPPVITVTDAVLLSVETDAVLLIIRSGQTTAAHVRHTCGL--
A0A3D4VGU2      DTIQKWRS--EWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTREL--
C1F294          DTIQKWRS--EWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTREL--
A0A3P0X3W6      ALLTDAEQ--DYDLVLIDTPPMLGLAEPIQIACSVDGVLLITQAGETNQDAVAAAIGT--
A0A1E3Y9R6      ELIAELKR--RYDWVVIDAPPVMPVTDAAVVAHGSSGVLFVVGAEMTPRQTAIAAVEQ--
A0A2W4TLP2      DLIAELKK--RFDWVVIDAPPVMPVTDAAVVANSASGVLFVVGAEMTPRQNAAAAVEQ--
A0A3R9WF43      AVLEMCTN--RFDYVVIDSPPILRVTDATIIAKKVDGIITVLRSQATTRSMASSVAQI--
A0A317HKM4      RLIDYLQK--QFDWIVIDSSPVLAVTDPCVIARVASGALLVVRSGRTSRDVASAAVER--
A0A2W0C122      AIMESWRE--RYDYVILDTPPIIAATDAVRLSKEVDSVLLVIRSGQTPTDALARSCDV--
A0A2W0AUU7      SLMESWRE--RYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDL--
A0A2W0BQL1      SLMESWRE--RYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDL--
A0A3P0XH15      ELLQRWRS--EYDHIILDSSPVLAVADTLSIAPQVDACFILVRSGVTRKKALLRTREQ--
A0A3M1WQW8      EAVKVLSE--RYDFVILDSPPV-STPDALILSTMVDGVILVIQCGETPRELVQRAKQS--
A0A3N1JHC1      SVIGTVRN--GFDFVLIDAPPLLGLADARILSKFTDGVIFICRAGQTNTDDLAEARRL--
A0A2V9KA79      EILAHARQ--RYRLIVLDAPPILPMADSHILAGLSDGVLLVVRARQTRRELFQHAVES--
G8P085          SLLQQWEQ--EFDYIIVDSAPLLIVSDSLPLASWADALILVTRYNMTPLGALKRIRDV--
Q1ILD9          EMLEEWQK--NFDHVIFDAPPALVVTDAVVLALLCDAVLLVARSGVTHRSALRRSYEM--
Q1IJZ6          DLLKRVVL--EYDLVLIDSPPAMLVSDAAIISSRVDGVVLVARAGIITRAALGKAVEV--
A0A2V8TCE6      ELLKMVLD--SYEMVVLDSAPLLTVADGAILASRTEGTLLVVESDRTTREEALRAREK--
Q1ITG0          EILNEWRG--AFDHVVIDTPPVVAVTDGVVLSQKTDAVLLIARASRTGRHPLRHARML--
A0A3N5PCI5      EFLARVGE--SFDWVIIDSPPVMAVTDPSVMAHLASGVLFVVNARHTKQRVAQAALDQ--
A0A3M1Q0S9      TMVRELEGFEDFDHVIFDSPPVLSVVDPLLIGRQMDGTILVLRSAYTSRDAGRLGVEK--
A0A3M1VZ38      ELVETLRERGEFDHVIFDSPPLLSVVDPVLIGRQTEGVVLVIRSGYTSREAGRLGKDK--
A0A3M1PY35      AVVRALRERHGAEFVIVDTPPTLVFADAYSIVPAIEGVILVARALRTPKDAVREVCEA--
A0A3M1VMP2      EIVGELDERLGFDFVVIDSPPVLVFADALNLVPVVEGTLLVARALSTPKDALRQAVDQ--
                              :..*  *     :                                 

A0A2V7YYV7      LD-RVGAH-TIGVVMNKVRASSGS---------YAYDYGYYAASPDGHARPGRRPSSKSE
A0A2V7Z0J5      LD-RVGAH-TLGAVMNKVRASGSS---------YAYEYGYYATPQADPSAPDVEPLARVK
A0A2V7Z3M4      LD-RVGAH-TLGVVMNKVRASADA---------YAYDYGYYSPAASGAPNPLVDKTSNAD
A0A3M2D9H8      LD-RVKAR-VVGAVLNRVQDSVSN--------------HYYHNLKSYAYIAKESDELTLL
A0A399Y5V2      LD-AVGAE-LLGVVLNEVTPNFGE---------PGYYYDYYYYYQSYRPIPEKQGSKRGG
Q01X01          LL-LDGIS-VMGVIFNYWDPTVN---------------DLYSYAQYHQDIA---------
A0A2V7VMF7      LR-KATPN-LLGAILNAVDLKTRS---------YHYYYYQDGEAGKAEARPEAAVKG---
A0A2V8JK38      LA-EAQVR-IAGVVLNDLDLRHLAGYSARYRDGYVYDRYYGHITHDENVENRS-------
A0A2V9IXG5      LA-KTHAN-IMGAVLNDLDVKKTR-----Y---YAYQSYYRYYSDSDAK-----------
A0A2V9J2P4      LA-KTHAN-IMGAVLNDLDVKKTR-----Y---YAYQSYYRYYSDSDAK-----------
A0A192WQ77      VK-NVNEH-LIGAVLNNVDIDKSF---SKD---LYYTGYYYYSSD---------------
A0A1Q7RLS4      VR-RINPN-VIGAVLNSVDLERSH-----------YKDYYYVGYYYYGESSSSKKGRKRR
A0A2V2R525      LM-DVGAN-IFGVVLNNVDVTAQD--GY-----YYYRPTA--------------------
A0A321LPW6      LV-NAGAK-IFGVVLNNVDMRQHK--YDDY---YCYYSKQYDSYGH--------------
A0A2V9R9V4      LS-AVGAR-IFGIVLNNVDLRREG--HDDY---Y-YYSYQYSYSAD--------------
A0A321LE75      LA-TVGAK-IFGVVLNNLDLRREG--YDSY---Y-YYRYYGDYSER--------------
A0A2V8R8U7      LL-DVGAH-IFGVVLNNVKLESTD--Y------YYN-TYYSSYYRT--------------
A0A2V8QMP4      LQ-DVGAH-IFGIVLNNVKLEGTD--Y------YYYSGYYSGYYSD--------------
A0A2V8R4S3      LQ-DVGAH-IFGIVLNNVKLEGTD--Y------YYYSGYYSGYYSD--------------
A0A2V8NJ55      LL-DVGAH-IYGVVLNNVKPEGSN--S------YYYYGYYSSYYES--------------
A0A2V8Q7I0      LL-DVGAH-IFGVVLNNVRLETQD--Y------YYS-GYYSSYYSD--------------
A0A2V8S6K4      LL-DVGAH-IFGIVLNNVKLEGND--Y------YYGYGYYSNYYAH--------------
A0A317I2L9      LL-DVGAH-IFGVVLNNVRQESHD--Y------YYS-GYYSNYYSS--------------
A0A2V8LLF9      LM-DVGAH-IFGVVLNNVKIETKS--D------YYYAGYYGGYYDAGYY-----------
A0A352FRF4      LL-DIGAN-IFGVVLNNVKIEKTQ--D------YYYGGYYGHYKSSY-------------
A0A2V8MKV0      LL-DVGAH-IFGIVLNNVKLDTHG--Y-------YYGGYYGRYYYKYGYYYSD-------
A0A2V8PYY8      LL-DVGAH-IFGIVLNNVKLDTHG--Y-------YYGGYYGRYYYKYGYYYSD-------
A0A1Q7YKQ8      LL-DVGAH-IFGVVLNNVKLESTD--Y------YYYAGYYSSYY----------------
A0A352F3R7      LL-DVGAH-IFGVVLNNVKLETQD--Y-------YYSGYYSSYY----------------
A0A0B6WXT1      LQ-DVGAH-IIGVVLNNVKLDAHD--Y------QYYANYYAAYY----------------
A0A3B9MEU8      LL-DVGAH-IFGIVLNNVKLETQD--Y-------YYSGYYSSYY----------------
A0A2V8MHG6      LS-DVGAK-IFGVVLNNVTVSKHD---------YCYNQYRAYYQS---------------
A0A2V8P7N1      LS-DVGAK-IFGVVLNNVTVSKHD--Y------YYYNQYREYYHST--------------
A0A2V8M3M6      LS-DVGAK-IFGVVLNNVTVSKHD--Y------YYYNQYREYYHS---------------
A0A1Q7NJH5      LS-DVGAK-IFGVVLNNVTVSKHD--Y------YYYNQYRDYYHSA--------------
A0A2V8PJY0      LS-DVGAK-IFGVVLNNVTVSKHD--Y------YYYNQYRDYYHSA--------------
A0A1Q7Y6W9      LQ-DVGAK-IFGIVLNNVNISSHD--H------YYYQRYYQQSYYD--------------
A0A2V8NC68      LQ-DVGAK-IFGVVLNNVNVRSSD--Y------YYYHHYYSHYYSK--------------
A0A399WK13      LL-DIGAK-IIGVVLNNVNLRSQD--NY-----YYYQSYYTRDNYR--------------
A0A352FLX4      LQ-DVGAR-IIGVVLNKVPSTGSN--S------YYYSGYYQHYHYG--------------
A0A2V8RTL7      LI-DVRAK-VLGVVLNNVNLNSQD--NY-----YYYQSYYYRNNYR--------------
A0A3E0PCJ6      LH-DIGAK-VFGVVLNNVDARSND--NY-----YYYQSYYHRDDDP--------------
A0A3M1S4R8      IQ-DVGAK-IFGVLLNNVNLSSQD--NY-----YYYQSYYYNSYYK--------------
A0A1Q7YFI6      LQ-DVGAK-IFGVVLNNVKLERQD--YYHR---YYYKNHYYSKHRD--------------
A0A136KC10      LN-DIGAK-ILGVVLNNVNLRAQD--NY-----YYYQSYYTRDNYR--------------
A0A2V8SEX6      LQ-DVGAK-IFGVVLNNVNLRSQD--NY-----YYYQSYYHRNNYR--------------
A0A3M2D6Y5      LQ-DVGAK-IFGVILNKVDVNSQE--NY-----YYYQSYYYSSYYK--------------
A0A0B6WWQ6      LH-DVGAR-IFGVVFNHAGMPSDA--AY-----YRYNR----------------------
A0A3B9MK99      LH-DVGAK-IFGVVLNNVALQSHD---Y-----YYYQRYYGARNYK--------------
A0A352EX26      LH-DVGAK-VFGVVLNNVTLQSND---Y-----YYYQRYYASGNYT--------------
A0A2V8MM59      LI-DVGAK-IFGVVLNNVNVRSHD--YY-----YYYQRYYH-------------------
A0A2V8PFE8      LT-DVGAK-IFGVVLNNVSARSHD--YY-----YYYQRYYHQSYYS--------------
A0A2V8PWS6      LT-DVGAK-IFGVVLNNVSARSHD--YY-----YYYQRYYHQNYYS--------------
A0A2V8LCT5      LL-DVGAK-IVGVVLNNVSVRSHD--YY-----YYYQRYYHQSYYH--------------
A0A352FTJ9      LL-DVGAK-LVGVVLNNVSVRSHE--YY-----YYYQRYYHQSYYT--------------
A0A2V8G155      LT-HCRAR-IIGAVLNRVALDRNR---YYY---SHY---YSREYQAY-------------
A0A2V8HDM7      LT-HCRAR-IIGAVLNRVALDRNR---YYY---SHY---YSREYQAY-------------
A0A2V8DRT9      LI-NANGH-MIGAVLNRVDLTHNA---YYY---SQY---YRREYGHY-------------
A0A2V7VYF3      LA-LAQAG-LMGAVLNRVDVEHHG---HYY---SGY---YRAAYARY-------------
A0A1F2SVH2      LE-QARAK-SIGAVLNRVDLQHNS---YYY---SQY---YRREYSDY-------------
A0A2V8AJG9      LR-QAKCD-VIGAILNRVDLKHHG---YYY---SQY---YRKQYGEY-------------
A0A2G6PYV5      LS-QNKIK-PLGTLFNDYDFTKGKKYYGYK---YGYRYKYGYGYG-YVPYSYN-------
A0A2V8F956      LD-HVQAR-FVGAVLNRVDLDRNA----------YY---YSNDYRREYTQYYAKSS----
A0A1F2S1W5      LE-LGQAK-FLGTVLNRVDLEHNS---YYY---SRY---YRPEYGGYYGPGAPGGTQTGT
A0A1F2T595      LE-LGQAK-FVGAVLNRVDLEHNA---YYY---SRY---YRPDYGGY----YGPPGGGGG
A0A2V8JQV5      FR-EDRTR-VIGTVLNMWDPRDAS---QKR---YYY---SNTYYEHY-------------
A0A2V9AC41      LS-TPHTK-ILGVLLNRVDVRAGE-----Y---GSY---YAHYYE-YYPHDLDLSDGPPA
A0A2V8K4L4      FV-ADGST-ILGTILTDWNPDQNG--YGYD---YKY---YSSHAAYYTDSGVT-------
A0A2V8NCZ3      FV-ADGST-LLGTILTDWNPDQNG--YGYD---YKY---YSSHAAYYTDAAIA-------
A0A2V9MAM9      LL-TDGVP-VLGTVLNDWNPNIAT---------YGY---YRYGKS-Y-------------
A0A2V9M454      IE-HSGGK-ILGTVLNKVDVRRDG-YYG-----YRY---YHGYYS---------------
A0A2V9IVR7      IE-NAGGK-ILGVVLNKVDVRRGT-YYGSY---YGY---GRGYYN---------------
A0A2V9ILE2      IE-NAGGK-ILGVVLNKVDVRRGT-YYGSY---YGY---GRGYYN---------------
A0A2V9LGY4      IE-NAGGK-ILGVVLNKVDVRRGT-YYGSY---YGY---GRGYYN---------------
A0A2V9J4D6      LH-STGAR-ILGVLVNKADLRRGG-GYGYG---YNY---YNGYYY---------------
A0A2V9L9C5      LH-STGAR-ILGVLVNKADLRRGG-GYGYG---YNY---YNGYYY---------------
A0A2N9M9N1      LD-RAGAK-TLGAVLNKLDDRVDG-YYTSR---YKY---YGYYYS---------------
A0A2V9JEC4      IE-QAGAH-IVGAILNKATRRATDGYYGSR---YSY---YGSYYH---------------
A0A2V9LPQ3      LD-VAGGK-VLGVVINKVDFQQEGYYYGSL---YRY---YGSYYG---------------
A0A348V070      IE-DHKIN-CLGVIINGVSLLEQE--GYYA---RQY---YHYSKP-L-------------
A0A2Z5G3A3      LQ-MHGGS-PTGIVLNGIEREAEK-----R---YSC---YGYSGSDLVTQRKG-------
A0A2V7UGP8      LT-QAKAN-ILGVVLNDVDVRHGE-----------Y---YSYHYG-YRYRAYR-------
A0A239MKT6      LR-QYSGR-LLGYVVNDVESNQTA---------------YGYGYG-Y-DAYYQ-------
A0A3E0PCN7      IE-EVGGN-VVGVILNDVPISEYK----YH---NSY---YYRQLEEF-------------
A0A2V8IYW3      ---LGRER-ILGVVFNGADTSRRY-GDDYY---GYY---AKSGYG---------------
G2LEI9          LD-ETNTR-VLGVVLNGMTQEQSS---YYG---YDY---YGYSSYYRYSQAVTVNGDGKA
A0A317J121      LS-EDQTP-LLGTVLNDFKATRRS-----R---QGY---YNYAGR---------------
A0A2V7YW66      LR-QAGVK-ILGAVLNRYRSLQTG--LGKR---YKY---YEAYGA---------------
A0A2V7Z0V0      LR-QSGIK-ILGAVLNRYRSLQTG--LGKR---YRY---YEAYGA---------------
A0A2V8GFD4      LD-AAGAR-YIGAVMNRAEIRRHP---HYY---SRY---YRTKYT---------------
A0A2V8HSS5      LD-AAGAR-YIGAVMNRAEIRRHP---HYY---SRY---YRTKYT---------------
A0A2V8KP55      LA-EAQVR-IAGVVLNDLDLRHLA----------GY---SARYRDGYVYDRYY-------
A0A399WNU1      IQ-DVHGN-VVGIVLNDIQLNNFK-----------Y---YNHTYY---------------
A0A2V9CG11      FA-KDRTR-VLGTILNGWDPKTGG-----R---YGY---GGYYAG-Y-------------
A0A2V2R0I6      LS-SVKCR-LLGVVLNAVDSSAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V8XAR9      LA-SVKCH-ILGVVLNAVDSSAPD--YYYS---YRY---YPYSEG-Y-------------
A0A2V8VZA0      LN-SVKCR-ILGVVLNAVD---------------RY---YPYSYG-Y-------------
A0A1Q7CB82      LN-SVKCR-ILGVVLNAVDSGAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V8WIU1      LN-SVKCR-ILGVVLNAVDSGAPD--YYYS---YRY---YPYSYG-Y-------------
A0A1Q6Y9F5      LS-SVKCR-ILGVVLNAVDASAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V9EVV8      LS-SVKCH-ILGVVLNAVDASAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V8YF91      LN-NVKCR-VLGVVLNAVDPGAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V8XZK2      LN-SVKSR-ILGVVLNAVDSSAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V8ZTX6      LT-SVKSR-ILGVVLNAVDSSAPD--YYYS---YRY---YPYSYG-Y-------------
A0A2V9BT79      LT-SVKSR-ILGVVLNAVDSSAPD--YYYS---YRY---YPYSYG-Y-------------
A0A1Q8B793      LT-SVKCR-LIGVVLNAVDSTAPD--YYYS---YRC---YPYSYG-Y-------------
A0A2V9BCA0      LT-SVKCR-LIGVVLNAVDSTAPD--YYYS---YRC---YPYSYG-Y-------------
A0A2V9BWU9      LV-AVKCR-LLGVVLNAVDSSSPD--YYYS---YRY---YTYSYGAY-------------
A0A2V9DKX2      LV-AVKCR-LLGVVLNAVDSSSPD--YYYS---YRY---YTYSYGAY-------------
A0A2V9JSI3      LE-NAGGK-VLGVVLNKLDARRNG-----------Y---YGSYYP-SAYGKYY-------
A0A2V9WI32      LS-HVNAR-ITGVIVNAFDLHSGS---------SYY---YQYDSK-YYGRYYE-------
A0A2V8IVN9      LE-NAHAK-FVGAVLNRVELEKHH----------YY---YSQYYR-KEYARYY-------
A0A1F2TPT3      LM-MANAK-VIGGVLSRVDPGRFG---QYY---SSY---YRGNSR-KYRDYYK-------
A0A2V8JTQ2      LS-KVNAR-LTGFVLNGANLDSSD-----F---RYY---HNYSQD-Q-------------
A0A2V8UZY0      LR-RVNAH-VAGFVLNGAQVDSSD-----F---RYY---YSYHSQ-H-------------
A0A3N5YNR8      LS-SVGAR-ILGALINNVDMNAPE-YSYYY---RHY---FDERYN-T-------------
A0A350UEK1      LR-EDGVT-LIGTVMNDWDPQDSP---GGY---YGS---YGKYST-Y--RQYY-------
A0A350UIQ4      LR-EDGTH-LIGTVMNDWDPKDSP---GGY---YGY---YGKYSS-Y--HQYS-------
A0A3N6A5T6      LN-QVGAK-ILGVMINDVDIRKSE--YRYY---YKY---YYDSKY-YSGYGYG-------
A0A1F2Q9L4      LQ-LSEVR-ILGAALNRFREHHGR-YGKRY---RAY---QKYVDD-A-------------
A0A1H5SQF5      LA-PSRNR-LLGLILNAADIESSE--FGGG---YKY---YGDSTY-Y-------------
A0A2Z5G448      LR-RARAR-VTGIVVNDVDLRLEN-----------Y---YTYSKQ-Y-GYDYA-------
A0A3E0NV31      FQ-RAGAR-ILGALINGADLRNPD-YGYYY---SGY---LSRTYD-Y---HYA-------
A0A3N5M5V0      LM-SVGAR-VLGAMINNVDMDTPE-YTYYY---RDY---YDDRYN-S-------------
A0A2V9AEW6      FT-EDGTR-VLGTVLNSWDPRTMR----YG---YGG---YGVYKD-YVGQ----------
A0A2V8WQK6      FA-EDGTR-VLGTVLNSWDPKNSR---GYG---YGN---YREYEK-YVGQ----------
A0A2V8XIF4      FA-EDGTR-VLGTVLNSWDPKNSH---RYG---YGS---YADYEE-YVGQ----------
A0A3N5XQP8      LT-GVGAN-LLGVLVNGLDVTEFG--YGAY---GGY---YPYGDQ-HRTHSWTRFFTDWA
A0A2Z5G7H4      MD-QSTQD-RVGIVLNGVSQGSPF-----H---YEY---YGHSGS-LGYPEIH-------
A0A2V9KCS3      FA-EDGTP-VLGTILNQWNPNSTA-----G---YGY---YSDYHQ-Y----YS-------
A0A2U3KC61      LL-QVNAR-VMGIVLNALNRHSIE----E------Y---YQYGGR-YANHYYH-------
A0A2V9Y2R7      LL-QVNAR-VMGIVLNALDLHSAD----GY---HYY---YSYGGR-YAGHYYD-------
A0A372IT17      LQ-MAQNA-VLGVVLNGVRETSAE-----------Y---YEY-YG-YKGSRYG-------
A0A136JPP4      IS-ALGAR-IYGVVLNGITSESVE---------YDY---YG--TG-Y--YTYY-------
A0A399WUJ8      IS-ALGAR-IYGVVLNGITSESVE---------YDY---YG--TG-Y--YHYY-------
A0A2V9L5B5      LY-NAGAR-ILGVALNDVDLRREG-YGHNG----------SYGYS-YTGYGAP-------
A0A2V9L7I0      LY-GAGAR-VLGVALNDVDLTRDG-FGYQH-----------YHYG-Y-IAGVS-------
A0A2V9LK56      LK-SVGAR-ILGVTLNGLDLRRDG-YGYGY---GSR---YGYHYG-Y-GYGYG-------
A0A2V9YHT3      LA-RVNAK-VAGVVVNAVDLRSPD-----L---HHY---YYSGGG-R-GYKYY-------
A0A2V9NGH6      LL-QVNAH-ATGVLLNAVDLNSGD-----Y----YY---YEYQGK-H-GQRYF-------
A0A2V9PYE6      LL-QVNAH-ATGVLLNAVDLNSGD-----Y----YY---YEYQGK-H-GQRYF-------
A0A2V9NL07      LA-QVNAR-VAGVLLNAVDLDSPD-----Y---YYY---YEYQGK-Y-GQRYY-------
A0A2V9QD92      LA-QVNAR-VAGVLLNAVDLDSPD-----Y---YYY---YEYQGK-Y-GQRYY-------
A0A2V9WPZ6      LM-QVNAK-VAGVLLNAVDLSSPD-----Y---YYY---YEYQGK-Y-GSKYY-------
A0A2V9ZLH4      LV-RVNAK-ITGVLLNAVDLSSPD-----Y---YYY---YEYQGK-Y-GGRYY-------
A0A2V9RQF1      LM-QVNSR-ISGVLLNAVDLNSPD-----Y---YYY---YEYQGK-Y-GQRYY-------
A0A2V9YDK8      LM-QVNAK-VTGVLLNAVDLNSPD-----Y---YYY---YEYQGK-Y-GSRYY-------
A0A2V9V8F7      LM-QVNAK-VAGVLLNAVDLSSPD-----Y---YYY---YEYQGK-Y-GSKYY-------
A0A2V9XGR9      LM-QVNAK-VAGVLLNAVDLSSPD-----Y---YYY---YEYQGK-Y-GSKYY-------
A0A2V9V3Q5      LM-QVNAH-VTGVLLNAVDLTSPD-----Y---YYY---YEYQGK-Y-S-QYY-------
A0A2V9NWS3      LM-QVNAR-VAGILMNAVDLRSPD-----Y---QYC---YEYQGK-Y-GHRYY-------
A0A2V9USA9      LM-QVNAK-VSGVLLNAVDLSSPD-----Y---YYY---YEYQGK-Y-A-RYY-------
A0A2V9XW18      LM-QVNAK-VVGVLLNAVDLSSPD-----Y---YYY---YEYRGK-Y-A-SYY-------
A0A3M2BZG9      LR-YQRIR-LLGTVVNRFNPSGAS-RYARQ---YYY---AD----------YG-------
A0A1Q7N5R7      LE-HLPIR-LLGVLLNDVQPGEM----------YGY---YS--YT-Y-AGGYA-------
A0A3M1SIV3      LN-SIGAR-IYGVVLNGISSTSPE---------YGY---YGYYYG-Y--ESYK-------
A0A3E0PHB0      LL-NMGAR-IYGVVLNGLKPNSVE---------YGY---YG--YG-Y-GYDYS-------
A0A3M2D491      LI-SIGAR-IYGVVLNGVKPSSLE---------YSY---YGYYYG-Y--YGYY-------
A0A357F267      LG-NLGAR-IYGVVLNGIKAGSME---------YDY---YG--SG-Y--YDYY-------
A0A353C9L6      LG-NLGAR-IYGVVLNGIKSGSVE---------YEY---YG--AG-Y--YDYY-------
A0A2V8RQV0      AN-AIGAR-IYGVVLNGIKSGSIE---------YEY---YG--TG-Y--YDYY-------
A0A2V8SJH5      LG-TIGAR-IYGVVLNGIKAGSME---------YDY---YG--TG-Y--YEYY-------
A0A2V9QB26      FT-EDNTR-VLGTVLNGWDPKETS-HYDYR---YQF---YR--YH-H-------------
A0A2V9VYY4      LL-QVNAR-VMGIVLNALNLHSVE-GYYYY---GTQ---YS--NN-Y----YS-------
A0A2V9KIE8      LY-GAGAR-ILGVALNGVDFRHGG-YGYGY---YRR---YG--YG-Y-GYGYG-------
A0A352F549      LQ-EIGAK-IIGVVLNKAELNAGN-DY--------Y---YH--YG-Y--KGYY-------
A0A3B9MLP9      LQ-EIGAK-IIGVVLNKAEVRSSD-YY--------Y---YH--YD-Y--KGYD-------
A0A3D5SQ87      LQ-EIGAK-IIGVVLNKAEVRSSD-YY--------Y---YH--YD-Y--KGYD-------
A0A2V8NW86      FT-EDNTR-VLGTVLNGWDPKETS-YYGYR---YPF---CR--YH-Y-------------
A0A2V8ZHL8      LE-NAGAR-ILGLVFNKVDVRHNG-YYGYY---GHY---YY---S-G----SG-------
A0A2V9B240      LE-NAGAR-ILGLVLNKVDVRHNG-YYGYY---GHY---YY--SS-G----SG-------
A0A2V9CBM2      IS-SVRAN-LIGVILNGVDVRTNG-----------Y---YD--YG-R----Y--------
A0A2V8XN17      IR-SVGGN-LIGVVLNSVDIRTNG-----------Y---YN--YG-S----YG-------
A0A2V8WX45      IR-SVGGN-LIGVVLNSVDIRTNG-----------Y---YN--YG-P----YG-------
A0A1Q6YR79      IR-GVGGN-LIGVVLNSVDIRTNG-----------Y---YS--YG-P----YG-------
A0A1Q7VA32      IR-GVGGN-LIGVVLNSVDIRTNG-----------Y---YS--YG-P----YG-------
A0A2V9EY85      IR-GVGGN-LIGVVLNSVDIRTNG-----------Y---YN--YG-P----YG-------
A0A2V9H8K0      IR-SVGGN-IIGVVLNSVDIRTNG-----------Y---YN--YG-Q----YG-------
A0A2V9FFE5      IR-GVGGN-LIGVVLNNVDICTNG-----------Y---YN--YG-P----YG-------
A0A2V9GM43      IR-GVGGN-LIGVVLNNVDICTNG-----------Y---YN--YG-P----YG-------
A0A1F2RFI7      LH-QVNGN-LIGVVLNNVDFSAVG--YDYY---YRY---YR--KG-Y-GYGYG-------
A0A1F2RZS3      LQ-QAGAN-LIGVTLNNVDFSAVG--YDYY---YRY---SR---G-Y-GYGYG-------
A0A1F2USE2      CR-DVGAT-VVGVVLNNLDVRSGD-YYYYY---YRY---YR--YG-Y-GYGYG-------
A0A2V9C238      AR-DVGAN-LIGVVLNNLDLRGGD---DYY---YRY---YH--YN-Y----YG-------
A0A1F2Q9F5      AR-DVGAN-VIGAVLNNLDIRSDD---YYY---GRY---YR--YD-Y----YG-------
A0A1F2QQH9      AR-DVGAN-VIGAVLNNLDIRSDD---YYY---GRY---YR--YD-Y----YG-------
A0A1F2QXK7      AR-DVGAN-VIGAVLNNLDIRSDD---YYY---GRY---YR--YD-Y----YG-------
A0A2V9DEM9      AR-GVGAN-LIGVVLNNLDLRGGD---DYY---YRY---YH--YN-Y----YG-------
A0A2V9CYQ5      IS-SVRAN-LIGVILNGVDVRTNG-----------Y---YD--YG-R----YR-------
A0A2V9BWU8      IR-SAGAN-LTGVVLNNVSLHTNG-----------Y---YG--LG-I----YG-------
A0A2V8ZG48      IR-SAGAN-LIGVVLNNVTLHTNG-----------Y---YG--LG-I----YG-------
A0A2V8Y334      IR-SAGAS-LIGAVLNGVSLHTNG-----------Y---YG--LG-I----YG-------
A0A2V9AY68      IR-SAGAN-LIGVVLNNVTLHTNG-----------Y---YG--LG-M----YG-------
A0A257VBK0      LA-RAHVQ-VAGVVLNEVETHSSY-----Y---YDYY-YYNHYYYATGTEPKRLPWILGK
A0A2V7XDY0      LR-KVTDT-VLGVVLNAVNVKAKG-----Y---YYY--YYPHDVETSKAPNKPSESKPAE
A0A350UQT3      LS-HLRAN-VLGLVLNQVKKHHAD-----S---YYYYGYYGKYYKRYQSAAQNAEG----
A0A2U3JZ71      LK-RLRAN-TVGVVLNDVRADSSD-----N---YYYYHYHPKYYKHYSVEAENEI-----
A0A2V8TTB0      LA-RLRAN-LVGVVLNEVHRKVSA-----G---YYYYYGH--YSKYYGRTEDK-------
A0A1F2TCR2      LL-SGRPQ-SIGAVLNRVDFDRNK-----Y---YYAR-YYGYQYKSYYGQTNTTPAA---
A0A2N9LQU7      LA-RAKAH-VLGMIVNGVALEPEY-----V---NSYVTYGYSKGYGDIDAKRSA------
A0A2P6WFK7      LR-RSNAN-LVGIVFNGVDMLLEQ-----Y---YYAKGSYYGKSMGNYYLSEDE------
A0A1F2V330      FQ---ATK-LLGAVVNDVDYQRSR-----Y--------AYAYQYQAGLPV----------
A0A2V8U914      LF-LDGVP-VLGTILNHWNPVVWG-----D---AYGYPSYRGVYDQTAS-----------
A0A2V7W309      LR-LSNIP-VLGALLNNLDLQQYG-----Y---TYRKSYYDYYDSNQDNAERRGQRADGR
A0A2V8TLH7      LR-KINAN-VIGAVLNNIDLERSD-----Y---KDYY-YVGYYYYGESSSSKKDRKRRST
A0A1Q7ZJT1      VR-RINPN-VIGAVLNSVDLERSH-----Y---KDYY-YVGYYYYGESSSSKKGRKRRSS
A0A2V8VC99      VR-KINSN-VIGAILNNVDLERSH-----Y---KDYY-YVGYYYYGTSGGKRGRRRKGSS
A0A348UZU3      ID-LLQLK-TFGVVINALNLDNRS-----Y---YHRH-YYRHYYKH--------------
Q01XL7          FA-EDGIA-VLGTILNDWTPKEGS-----P---SH---YYYHSYEAYGQK----------
A0A2V8ERZ5      VM-QAHPR-FAAVVLNKVNFAKNK-----Y---YYSR-YYGHQYKNYYAEATP-------
A0A2V8GTX0      LQ-AGHPR-SIAAILNRVDFDRNR-----Y---YYSR-YYGHQYKSYYAEAPAAS-----
A0A2V8J0X9      LQ-SGRPR-SIGVVLNRVDFDRNK-----Y---YYSR-YYGYQYKSYYGQNQGAA-----
A0A372IRG7      LR-RSGAR-VLGTIINDVDLRLEN-----Y---YTYSRRYDYGYKGYKGYGSAYGAGYAG
A0A1F2U158      IL-ASHPK-MVGVVLNKVDFARNK-----Y---YYSR-YYGHQYKSYYARVG--------
A0A2V8F6S9      VM-QTRPK-YAAVVLNKVDFARNK-----Y---YYSR-YYGHQYKNYYAEAAV-------
A0A1I6MH75      LI-RSGAP-ITGLVLNAVDLNSPE-----------YYGYYGYSGYSYTSIDSDSWESQKR
E8WVF6          LV-RSGAP-IAGIVLNAVDLNSPE-----------YYGYYGYSGYSYSSLDTAGWDAKSE
A0A1H5Z7N3      LI-RSGAP-LAGIALNAVDLNSPE-----Y---YSYYGYYGYSGYGSQGVEHDGWASKSD
A0A1G7JVV8      MV-RSGAP-VTGVVLNSVDINAPE-----------YHGYYGYSGYSYSNIDSESWESN--
A0A1H4T6W9      LV-RSGAN-ITGVLLNSVDINAPE-----------YHGYYGYSGYSYSNIDSESWEAGSN
I3ZEU5          LS-RSGAN-VTGVLLNSVDITAPE-----------YHGYYGYSGYSYSNIDSESWESGST
A0A428MDU2      LL-RSGAP-ITGIVLNAVDLSSPE-----------YYGYYGYSGYSYSSVDSESWESQTV
A0A239HDF6      LV-RSNCP-LKGIVLNAVDLSAPE-----------YESYYGYSGDGYANLDNG-WSASFR
A0A1Q3QQB6      LL-RSGAP-ITGIVLNAVDTNSPE-----------YYGYYGYSGYSYSSGDSGSWEPQSD
A0A3N1K1G7      LL-RSGAP-ITGIVLNAVDLNSPE-----------YYGYYGYSGYSYSSVDSESWESQAV
A0A2W0BGU4      LD-GANAR-LLGVALNKVHMRHDG--------------YYGSYYSGYHA-----------
A0A2W0BVQ9      LD-GANAR-LLGVALNKVHMHHDG--------------YYGSYYSGYHA-----------
A0A3D1ASD2      LH-RLRAN-VVGLVLNEVRKEMSD-----S---YHYYGNYGKYYRAENEKRAS-------
A0A2N9MK30      LQ-RLRAN-VVGVALNEVTKDIGD-----S---YYYHGYYGKYARYYNHKTETA------
A0A2V9MN96      LL-QVNAR-VMGVVLNAFNFRSTD-----D---NYY--YYGSKYSGSYYQQPEENDRGAY
E8UZE1          IV-SVRGR-VAGVVLNDVKTSSEA-----Y---YAYY-GNQDGGAAYYAEAENA------
A0A2V7V2Z1      VR-ETGTR-LLGVVLNRAQVEKHS-----Y---YYGR-YYGHYYGHYYSSAPSRP--VAG
A0A2V7X2F7      IK-ESGAR-LLGVVLNRARVQQHG-----Y---YYGR-YYGHYYGHYYGHYGQQTEAPNR
A0A2V7V2I1      VK-DTGAR-ILGVVLNRVPMEQNA-----Y---YYSH-YYSHYYGHYYDDQHPKR-QDEP
A0A2V7U3M2      VH-ETGAR-LLGVVLNRAQVEKHS-----Y---YYGR-YYGHYYGRYYGAPAPRP-AVAR
A0A2V7UHT0      VK-ETGAR-LLGVVLNRAQVEKHS-----Y---YYGR-YYGHYYGRYYGSPPAQT-APAR
A0A2Z5FVL3      LRAQLGTNRHIGVVLNGVERTADA-----Y---YKY---YGFSNSTYYTNTKRLGGGSEI
A0A1V6HR88      LQ-VAEVK-VLGAVFNRFRVGGGP-----Y---RKGYAAYQTYAGYGEERSGGEVAAR--
A0A3E0P0A3      LT-RAGAP-MLGTVFNAYKARPGR-----Y---GGRYQSYGYGYGYGAYGDVELQDDVA-
A0A2V9KBD6      LF-KVNAP-LTGFVLNGAQLDSAD-----F---RYYHSYYSPDQSKRLGNAA--------
A0A2W0AJ66      LL-RVNAH-LTGFVLNAAELSSSD-----F---RHYYGYYSQHETNRPDAVA--------
A0A1Q7RBU1      LL-KVNAH-LLGFVLNGAGLSSSD-----F---QYYYGYYGQDQSKRLGKGT--------
A0A2V9JPV9      LL-KVNAR-LLGFVLNGAGLSSSD-----F---QYYYGYYGQDQSKRLGKGA--------
A0A2V8EXP2      LS-HARPK-FLGAILNRVDLQHQG-----Y---YYSH-YYRREYAGYYTQDSSKLPAAS-
A0A2W4RYA1      LA-RAGAR-VIGGVLNRVDLDRNP-----Y---YYSA-YYSREYTRYYVPAERARSSSS-
G8P0Y7          LH-SVNAD-VLGVVVNAADLGSPD-----Y---YHYGGRSGYYAANKMKSQEMKPGEARD
A0A3D4VGU2      LR-RANAR-ILGSVVNGVDMRLEN-----Y---YTYSRGYSYGYRSGYESAYGAGYGVED
C1F294          LR-RANAR-ILGSVVNGVDMRLEN-----Y---YTYSRGYSYGYRSGYESAYGAGYGVED
A0A3P0X3W6      LN-RLDVR-ILGLVLNKVRREMSS-----T---YQHFGVYGQYDERVLNAS---------
A0A1E3Y9R6      LR-SANAR-FIGAVLNRVNIQRHA-----Y---YYSP-YYRKEYGKYYQRSPNRA-----
A0A2W4TLP2      LR-GANAK-FIGAVLNRVNVQRHS-----Y---YYSP-YYRKEYGKYYQRAANRA-----
A0A3R9WF43      LI-RTHAP-ALGFVLNGVHNPSLD-----G---FH---DYSYLREKGSETHADA------
A0A317HKM4      LD-AVGAN-VVGAMLNGVVLDQPG-----R---SYLP-YYHREYPAYYCEQTGSSWIPKL
A0A2W0C122      LN-QANIP-VLGIVVNGVSPRSSG-----S---YYYG-YYPQLAKGYYTNSPQV------
A0A2W0AUU7      LN-QANAP-VLGIVVNGVSSRSAG-----S---YYYG-YYPQLAKGYYGDSPQA------
A0A2W0BQL1      LN-QANAP-VLGIVVNGVSSRSAG-----S---YYYG-YYPQLAKGYYGDSPQA------
A0A3P0XH15      MR-RVNSR-VQGIIVNDVDLRLEN-----Y---YTYSKRYNYSYNSTYGAGYGGGMDAEQ
A0A3M1WQW8      LE-DVNAK-IFGVVLNRMDVGQDG-----Y---YYY--YYRYYYADEDPRDESPMVEG--
A0A3N1JHC1      LA-EDGTY-IVGTILNDYDLRNEK-----S---SHY--SSYLTYVGNSSA----------
A0A2V9KA79      FH-ATN---ILGVVLNDVDVDHTR-----Y---A-Y--AYRYYQKNYATKTPA-------
G8P085          LR-HTNAQ-VAGVVINDMAVTQTG-----Y---------YGGYGSGYYN-----------
Q1ILD9          LL-HDGIR-VAGVILNMYNPAGD----------------YGYYGSNYYSYYHEGEGVKAD
Q1IJZ6          LR-RNKAP-LRGLVLNAVNTKGTD----------------YYYSHGYYGYDSYGSNGNA-
A0A2V8TCE6      LR-QVSAR-LLGVVLNNAAESGRS-----Y---GRY--RYRY----------EPSADSGA
Q1ITG0          LA-KVRAN-VVGLVVNDF---DAK-----A---KYY--GYSYSYDKYYVEDKTETTVNN-
A0A3N5PCI5      LE-TAGAT-FAGAVLNAVTLDRDH-----Y---YNS--RYYLPFYGDYLTDKRSA-----
A0A3M1Q0S9      LR-SGRVPHVLGVVLNAVHVEHVP-----------Y--QYRYYRSGYK---QAGTDSAQA
A0A3M1VZ38      LE-KGRAT-ILGAVLNAVETEHVP-----Y---Q-Y--RYYRY-----------AADDES
A0A3M1PY35      LR-KIKAP-LLGAVLNDEAGDDAS-----G---SYY--RYRHYKRGYYAKARAAAAEDAG
A0A3M1VMP2      LA-KVNAR-ILGTILNCEVTEDVT-----G---SYY--RSYRYRKGYY---RRPAEEEGE
                           .  ..                                            

A0A2V7YYV7      APTSSSGT----------------------------------------------------
A0A2V7Z0J5      PSRSARNA----------------------------------------------------
A0A2V7Z3M4      HRAASN------------------------------------------------------
A0A3M2D9H8      ED----------------------------------------------------------
A0A399Y5V2      GRRSKDSGGARAAQTAGSR-----------------------------------------
Q01X01          ------------------------------------------------------------
A0A2V7VMF7      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A192WQ77      ------------DGERKKKRKKSDKDLKVGAGA---------------------------
A0A1Q7RLS4      SSSIAAVTTPDTEDQDRVTRIVG-------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------AQ----------------------------------------------
A0A2V9R9V4      ------------AKRTKT------------------------------------------
A0A321LE75      ------------SVK---------------------------------------------
A0A2V8R8U7      ------------DESDVQGGADAGQNSRAASS----------------------------
A0A2V8QMP4      ------------EEAAPEGAAAAAEAGGGRGV----------------------------
A0A2V8R4S3      ------------EEAAPEGAAAAAEAGGGRGV----------------------------
A0A2V8NJ55      ------------SEEDEEMAAEGARAE---------------------------------
A0A2V8Q7I0      ------------AESGGDSARESA------------------------------------
A0A2V8S6K4      ------------DADEEETSGPAQARAGGQP-----------------------------
A0A317I2L9      ------------DADAGASTGETA------------------------------------
A0A2V8LLF9      ------------NSDEETAKDGDARAASV-------------------------------
A0A352FRF4      ------------YAAEEQPATDQGDATNT-------------------------------
A0A2V8MKV0      ------------YSDDD------GKKAQTASG----------------------------
A0A2V8PYY8      ------------YSDDD------SKKTQAASG----------------------------
A0A1Q7YKQ8      ------------NSDDE-PDVEAASAGESRTS----------------------------
A0A352F3R7      ------------AEGEDKPEAVPGETAQS-------------------------------
A0A0B6WXT1      ------------DEEED-ERDLPEGAAERGAH----------------------------
A0A3B9MEU8      ------------ADGDK-PEEVPGEPAETR------------------------------
A0A2V8MHG6      ------------AETEPHKISTS-------------------------------------
A0A2V8P7N1      ------------ADIQPTEISPSTADS---------------------------------
A0A2V8M3M6      -------------DIQPTEISPSTADS---------------------------------
A0A1Q7NJH5      ------------ADTQPAEISPSTVDS---------------------------------
A0A2V8PJY0      ------------ADTQPAEISPSMVDS---------------------------------
A0A1Q7Y6W9      ------------SENKVAPEAQG-------------------------------------
A0A2V8NC68      ------------VEADVDTAA---------------------------------------
A0A399WK13      ------------SDDEA-------------------------------------------
A0A352FLX4      ------------AETTADQQ----------------------------------------
A0A2V8RTL7      ------------HTDEGE------------------------------------------
A0A3E0PCJ6      ------------DDPEAADEA---------------------------------------
A0A3M1S4R8      ------------KEEEEE------------------------------------------
A0A1Q7YFI6      ------------EEEISSDVSTINQ-----------------------------------
A0A136KC10      ------------SGDDA-------------------------------------------
A0A2V8SEX6      ------------PSDEQ-------------------------------------------
A0A3M2D6Y5      ------------KEEEK-------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------SDGDDDIEPTSHARRNGSHNTLDLN-----------------------
A0A352EX26      ------------SDLEADMPAPPPPASASSTLDLR-------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------HDVESDGADERASA----------------------------------
A0A2V8PWS6      ------------HDVESEPGERAASA----------------------------------
A0A2V8LCT5      ------------ADEAEEAKSVAAS-----------------------------------
A0A352FTJ9      ------------QETAEEVAATRS------------------------------------
A0A2V8G155      ------------YRSERTAS----------------------------------------
A0A2V8HDM7      ------------YRSERTAS----------------------------------------
A0A2V8DRT9      ------------YIKGANTKSADAKSA---------------------------------
A0A2V7VYF3      ------------YGAPAHD-----------------------------------------
A0A1F2SVH2      ------------YQNEGSART---------------------------------------
A0A2V8AJG9      ------------YSRTA-------------------------------------------
A0A2G6PYV5      ------------TPDDPTG-----------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      GAGPPAANSGGVGTRAARVAAATAAKAASVAATVGSRLVRRTAESASGTLQPGLRTRGDI
A0A1F2T595      GGTVAEPVVARPAAASILGGAGAGARAARVAASAGTSFTRRTLASVFRSVQSGVRSAQNF
A0A2V8JQV5      ------------VHKETEEVKS--------------------------------------
A0A2V9AC41      AFGNGNGALSHRVNRHSPATPEPAARKQRSNGLPAGFIDSVGSKLAEAMGPMATLVLDDH
A0A2V8K4L4      ------------NDLEAVVGDSKESSGKQAVGSRDL------------------------
A0A2V8NCZ3      ------------NDLEA-VSNSKDASG---------------------------------
A0A2V9MAM9      ------------SWKNAET-----------------------------------------
A0A2V9M454      ------------YKYKAYYREEDRSSGRS-------------------------------
A0A2V9IVR7      ------------Y--------YYGARSGR-------------------------------
A0A2V9ILE2      ------------Y--------YYGARSGR-------------------------------
A0A2V9LGY4      ------------Y--------YYGARSGR-------------------------------
A0A2V9J4D6      ------------S--------DYNSYSLRPPE----------------------------
A0A2V9L9C5      ------------S--------DYNSYSLRPPE----------------------------
A0A2N9M9N1      ------------QEPSASKTPDLYSAGDR-------------------------------
A0A2V9JEC4      ------------K-PPTSDVLDSGNGSSG-------------------------------
A0A2V9LPQ3      ------------K-P------DNGESASP-------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------GEHANA------------------------------------------
A0A2V7UGP8      ------------YESGPDRSEATGPAPPPAV-----------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------EDEQANNGSLHLE-----------------------------------
A0A2V8IYW3      ------------KSR---------------------------------------------
G2LEI9          SGPKPPPSASEVFEQLKVALDEQQAADDRVPPAPDASPAGNSSNNGHKAG----------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------EESEP----KAGSAA---------------------------------
A0A2V7Z0V0      ------------EESEPRAAGKAGSAA---------------------------------
A0A2V8GFD4      ------------TSYAVSPGSQPSSAR---------------------------------
A0A2V8HSS5      ------------TSYAVSPGSQPSSAR---------------------------------
A0A2V8KP55      ------------GHITHDENVENRS-----------------------------------
A0A399WNU1      ------------RQLEPPDLDQGDGNVLHL------------------------------
A0A2V9CG11      ------------GGVSQRGGIAGDEG----------------------------------
A0A2V2R0I6      ------------GPQEAMGGPHD-EDSEPPEERPFR--DG-DEDSQVL------------
A0A2V8XAR9      ------------GPQEPGETFHS-EHSESVAEAVIQHYDD-EDDTQAL------------
A0A2V8VZA0      ------------GPQEAVEAPHE-EDSDAIAHRVSR--DR-DDDSEAL------------
A0A1Q7CB82      ------------GPQEAVEAPHE-EDSDAIAHRVSR--DR-DDDSEAL------------
A0A2V8WIU1      ------------GPQEAVEAPHE-EDSDAIAHRVSR--DR-DDDSEAL------------
A0A1Q6Y9F5      ------------GPQEALDAPHE-NESDAIAHRVSR--DR-DDDSEAL------------
A0A2V9EVV8      ------------GPQEALEAPHE-NESDAIAHRVSR--DR-DDDSEAL------------
A0A2V8YF91      ------------GPQEVTETAQG-EASDAAEEAASR--RH-DDDSQAL------------
A0A2V8XZK2      ------------GPQEAGEPAQGDDASESVTEALSR--HH-DDDSQAL------------
A0A2V8ZTX6      ------------GPQETGESVQA-EASESVSEVVSR--HQ-DDDSQAL------------
A0A2V9BT79      ------------GPQETGDAAQG-EILESASEAISR--HHDDDDSQAL------------
A0A1Q8B793      ------------GEPQAGELPAS-TEQDAISRRRPP--EH-EDDTQAL------------
A0A2V9BCA0      ------------GEPQAGELPAS-TEQDAISRRRPP--EH-EDDTQAL------------
A0A2V9BWU9      ------------GKEKDGAFERH-HQS---------------------------------
A0A2V9DKX2      ------------GKEKDGAFERH-QQS---------------------------------
A0A2V9JSI3      ------------LTDEEQSAVKS-------------------------------------
A0A2V9WI32      ------------EDPPQNGTSAAGKAS---------------------------------
A0A2V8IVN9      ------------AKTGSA------------------------------------------
A0A1F2TPT3      ------------GAASA-------------------------------------------
A0A2V8JTQ2      ------------TKLFVDE-----------------------------------------
A0A2V8UZY0      ------------QTKSLGEGR---------------------------------------
A0A3N5YNR8      ------------DLSSAAG-----------------------------------------
A0A350UEK1      ------------SNQAAS------------------------------------------
A0A350UIQ4      ------------RNQGES------------------------------------------
A0A3N6A5T6      ------------GDKEDAGKS---------------------------------------
A0A1F2Q9L4      ------------AVGASPRA----------------------------------------
A0A1H5SQF5      ------------EDSDA-------------------------------------------
A0A2Z5G448      ------------TNYGGGYGETDAEK----------------------------------
A0A3E0NV31      ------------GTSADG------------------------------------------
A0A3N5M5V0      ------------DLSSAAGSPGAV------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      RVQTLWNRMRVRNGSSNGTRVAPRKASRSRGSKARSQNERPSESGPDLTL----------
A0A2Z5G7H4      ------------GGKHVDA-----------------------------------------
A0A2V9KCS3      ------------GERKSG------------------------------------------
A0A2U3KC61      ------------EESPEDKPTAAASKVS--------------------------------
A0A2V9Y2R7      ------------DGSPQNG-TSAVSKVS--------------------------------
A0A372IT17      ------------GTRT--------------------------------------------
A0A136JPP4      ------------KNRPDDTTPIMDDADVVGQYGNSADSFKP-------------------
A0A399WUJ8      ------------QHRTDDATPIMEDMGPSEPPRDQGSSFRP-------------------
A0A2V9L5B5      ------------GSEGSSRHGNT-------------------------------------
A0A2V9L7I0      ------------PSSGRESEARD-------------------------------------
A0A2V9LK56      ------------YGYGADSEDSTEAGTQNSSDGVR-------------------------
A0A2V9YHT3      ------------DDSTTQKNR---------------------------------------
A0A2V9NGH6      ------------GQDE-------PAIAEEAKATSSGA-----------------------
A0A2V9PYE6      ------------GQDE-------PAIAEEAKATSSGA-----------------------
A0A2V9NL07      ------------DED--------MTGGDSVRAASGSA-----------------------
A0A2V9QD92      ------------DED--------MTGGDSVRAASGSA-----------------------
A0A2V9WPZ6      ------------QEEE-------LDDSDEPKASSTNA-----------------------
A0A2V9ZLH4      ------------QEDEIA-----LDTEDSSKATSTSA-----------------------
A0A2V9RQF1      ------------QEDEVK-----DLEESGAQVTQTSA-----------------------
A0A2V9YDK8      ------------QEDELT-----EDKDGALTASSTSA-----------------------
A0A2V9V8F7      ------------QEEELD-----DSDEP--KASSTNA-----------------------
A0A2V9XGR9      ------------QEEELD-----DSDEP--KASSTNA-----------------------
A0A2V9V3Q5      ------------QEDPP----DPPAEAQKQPQAASGV-----------------------
A0A2V9NWS3      ------------QEDELP-----ESEEAAKRASAGGL-----------------------
A0A2V9USA9      ------------RDDEPSHDGDGEDVEETSPASSTSA-----------------------
A0A2V9XW18      ------------REDSSGREHEEEEEVIEDAPSSSSA-----------------------
A0A3M2BZG9      ------------SDEQLPASTAA-------------------------------------
A0A1Q7N5R7      ------------AVDEDNSTRVARRRMQGVL-----------------------------
A0A3M1SIV3      ------------HDYEENK-----------------------------------------
A0A3E0PHB0      ------------NYYQKDDSTPLMEEVAAEELGEGWIEEIDDEDQNGSGK----------
A0A3M2D491      ------------GSSEKD------DDVF--------------EEKNGKEG----------
A0A357F267      ------------RKSDADSSTPFMDDAA--------------DTKD--------------
A0A353C9L6      ------------RKSEVDTATPLMDDAR--------------NIHNTNG-----------
A0A2V8RQV0      ------------GKAKDDTSTPIMETNG--------------NGHAEESE----------
A0A2V8SJH5      ------------GKSETDLSTPVMEEVE--------------SIHTTKP-----------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------EESPNNKPKAASKIS---------------------------------
A0A2V9KIE8      ------------YGYGYGYGYGKDAEEGDNEAQSPDQNS---------------------
A0A352F549      ------------SRADERSSQSESSSITVVPK----------------------------
A0A3B9MLP9      ------------SQPDDETTESKSSSI--VAK----------------------------
A0A3D5SQ87      ------------SQPDDETTESKSSSI--VAK----------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------KTERHSASEAVRS-----------------------------------
A0A2V9B240      ------------KTKRTPASESVSSHLPG-------------------------------
A0A2V9CBM2      ---------------RSTATKIVSDENFA-------------------------------
A0A2V8XN17      ------------SNRGDPPQETFVPTNLHLPPQQKASD----------------------
A0A2V8WX45      ------------PDARPPLQETFATTDFET-PQQKASD----------------------
A0A1Q6YR79      ------------PNAGSPPQETFVPANFQMPPQQKASD----------------------
A0A1Q7VA32      ------------PNAGSPPQETFVPANFQMPPQQKASD----------------------
A0A2V9EY85      ------------PNAGSPPQETFVPANFQMPPQQKASD----------------------
A0A2V9H8K0      ------------PNADSSSHETVVTANFQMPPQQKASD----------------------
A0A2V9FFE5      ------------LNPDCPSHETVVTANFQMPPQQKASD----------------------
A0A2V9GM43      ------------LNPDCPSHETVVTANFQMPPQQKASD----------------------
A0A1F2RFI7      ------------GYGSGCEEKQA-------------------------------------
A0A1F2RZS3      ------------EHPYARPEANKQDI----------------------------------
A0A1F2USE2      ------------SQENHPPEDHAEQS----------------------------------
A0A2V9C238      ------------SDE-HPSGDSKG------------------------------------
A0A1F2Q9F5      ------------TGE-HPPK----------------------------------------
A0A1F2QQH9      ------------TGE-HPPK----------------------------------------
A0A1F2QXK7      ------------TGE-HPPK----------------------------------------
A0A2V9DEM9      ------------SDE-HPSGDSKG------------------------------------
A0A2V9CYQ5      ------------ST-------ASQIVSDKISLESDSQGALTQSN----------------
A0A2V9BWU8      ------------SNGNGSSNSNGNSHSEMISDSADSWSTLSK------------------
A0A2V8ZG48      ------------S--------NGNSHSEAISDPAEPWNRLSK------------------
A0A2V8Y334      ------------S--------NGNSHSEIISDAEDSWSTLRK------------------
A0A2V9AY68      ------------SNG------NGNSHSEMISEAADSWNTLSK------------------
A0A257VBK0      SGGWKDVFKGKKNRREYPE-----------------------------------------
A0A2V7XDY0      DIAVGNR-----------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      R-----------------------------------------------------------
A0A2V8TLH7      T-SLETVDDQGVEGKVTRIVG---------------------------------------
A0A1Q7ZJT1      SIAAVTTPDTEDQDRVTRIVG---------------------------------------
A0A2V8VC99      SIAAVPTTDAEEK----RSVG---------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A372IRG7      GKDGEE------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A1I6MH75      ------------------AGENPVEGKNGQ------------------------------
E8WVF6          ------------------SGKT--RKRDDR------------------------------
A0A1H5Z7N3      K-----------------RKSKSKEERGGE------------------------------
A0A1G7JVV8      ------------------GRENERNNKGGQA-----------------------------
A0A1H4T6W9      ATPGGGQGKARDGGNRSSGPGEPSGAEGHDGEDRA-------------------------
I3ZEU5          GT----------------GDGGPRNSAAGQGEDKA-------------------------
A0A428MDU2      ------------------SAS--SNGAGGRV-----------------------------
A0A239HDF6      ------------------GKNGRKNRTKGDQA----------------------------
A0A1Q3QQB6      ------------------SRS--KDRRTGETD----------------------------
A0A3N1K1G7      ------------------GDS--SRKAGGTER----------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A2V9MN96      AS----------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      SKV---------------ARIGDKRSAR--------------------------------
A0A2V7X2F7      GKV---------------ASIAAKRGRR--------------------------------
A0A2V7V2I1      APM---------------T----KQATR--------------------------------
A0A2V7U3M2      GKV---------------AHIREKRSAR--------------------------------
A0A2V7UHT0      GKV---------------ANIREKRNAR--------------------------------
A0A2Z5FVL3      S-----------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          LDQ---------------NPESEHDETLHTSS----------------------------
A0A3D4VGU2      TDD---------------KG----------------------------------------
C1F294          TDD---------------KG----------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      PDA---------------AALQGDSTRAAAPPANS-------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
Q1ILD9          RD----------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ADA---------------RRAPFRRAAGLLRMR---------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      RRG---------------AKGARRTAAGGRG-----------------------------
A0A3M1VZ38      RPR---------------RRGRAARAGGQRT-----------------------------
A0A3M1PY35      KEK---------------KRSAS-------------------------------------
A0A3M1VMP2      RAS---------------ARDAAG------------------------------------
                                                                            

A0A2V7YYV7      --------------------------------------------------
A0A2V7Z0J5      --------------------------------------------------
A0A2V7Z3M4      --------------------------------------------------
A0A3M2D9H8      --------------------------------------------------
A0A399Y5V2      --------------------------------------------------
Q01X01          --------------------------------------------------
A0A2V7VMF7      --------------------------------------------------
A0A2V8JK38      --------------------------------------------------
A0A2V9IXG5      --------------------------------------------------
A0A2V9J2P4      --------------------------------------------------
A0A192WQ77      --------------------------------------------------
A0A1Q7RLS4      --------------------------------------------------
A0A2V2R525      --------------------------------------------------
A0A321LPW6      --------------------------------------------------
A0A2V9R9V4      --------------------------------------------------
A0A321LE75      --------------------------------------------------
A0A2V8R8U7      --------------------------------------------------
A0A2V8QMP4      --------------------------------------------------
A0A2V8R4S3      --------------------------------------------------
A0A2V8NJ55      --------------------------------------------------
A0A2V8Q7I0      --------------------------------------------------
A0A2V8S6K4      --------------------------------------------------
A0A317I2L9      --------------------------------------------------
A0A2V8LLF9      --------------------------------------------------
A0A352FRF4      --------------------------------------------------
A0A2V8MKV0      --------------------------------------------------
A0A2V8PYY8      --------------------------------------------------
A0A1Q7YKQ8      --------------------------------------------------
A0A352F3R7      --------------------------------------------------
A0A0B6WXT1      --------------------------------------------------
A0A3B9MEU8      --------------------------------------------------
A0A2V8MHG6      --------------------------------------------------
A0A2V8P7N1      --------------------------------------------------
A0A2V8M3M6      --------------------------------------------------
A0A1Q7NJH5      --------------------------------------------------
A0A2V8PJY0      --------------------------------------------------
A0A1Q7Y6W9      --------------------------------------------------
A0A2V8NC68      --------------------------------------------------
A0A399WK13      --------------------------------------------------
A0A352FLX4      --------------------------------------------------
A0A2V8RTL7      --------------------------------------------------
A0A3E0PCJ6      --------------------------------------------------
A0A3M1S4R8      --------------------------------------------------
A0A1Q7YFI6      --------------------------------------------------
A0A136KC10      --------------------------------------------------
A0A2V8SEX6      --------------------------------------------------
A0A3M2D6Y5      --------------------------------------------------
A0A0B6WWQ6      --------------------------------------------------
A0A3B9MK99      --------------------------------------------------
A0A352EX26      --------------------------------------------------
A0A2V8MM59      --------------------------------------------------
A0A2V8PFE8      --------------------------------------------------
A0A2V8PWS6      --------------------------------------------------
A0A2V8LCT5      --------------------------------------------------
A0A352FTJ9      --------------------------------------------------
A0A2V8G155      --------------------------------------------------
A0A2V8HDM7      --------------------------------------------------
A0A2V8DRT9      --------------------------------------------------
A0A2V7VYF3      --------------------------------------------------
A0A1F2SVH2      --------------------------------------------------
A0A2V8AJG9      --------------------------------------------------
A0A2G6PYV5      --------------------------------------------------
A0A2V8F956      --------------------------------------------------
A0A1F2S1W5      RHL-----------------------------------------------
A0A1F2T595      RIERHL--------------------------------------------
A0A2V8JQV5      --------------------------------------------------
A0A2V9AC41      ILALGESSESFPEAKIEELTKLVSEEILDDSLRVRFEKQMSKEIQKLGEL
A0A2V8K4L4      --------------------------------------------------
A0A2V8NCZ3      --------------------------------------------------
A0A2V9MAM9      --------------------------------------------------
A0A2V9M454      --------------------------------------------------
A0A2V9IVR7      --------------------------------------------------
A0A2V9ILE2      --------------------------------------------------
A0A2V9LGY4      --------------------------------------------------
A0A2V9J4D6      --------------------------------------------------
A0A2V9L9C5      --------------------------------------------------
A0A2N9M9N1      --------------------------------------------------
A0A2V9JEC4      --------------------------------------------------
A0A2V9LPQ3      --------------------------------------------------
A0A348V070      --------------------------------------------------
A0A2Z5G3A3      --------------------------------------------------
A0A2V7UGP8      --------------------------------------------------
A0A239MKT6      --------------------------------------------------
A0A3E0PCN7      --------------------------------------------------
A0A2V8IYW3      --------------------------------------------------
G2LEI9          --------------------------------------------------
A0A317J121      --------------------------------------------------
A0A2V7YW66      --------------------------------------------------
A0A2V7Z0V0      --------------------------------------------------
A0A2V8GFD4      --------------------------------------------------
A0A2V8HSS5      --------------------------------------------------
A0A2V8KP55      --------------------------------------------------
A0A399WNU1      --------------------------------------------------
A0A2V9CG11      --------------------------------------------------
A0A2V2R0I6      --------------------------------------------------
A0A2V8XAR9      --------------------------------------------------
A0A2V8VZA0      --------------------------------------------------
A0A1Q7CB82      --------------------------------------------------
A0A2V8WIU1      --------------------------------------------------
A0A1Q6Y9F5      --------------------------------------------------
A0A2V9EVV8      --------------------------------------------------
A0A2V8YF91      --------------------------------------------------
A0A2V8XZK2      --------------------------------------------------
A0A2V8ZTX6      --------------------------------------------------
A0A2V9BT79      --------------------------------------------------
A0A1Q8B793      --------------------------------------------------
A0A2V9BCA0      --------------------------------------------------
A0A2V9BWU9      --------------------------------------------------
A0A2V9DKX2      --------------------------------------------------
A0A2V9JSI3      --------------------------------------------------
A0A2V9WI32      --------------------------------------------------
A0A2V8IVN9      --------------------------------------------------
A0A1F2TPT3      --------------------------------------------------
A0A2V8JTQ2      --------------------------------------------------
A0A2V8UZY0      --------------------------------------------------
A0A3N5YNR8      --------------------------------------------------
A0A350UEK1      --------------------------------------------------
A0A350UIQ4      --------------------------------------------------
A0A3N6A5T6      --------------------------------------------------
A0A1F2Q9L4      --------------------------------------------------
A0A1H5SQF5      --------------------------------------------------
A0A2Z5G448      --------------------------------------------------
A0A3E0NV31      --------------------------------------------------
A0A3N5M5V0      --------------------------------------------------
A0A2V9AEW6      --------------------------------------------------
A0A2V8WQK6      --------------------------------------------------
A0A2V8XIF4      --------------------------------------------------
A0A3N5XQP8      --------------------------------------------------
A0A2Z5G7H4      --------------------------------------------------
A0A2V9KCS3      --------------------------------------------------
A0A2U3KC61      --------------------------------------------------
A0A2V9Y2R7      --------------------------------------------------
A0A372IT17      --------------------------------------------------
A0A136JPP4      --------------------------------------------------
A0A399WUJ8      --------------------------------------------------
A0A2V9L5B5      --------------------------------------------------
A0A2V9L7I0      --------------------------------------------------
A0A2V9LK56      --------------------------------------------------
A0A2V9YHT3      --------------------------------------------------
A0A2V9NGH6      --------------------------------------------------
A0A2V9PYE6      --------------------------------------------------
A0A2V9NL07      --------------------------------------------------
A0A2V9QD92      --------------------------------------------------
A0A2V9WPZ6      --------------------------------------------------
A0A2V9ZLH4      --------------------------------------------------
A0A2V9RQF1      --------------------------------------------------
A0A2V9YDK8      --------------------------------------------------
A0A2V9V8F7      --------------------------------------------------
A0A2V9XGR9      --------------------------------------------------
A0A2V9V3Q5      --------------------------------------------------
A0A2V9NWS3      --------------------------------------------------
A0A2V9USA9      --------------------------------------------------
A0A2V9XW18      --------------------------------------------------
A0A3M2BZG9      --------------------------------------------------
A0A1Q7N5R7      --------------------------------------------------
A0A3M1SIV3      --------------------------------------------------
A0A3E0PHB0      --------------------------------------------------
A0A3M2D491      --------------------------------------------------
A0A357F267      --------------------------------------------------
A0A353C9L6      --------------------------------------------------
A0A2V8RQV0      --------------------------------------------------
A0A2V8SJH5      --------------------------------------------------
A0A2V9QB26      --------------------------------------------------
A0A2V9VYY4      --------------------------------------------------
A0A2V9KIE8      --------------------------------------------------
A0A352F549      --------------------------------------------------
A0A3B9MLP9      --------------------------------------------------
A0A3D5SQ87      --------------------------------------------------
A0A2V8NW86      --------------------------------------------------
A0A2V8ZHL8      --------------------------------------------------
A0A2V9B240      --------------------------------------------------
A0A2V9CBM2      --------------------------------------------------
A0A2V8XN17      --------------------------------------------------
A0A2V8WX45      --------------------------------------------------
A0A1Q6YR79      --------------------------------------------------
A0A1Q7VA32      --------------------------------------------------
A0A2V9EY85      --------------------------------------------------
A0A2V9H8K0      --------------------------------------------------
A0A2V9FFE5      --------------------------------------------------
A0A2V9GM43      --------------------------------------------------
A0A1F2RFI7      --------------------------------------------------
A0A1F2RZS3      --------------------------------------------------
A0A1F2USE2      --------------------------------------------------
A0A2V9C238      --------------------------------------------------
A0A1F2Q9F5      --------------------------------------------------
A0A1F2QQH9      --------------------------------------------------
A0A1F2QXK7      --------------------------------------------------
A0A2V9DEM9      --------------------------------------------------
A0A2V9CYQ5      --------------------------------------------------
A0A2V9BWU8      --------------------------------------------------
A0A2V8ZG48      --------------------------------------------------
A0A2V8Y334      --------------------------------------------------
A0A2V9AY68      --------------------------------------------------
A0A257VBK0      --------------------------------------------------
A0A2V7XDY0      --------------------------------------------------
A0A350UQT3      --------------------------------------------------
A0A2U3JZ71      --------------------------------------------------
A0A2V8TTB0      --------------------------------------------------
A0A1F2TCR2      --------------------------------------------------
A0A2N9LQU7      --------------------------------------------------
A0A2P6WFK7      --------------------------------------------------
A0A1F2V330    &nbs