BYKdb

Dataset for cluster cd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I0UTA5      MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKVYAASASGYVTIGSGGTIDVLSG
Q1AUN8      ------------------------------------------------------------
                                                                        

I0UTA5      SSAAKDRARSYSAIVSSEAVAKIIQEKNPNMGMTVSGIRGSVTASTDENSSLIKVSAHAS
Q1AUN8      ------------------------------------------------------------
                                                                        

I0UTA5      TPEQAQVLANSALHATAEYIKNIEGNNGGSGNAANSNGGNNATPNTENGNTAGASASANT
Q1AUN8      ------------------------------------------------------------
                                                                        

I0UTA5      AVSGNAANNIRVIPLDNASINPPLVSPNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRIRT
Q1AUN8      -----------------------------------------------MVVRTSLRRRARE
                                                           :.:* *: .* * 

I0UTA5      RDDAVKATGSSILGVLPTSDDLTEENIVTGSSNDHIAQESIRQLRTNLRFVNIDEPPRSF
Q1AUN8      EQRKGDLSG----------------RLITLHDPSDPASEAYRTLRTGLLYAVVDAPPRVI
             :   . :*                .::*  . .  *.*: * ***.* :. :* *** :

I0UTA5      LVTSAVPSEGKSTVSLSLARSMAESGQAVILIDADLRRPTLAKKLNVDAKVGLTQVLAGQ
Q1AUN8      SLTSPGPTEGKSTVCANLGVVLAQANKRTLLIDGDLRRPSLHAVFDLRNINGLVNAITGE
             :**. *:******. .*.  :*::.: .:***.*****:*   :::    **.:.::*:

I0UTA5      VDIAEAVYQLEESNLFVLTAGRIPPNPSELLGSDKMRQLVRELSEEF-VVVLDAPPLLPV
Q1AUN8      RGLSEVLSE-PLPNLRVCTSGPVPPNPAELLSSNRFAALVEEARQGFDYVLIDSPPVEPV
             .::*.: :   .** * *:* :****:***.*:.:  ** *  : *  *::*:**: **

I0UTA5      TDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLNKVNANLFGLVLNRAPRKGLGNSYYG
Q1AUN8      ADPLILATHADGVLLVLDAQRTRKGALRKALHDLRGVKANVLGTVMNNFDGKRGGYAYHG
            :*. :*:  .***::* .  .:..  : :* ::*. *:**::* *:*.   *  * :*:*

I0UTA5      FGYANSYVGYATYYGYSKDGTKKKVKSRKKAKK
Q1AUN8      YTR------------------------------
            :                                

© 1998-2019