BYKdb

Dataset for cluster orphancd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

184 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A1H6WL79      -----------------------------------------------------------M
A0A1Q2CI19      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      ------------------------------------------------------------
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A351ETF8      -----------------------------------MSAAVVGVRPVNVAELQHVRGSFCM
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      MEAVCLFCWQLWQGSQLERTSRWRGGSSWGQRRKACGSSLRVVRVSAEVRGGVHLLEAHR
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
S3X7T8          ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1Y4CKD6      ---------------------------------------------------MNDRRYGLD
A0A0Q7KBQ4      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      -------------------------------------------------------MPQQD
A0A359IQX7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A2I1VJQ6      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A448PRK6      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1N5CK61      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A2N3R006      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      ---------------------------------------------------------MYV
A0A1L2ZMQ6      ----MPIDEDQRQGEGLRILMAVVRRFWPVLLIATLVGALCGFGWAALQPKM------YQ
A0A0Q5M6Z7      ----------------MRDFVQLLRRYWVGELAIVMLTVGLVAALTAVQPRV------YE
A0A3L7ADK2      MDAETNPDIVNDNDRSLRDFVRMIRTYWMGALLIIALSIASGAVWTLFQPQV------FE
A0A0G3V3M7      --------------MRPADYLRIVRRRWWVLLVTVVIAMTFALLTRPSSAAT------AK
A0A1H6WL79      ERTTQLLQDDKPQGMSGNDLLSVVRSHWLGILVITVLMTGGSLGWYALQPKV------YA
A0A1Q2CI19      --------------MSLKDFLSILRHRWLVIVLCVLIAAGVVFAITPAERDVSPRIGSYT
W6JTW4          --------------MPLREYLRILLHRAPLIAGATVVAGLLSWFLVPAGTQNAPR--SYT
A0A0A0JTY0      --------------MTLQDYFKVFRHRWIIIVICALVAGAITWFITPASSDTTKKVGSYT
A0A0A0JXF2      --------------MTLQDYIKVFRHRWIVIVLCAVIAAGVTWLVTPASADTTKKVGSYT
E6S8H2          --------------MTLSEYLKVFRQRWLIIAITTLVAGAVMWVTSPAVADTSQKASSYT
A0A0A0JGH0      --------------MTLQDYIRIIRQRWIVIVICAAVAGLVTWFLTPANASSVKDAPSYT
N0E4U7          --------------MTLRDYLTIARRRWPIIVACALVAAAVTWFLTPAQTDEAEVAPSYT
A3TMH6          --------------MTLNDYLKAFRRRWLVIALCAVVAGAVMWTVTPAHPEVTRSTGSYT
A0A0A0IYK2      --------------MTLQDYIKVFRHRWMVILVCALVAGAVTWFVTPASADTTKKVGSYA
A0A0Q9L0H3      --------------MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYT
A3TMK0          --------------MTLQDYIKVFRHRWPVILICALVAGAATWFITPASSDTTKKVGSYT
A0A3E2DN22      --------------MTIVDVVRILRRNLALLVICTLAGGLLGAVYQLTRSET------FT
A0A3Q9ULZ9      --------------MTVIDFVRLLRRNLLLLVICGVVGMGAAAAYVFTRPVQ------YV
A0A3S9JFL2      --------------MTVIDLVRLLRRNLALLLVCGLVGIAAAAAYVFTRPVQ------YV
A0A0Q5JKD6      -------------------MVRVVRAYWKAIVALIVVGGLAGLGWSSLQPRV------YT
A0A0Q9TBP0      -----------------------------MALLVLLAAVAVSCAYSLAATPL------YI
A0A346XTB0      ---------MEEQLRRGPSLLESLWRYRVVVAGVTLFMGLLGYVVGLQEDVR------YV
A0A2W6DK08      --------------MGIKDYLTALQRRWPVVVVAGLLGLLIGYLVAPGAANQ------LS
A0A2S0LQ32      -----------------------MKVNAVFIICCVVVGGLLGFGYAKTQPKL------YQ
A0A2N6V1R5      ----------------------MTRVNLGFLILCVLLGLAGGFGYASAQPWT------YT
G9PHS6          ----------------------MTRVNLGFLILCVLLGLAGGFGYASAQPWT------YT
U1PLM7          ----------------------MTRVNLGFLILCVLLGLAGGFGYASAQPWT------YT
A0A351ETF8      AEQPSNQDSSSLAVLDLRAHLAIVRKYWWFTVLVVVCAVAVAFLLTQRQERI------YS
A0A349B7N2      ------------------------------MVLGLTLGWVTTPSSAGPDEPD------YY
A0A346Y185      SGRLNPMDSLQAPATSVEALVGVLRSSIGRILLVGVAAGLLGFGLSALQSLR------YT
A0A259S8H9      ----------------MLDLFTILRRGWLYLAAGLLLGALAGFGYAQTLAPV------YT
A0A0Q5L115      -MDRPDTEPRPRTL-DLQDYLRIVRSYWLGAFLIVLLGVTAGAGWTLTQTRV------YE
A0A2W1Z497      --MAPDARPDERTSRTLADYVRMFRTYWFGAVLIVLACVAAAGAWTLTQPRV------YT
A0A1H6YPK1      --------------MEFRDYLDVLRSRWLSIAVCTLVVGAVAYLWSDMQPRV------YS
A0A2R7MGI0      ----------------MQRVVRILRAYWKTIGALLALGALAGLGWSALQPRV------YT
A0A2T7WQY4      --------------MDMQRVVRILRAYWMTIGALFALGALVGLGWSALQPRV------YT
A0A1G6GTN3      ----------------MQRVVRILRAYWKAIVALIATGALAGLGWSSLQPRV------YT
A0A1N7DLV3      ----------------MQRVARILRAYWKAIVALTLAGGLAGLGWSALQPRV------YT
A0A1V2NSB5      ----------------MQRVARILRAYWKAIVALTLAGGLAGFGWSALQPRV------YT
A0A0Q5Q5L3      --------------------MRILRAYWKAIVVMTVLGGLAGLGWSATQARV------YS
A0A0Q6DVM4      --------------------MRILRAYWKAIVVMTVLGGLAGLGWSATQARV------YS
A0A1R3WWR6      ----------------MQRVVRILRAYWKAIVALTIAGGLVGLAWSAVQPRV------YT
A0A2S5UYV0      --------------MTVLDFLRLTGRSWRTLLIGVAIGLLAAFGYTQVQPHV------FT
A0A2S5ULV5      --------------MTVLDFLRLTGKSWKILAIGVIVGLLAAFGYTQIQPKV------YE
A0A2S5X9U6      --------------MTVLDFLRLTGKSWKILAVGAIVGLLAAFGYTQIQPKE------YE
A0A3Q9IY80      --------------MELRTYLRILRAHWLGLIVLVVVGVVSAFGWTLLQPKV------YS
A0A0F0LP73      --------------MTVLDFLVLIRRGWFFLALGLLFGALGGFVTAQLTPPV------YT
A0A1F1X071      --------------MTIEDFLRLLLRNLLLLVAGLVLGAATGYGLSFTQSTT------YS
A0A3R8RWC7      --------------MTIEDFLRLLLRNLLLLVAGLVLGAAAGYGLSFTQSTT------YS
E3B8H1          --------------MTILDLVRIIRTNLKLLLLSMLLGIVVAAGYTLTRPVE------YQ
A0A0Q5AWK6      --------------MTVVDFIAFIRRNWKALVVAVLVGVTAMAAFSFVTPKV------YE
A0A3N1NLD3      --------------MTVVDFIAFIRRNWKILVVAVLVGVSAMAAFSAVSPKV------YD
A0A3N2FVI8      --------------MTVVDFIAFIRRNWKIIVVAVLVGVSAMAAFSAVTPKV------YD
A0A2S5XDQ6      --------------MTVVDLIAFIRRNWRTLVGAVLVGALAMAAFSFLTPKV------YE
A0A2S5XNN6      --------------MTVVDLIAFIRRNWRTLVVAVLVGALAMAAFSFLTPKV------YE
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
S3X7T8          --------------MVL-------------------------------------------
A0A261FE22      ----------------------------------------------------------MA
A0A0J6YE86      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A1E4BP96      ---------------------------------------------------M------YT
A0A151BT98      --------------MTIRDFLRIMRQRWRWLLGTLLVVLAVAAVSTLMQPKT------YE
A0A2Y8ZRF8      --------------MTIRDFLRIMRQRWRWLLGTLLIVLIAAAVSTMLQPKT------YE
A0A2R9UAT1      ------------------------------------------------------------
A0A1F1IHY9      --------------MSLSKAMSMLQRHWMILVAAPLIGVLLAGLWVLTQNPR------YA
A0A3L8NYD3      ---------MEAARVTVVDFVRLTRVNWRVIFATFSLGLVAALLYTLHQPVV------YT
A0A1Y4CKD6      LSPVRDEEQGLDMAELASNYLRIARRMWWLFLACVAIGVGCLYVASYVSYTP------LY
A0A0Q7KBQ4      -----------------------MRSRWVFSVSTFVVGAVATILLVLSMSPV------YG
A0A2S8WHZ8      --------------------MQVVRAYWRGIIGIFLICILLAFLWTLTQPRI------YA
A0A1Y4CTD2      ---------MVLDGVTVREAARQVAQNWWVVLA---LALATFLGMTGVGKLT------YV
A0A3N3ZPU0      TSDEQYLDAPVHIAHRLRAVARAAGWYWKVALALIVLSVAAGAAIALLMPKV------YS
A0A359IQX7      --MLRVGTLETGRPMTLLDFVRMTRHNAWLLLASVVLGLVAAAGYSLTQPTL------YG
A0A0Q9LZR0      --------------MELTDYLRVARTYWRGLVAFMLLGVAVAGGLSLVTPKV------YQ
A0A1F1J417      --------------MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKV------YA
A0A2A8D6P2      --------------MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKV------YA
A0A448USF4      --------------MTILDFVRTTRANLVLLIAGIVIGAIAGLGYSLLQPKV------YA
A0A1F1QKB0      --------------MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKV------YA
A0A1F0THV9      --------------MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKV------YA
A0A2I1VJQ6      --------------MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKV------YA
D8USQ4          --------------MTILDFVRTTRANLLLLIAGIVIGAIAGLGYSLLQPKV------YA
E3H5W1          --------------MTILDFVRTTRANLLLLIAGIVIGAIAGLSYSLLQPKV------YA
A0A448PRK6      --------------MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKV------YA
A0A433EDP2      --------------MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKV------YA
A0A231VTW0      --------------MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKV------YA
A0A433ECD0      --------------MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKV------YA
U7V3Z1          --------------MTILDFVRTTRANLVLLILGIIIGALLGVGYSLTQPKV------YA
A0A1N7E3F1      --------------MELLRYARLMRRYWPLLLLSVLAGVGTAHVVTVNTAPR------YL
A0A372P1T1      --------------MELLYYARLMRRYWPLLLLSVLAGVGTAHVVTVNTPPK------YL
A0A1L2ZMV4      -MEYTAENQPQALNHQVRRLAHVVLNNWKGAIAIFLLAVLASVGLFLISPKT------YA
A0A1N5CK61      --------------MTVLDFVRMVRVNAKYLLIGMLVGALLGFGYSLLQPKV------YA
A0A2R7Z032      --------------MTFAEFVRLTRAYWWFLVLLTALGAGVMIAKTSREPEL------YS
A0A1I0W453      --MVGGGAPPRLAGMTFGDFVRLSRAYVWVLIGCTILGAALMLAKTTRDPVL------YS
A0A1H4LCS9      --------------MTFGDFVRLSRAYVWLLIGCTILGALLMVAKTTQDPVL------YA
A0A0Q6VV12      --------------MTFGDFVRLTRAYVWVLIGCTVLGALLMMAKTTRDPVL------YS
A0A0Q9QB08      --------------MTFGDFVRLSRAYVWVLIGCTVLGAALMVAKTTQDPVL------YS
A0A1M6K628      MAIARRKPRTGRDILDLVQLWALARRNWLTLLLATILGVAVGAGISYLQPTL------YS
A0A1S1CAD0      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
G5ET14          --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1E9DXX2      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1E8S156      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1E8S5S2      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1S1DFA8      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A2I1Z490      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1F0DAA9      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1F0PHK9      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1F0VZG6      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1E9G8X4      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1E9IAW2      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1E9ZBC9      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1E9ZDP4      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1F0R6B5      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1F0Z7N5      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1F1D897      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
D2NP38          --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1F1FV74      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1E9M791      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A291DEI8      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPRV------YA
A0A1S1D5T1      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1E8TRD6      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1F0XT88      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1F1EVP5      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
C6R548          --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A0K2RXS2      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A1F0KX60      --------------MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKV------YA
A0A2T0UZ65      --------------MTFLDFVRLSRANLLRIVLLVLIGAGLAFAYAQTLPKV------YA
A0A1R4JTI6      ------------------------------------------------------------
A0A0G3V3F3      --------------MDLAAHFRIIARAWKQILIAGVLVAVAMFFWSNRAERV------YE
A0A0Q7QDF6      --------------MTSRSGWTAVARRWPLVVLLGALGLGAAALVLSGQTTR------YD
A0A3S0V9U6      --------------MTLLDFIRLTRANIILLVVGILVGALVGYGTTLIQPKT------YA
A0A261FQA1      --------------MSIADILQMIKKHWIVGLAVLVVSLAVTVCVVQTTVPE------YS
A0A1Q2CJ92      -------------------MWGLLRRGWLVIVASLAVGLALAFALSLTQPVL------YS
A0A2T0S3C8      --------------MDVRDYLRVLRKRWWMLLAGIGVACGLAGILTSQMTPQ------YA
A0A285VUW0      --------------MSVRDLFLAIARRWRGAVAILLLVVAATAFATSRQPQV------FE
A0A444BL03      --------------MTLLDFVRLTRTHLLFLVVLTLAGGAAAYGLTLRMPSV------YL
A0A1C6T1J1      --------------MDLYRQLRLVRRHWWIVLVTLMVALGTTALVTIRSEPR------YV
A0A2W2CFC8      --------------MDPLRQLRLVRRHWWIVLVTLMVSLGVTALVTVRAQPR------YL
R4LD52          ----------------------------------MLAALVLGALVTVQTAPR------YA
A0A2N3YJR1      --------------MTLLDFVRLSRTHLLSLVLLTLLGGAAAFGLTTRLPQV------YQ
A0A2W2A4B0      ----------------MTPLTRALVLRWYFAVGGALLGFVVAIALSSTVTPQ------FR
A0A1H7N9P7      --------------MSLSVFLGLIRRRSSWLVAGVVLAVAVAGVGSLTATRL------YT
A0A1M7V0F8      --------------MTLSAFLGVLRRRSSWLLVSVLVGLTVAGAGSAAATRL------YT
A0A1Q2CRV2      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A2N3R006      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      TSG------------DDSNVQAAYQGSLASQQRIASYA----QLASSDAVISNAVSE-SR
A0A1L2ZMQ6      STSSGLIVTPKSSTVG-----EAIAGNSLAQDRAGSYA----VMASSQRTAERAVEKLEK
A0A0Q5M6Z7      STASGLTQAATGESLS-----MAFAGESLAKSRAESYV----RVANSDAVADRARKIL--
A0A3L7ADK2      AKATGIVQAPRGNDPS-----NAYSSEALSKSQAASYA----TVATSLAVAERVEKAG--
A0A0G3V3M7      ASRPGVSFRATTTLIS-----SGSANTSVNGRDYDRLA----LLMITGEVPKRVAEAI--
A0A1H6WL79      AESSGIVVAAGAENLG-----LSLAGDSLAKSKAKGYQ----SVGESILVAESVIRTL--
A0A1Q2CI19      ATSTLLVGSVGA---------PDAGAGYASLGRVALFI-------TTGEVPRNAAAAL--
W6JTW4          ATAQMTV----D---------GGEERVTVGLPRIAFFI-------TTGDIPQAAADKL--
A0A0A0JTY0      ATATMLVTAKAS---------SAATAVAPNLDRVALYL-------KTGEVPKRAAKKV--
A0A0A0JXF2      ATATILV----G---------STDPERTGNMGRIPLYM-------TTGEIPRRAAAVV--
E6S8H2          ATATLLV---TS---------TETDSESP-MGRIALYL-------TTGEIPQRAAAEL--
A0A0A0JGH0      ATATVLV---SA---------ATADEQVS-VDRVVLYA-------KTGAIPTAAAKAL--
N0E4U7          ATATLLV---GS---------GGPPELVS-IDRLALFI-------KTGEIPSRAAKVL--
A3TMH6          ATATLLV---ER---------T--EDVNSQLGRIALFL-------TTGDIPRGAAKRL--
A0A0A0IYK2      ATATILV---GS---------TDPENPNPNMGRIPLYM-------TTGEIPRRAAAAV--
A0A0Q9L0H3      ATATLLV---GS---------NDPETGSTNLGRIALYM-------TSGEVPKRAAARV--
A3TMK0          ATATILV---GS---------KDPEATGSNLGRIALYL-------TTGEVPKRAAAVV--
A0A3E2DN22      AKATGMVVAGDSTSVG-----EAMSGNAIAQQRAATYT----KLVETRTMAQKTSEIL--
A0A3Q9ULZ9      AQSTAMVVAGDSSSVG-----GAMSGNTIAQQRASAYS----TLIGTEAVDNRVQKTL--
A0A3S9JFL2      AESTAMVVAGDSSSVG-----GAMSGNTIAQQRASAYS----TLVGTAAVDNRVRATL--
A0A0Q5JKD6      ADASGYVAAVASDGSTG----AALAGDQLALSKVKSFI----DMGYWRSVAETARGEL--
A0A0Q9TBP0      ATADVLIEPSGAD--I-----SASSGTKIDADEVATQV----QVVTSLPVSRLVQERF--
A0A346XTB0      AQGTLFLADPNLGDEL-----QGIVSARIS---AEEYVPRQAARIQSRAVLQEAADLI--
A0A2W6DK08      GKGSYVATAT------------VLQAPDVKEAVASTTL-----LVTAEPVAERVSKML--
A0A2S0LQ32      SSAQATIVIAGTD---------AWSANSVAQQKAGVFA----KLAGSAAVAQSVSQSL--
A0A2N6V1R5      ATSQAMVVVPGTD---------AFSQNSISGQKASVYA----VLAGSQNVANRVAKTL--
G9PHS6          ATSQAMVVVPGTD---------AFSQNSISGQKASVYA----VLAGSQNVANRVAKTL--
U1PLM7          ATSQAMVVVPGTD---------AFSQNSISGQKASVYA----VLAGSQNVANRVAKTL--
A0A351ETF8      TSAQVLLRSSENSFLF-----PFPATGPLALNREGEIE--------TLYVTSPAFTEA--
A0A349B7N2      RATHTLVAETGTS--------------------APPNLAQLSLLLRVGDVPERVAAEF--
A0A346Y185      AEADLLLADPRNTG--------LFGETGVNFLDPSRYVRNQAEFAQSNAVAERASVLL--
A0A259S8H9      SQATGFIAATGTA---------VIAGSDEAVARAGAYM----PLINTSQVRDEIAKEA--
A0A0Q5L115      SSASGVVQVAAGGDAN-----LAFAADQLAKSQAQSYV----ELGGSLAVAESAAAAL--
A0A2W1Z497      SGASGFVRVAGNGDAN-----LDYAADQLSKSQAETYV----ELGGSLAVAKRVVRAT--
A0A1H6YPK1      TSAEALVTPAGSL--------DEVGDAATVESRMAVYT----RLATSDQVAAVVAESI--
A0A2R7MGI0      ADASGYVATVSSDGSTG----SALAGDQLALSKVKSFV----DMGYWRSVAEAARQTL--
A0A2T7WQY4      ADASGYVATVSSDGSTG----SALAGDQLALSKVKSFV----DMGYWRSVAEAARESL--
A0A1G6GTN3      ADASGYVAAVASDGSTG----AALAGDQLALSKVKSFI----DMGYWRSVAETARQDL--
A0A1N7DLV3      ADASGYVASVSSDGSTS----SALAGGTLALSRVKSFI----DMGYWKSVAETARDEL--
A0A1V2NSB5      ADASGYVASVSSDGSTG----SALAGGTLALARVKSFI----DMGYWKSVAETARDEL--
A0A0Q5Q5L3      ADASGYVAAVASDGSTG----AALAGDQLALSKVKSFI----DMGYWRSVADTARQQL--
A0A0Q6DVM4      ADASGYVAAVASDGSTG----AALAGDQLALSKVKSFI----DMGYWRSVADTARQQL--
A0A1R3WWR6      ADASGYVAAVASDGSTG----AALAGDQLALSKVKSFI----DMGYWRSVAETARTEL--
A0A2S5UYV0      ANSSGFVMAGPAAEG------GYIGGSEAAIAKAQSYI----PLITSQPVYAKIAENP--
A0A2S5ULV5      ADSAGFVIAGSSGEF------SSIDGSEQAITKANSYL----PLITSQPVYAKIAENP--
A0A2S5X9U6      ANSAGFVVASGNAEL------GYINGSEAAIAKANSYI----PLITSQPVYAKIAENP--
A0A3Q9IY80      ADASG-IVAPVRTELSGNDAGSALVAENLAKAKVGSYL----DLGSWRAVAEHAIAEL--
A0A0F0LP73      AQATGFIAGTGG---------AVIAGTNIAIDRAGAYM----PLVDTAQVREEIAKDA--
A0A1F1X071      ASALGYVSASAQSDENGDPIQQASGNMEFQYSKAQSYL----PLFNTRAVGQRIVDEL--
A0A3R8RWC7      ASALGYVSASAQSDENGDPIQQASGNMAFQYQKAQSYL----PLFNTRAVGQRIVDEL--
E3B8H1          ATSTAQIMAGASNDAS-----AAMVNQQLANQRSGAYA----QLASGSGVADRVVALS--
A0A0Q5AWK6      SSSAGFVIAATDGSSA-----DAISGAQTAVTRANAYL----PLISSSAVYERIQSDP--
A0A3N1NLD3      SSSAGFVIAATDGSSA-----DAISGAQTAVTRANAYL----PLISSSAVYERIESDP--
A0A3N2FVI8      SSSAGFVIAATDGSSA-----DAISGAQTAVTRANAYL----PLISSSAVYERIESDP--
A0A2S5XDQ6      SSSAGFVIAASDGSSA-----DAISGSQTAVTRANAYL----PLISSSAVSERIEADP--
A0A2S5XNN6      SSSAGFVIAASDGSSA-----DAISGSQTAVTRANAYL----PLISSSAVSERIEADP--
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          --------------------SASYQNSLASAQRVASYA----ELVDSDVIVSRALES-TG
S3X7T8          ---------------GGAVGEDGIAGGVLGIGRLHGYF----HPIR------------DG
A0A261FE22      KNSDGAMTT---------------GASNGGSSPLASYA----QLVQSDAVLEPVVNN-LG
A0A0J6YE86      ------------------------------------------------------------
A0A439DNZ6      ---------------------------------MISYT----ELLMGETLAQRTIDK-LD
A0A1E4BP96      ASASGYVSGAS----LAAETGSPLVGDQLARSKVTSYL----DIGSWRAVAEHAIED-LG
A0A151BT98      ASARFYLA-------GSNG-----QGTPVQRDDLATYA----QVVSAPAVQKVIRQQ---
A0A2Y8ZRF8      ASARFYLA-------GSNG-----QGTPVQRDDLATYA----QVVSAPAVQEVIRKQ---
A0A2R9UAT1      -----------------------MLANNLALSKVVSYV----DIGSWRSVAEYAIEK-LR
A0A1F1IHY9      STANALVVVG-----NSESLGVALTADNLAKSKAQQYA----LLGESRAVSDKAVEE-LP
A0A3L8NYD3      ATSKGYVAVD-----SGDSVSDVYSATSLAQQKLSVYV----GLVSSTAVAQDVIDS-LK
A0A1Y4CKD6      RSEATFTI-------TSGDGSSLYSSVSSASQLSKTFP----YVLDSSYFRGVLEDA---
A0A0Q7KBQ4      SSAKLFITS------PVGQQVTDPTAAYFASQRLASYA----DLAREPSLLQDVINRLNL
A0A2S8WHZ8      ATSSGLVIAG-----DSENIGNALAGDNLAKSKAVGYK----SIAGTRTIADLVRKE-LK
A0A1Y4CTD2      PEYTSAATLV-----IRVKGADAYSSLAQASQMTAVYS----EVFQSSALRNEISAS---
A0A3N3ZPU0      STNTVMVVTG-----NSNTLGDYMTADSVSLSKADSYM----QLGGSPEVAQIAAES---
A0A359IQX7      SVSTGIVVAG-----NSNSIGDATAGMVLAEQKAAAYT----ILTGTRQVSQDVADGLRS
A0A0Q9LZR0      ADASGFVSAG-----ASSNPGEASVGDSLAKSRATSYV----DLAKSRATAQDVINT-LG
A0A1F1J417      ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
A0A2A8D6P2      ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
A0A448USF4      ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
A0A1F1QKB0      ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSN
A0A1F0THV9      ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
A0A2I1VJQ6      ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
D8USQ4          ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
E3H5W1          ASASGYVTV------GQSGTIDVLSGSNAAKERARSYS----AIVSSEAVAKIIQEQNSD
A0A448PRK6      ASASGYVTI------GSGGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNPN
A0A433EDP2      ASASGYVTI------GSGGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNPN
A0A231VTW0      ASASGYVTI------GSGGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNPN
A0A433ECD0      ASASGYVTI------GSGGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNPN
U7V3Z1          ASASGYVTI------GSGGTIDVLSGSSAAKDRARSYS----AIVSSEAVAKIIQEKNPN
A0A1N7E3F1      ASITMLVSADA----GDGGLSTALQAGALSQQRVQSYA----ALLTSRQVVGRIAGG---
A0A372P1T1      ASITMLVSADA----RDGGLSTALQAGALSQQRVQSYA----TLLTSRQVVGRIARG---
A0A1L2ZMV4      ATNTVMVVAG-----GGNNLGSYLSAETLANTKAETYL----ALGNAPEVSQLVSKHFAE
A0A1N5CK61      SSATGYVTVG-----ESTGIGDVISGSSAAKDKASSYL----ALVSSGPVADEIVKQNPN
A0A2R7Z032      AGASGIVKVG-----FSSSAGEEMSNQSLASDKAALYV----ALANTTPVAERVVEK-LG
A0A1I0W453      ATSSGLVRVG-----NAATAGEEQGNAQLAEDKANLYA----FLVSKTPVAAQVVED-LD
A0A1H4LCS9      ANASGFVKVG-----NATTAGEEQNNAQLAEDKANLYA----FLVSKLPVAQLVVDD-LG
A0A0Q6VV12      ATSSGLVVVG-----NATTAGEEQGNAALAEEKAGLYA----FLVSSMPVAEKVVDD-LG
A0A0Q9QB08      ATANGLVKVG-----EAGSAAEEQGNASLAEDKANLYA----FLVPTTPVAEQVVKE-LG
A0A1M6K628      ATSVGYVVV-------GNSSTENAGARNPAAEKAATYL----PLAESRSVAETVAQE---
A0A1S1CAD0      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTPE
G5ET14          ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTPE
A0A1E9DXX2      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1E8S156      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1E8S5S2      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1S1DFA8      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A2I1Z490      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTPE
A0A1F0DAA9      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F0PHK9      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F0VZG6      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1E9G8X4      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1E9IAW2      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1E9ZBC9      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1E9ZDP4      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F0R6B5      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F0Z7N5      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F1D897      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
D2NP38          ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F1FV74      ASSSGYVTV------GESGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNPD
A0A1E9M791      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A291DEI8      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1S1D5T1      ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTPE
A0A1E8TRD6      ASSSGYVTV------GESGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F0XT88      ASSSGYVTV------GESGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNTPE
A0A1F1EVP5      ASSSGYVTV------GESGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNPE
C6R548          ASSSGYVTV------GESGTVDVLSGSTAAKERARSYA----AIVSSEAVAQKIKQNTPE
A0A0K2RXS2      ASSSGYVTV------GESGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A1F0KX60      ASSSGYVTV------GESGTVDVLSGSSAAKERARSYA----AIVSSEAVAQKIKQNNPE
A0A2T0UZ65      ADASGYVVTG-----GGQNTGDVFAGSTLAGSKAESYL----PLINSRAVGKRAGEI-IG
A0A1R4JTI6      -------MVTAG---VNENLGIALTADNLAKSKATQYQ----ELATSRAVAEGAVKQ-AG
A0A0G3V3F3      ATALLAVTPSDT---------GLGINADQATFLAKSYA----LYAETPRVTAAAAKS-SG
A0A0Q7QDF6      GSAEVLIQPTSP-------------ATSLSGRAVESYA----HVLGGTALEQRAVKA-LG
A0A3S0V9U6      ATSSGYVTLGKSEDPTTGSAGEILSGDAAAQSKAKAYL----PLITSAPVAQKIASS-SK
A0A261FQA1      ASV--------T---AVTNAQSAAADGSTSDSRMGVVS----RVATSSAVLEPVIDE-LD
A0A1Q2CJ92      ATSAGYVVA--G---NSATVGDAFAGSTLAAEKAGTYL----PLVQSRSVANRIAEE-LA
A0A2T0S3C8      TSVTFFVT---T---PNNGVTDAYQGGLFSQQRVKSYA----TLLTGDRLAKVVAAKTPG
A0A285VUW0      SRTTVYFAATDE---AGESSGNLYQ---MPAGERSTLA----RIARSPLMLDPVRET-LG
A0A444BL03      ADASGYVRID-G---AGASTGESIAANSLGGSKADSYL----PLVTSRAVAQRAITA-TG
A0A1C6T1J1      ASVTFFVT---T---PSEGVAAAYQGGLFLQQRIKSYA----DLLVSDRLAQSVVAE-GQ
A0A2W2CFC8      ATVTYFVT---T---PSQGVSDAYQGGLFLQQRVKSYE----QLLTSDRLARSVVAD-NQ
R4LD52          TSVTFFVT---T---PNTGVTDAYQGGLFSQQRVKSYA----SLLVSDRLAQLVAAE-PG
A0A2N3YJR1      ADASGYVRVT-A---AGSSTGEGIAANALSGSKADSYL----PLVTSRAVAQRAIEA-TG
A0A2W2A4B0      ATSKIWISISGD---AESSALDLAQGTNAAQQRIHSYL----DLVPQPIVLQPVIDE-LH
A0A1H7N9P7      AEARLFFTL--E---YGDSAGDLAQGSNYLQSQVASFA----LLAETPTVLGPAGEA-PD
A0A1M7V0F8      AEASLFFAL--E---YGDSAGDLAQGSNYLQSQVSSFA----LLAGTPTVLGPAGER-AG
A0A1Q2CRV2      ----------------------MQAGSNYAANQVQSFA----KVAKSGFVLTPVIED-LQ
A0A101KZQ4      -------------------------------------------MAKSRSVALDVQEN-LG
A0A1H4I042      --------------------MDTYQGNLLSQERVRSYT----ILLTGEALAQRTIDA-LH
A0A022KX11      ------------------------------------------------------------
A0A2N3R006      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ----------------------------------------------------------MM
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      -------------------------------------------------------MGVVD
R7Y679          ------------------------------------------MFGRSRLGTRIRDEGDLD
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      -----------MAR---------------------------------------SIEVTIP
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      KSI----SSEDVRK---------------------------------------KLSTSWD
A0A1L2ZMQ6      QGVADVPDAGSLIS---------------------------------------SITAAVL
A0A0Q5M6Z7      -GT--DRSIGDLLG---------------------------------------HIQASLP
A0A3L7ADK2      -VV--KQSAGVLLG---------------------------------------RITALQP
A0A0G3V3M7      -DE--VRWPQIQNANANKCTETGADATSPDCKKSGRRVSAGSGQVELGTGGFIKASAIPD
A0A1H6WL79      -GL--KESAPDITR---------------------------------------SISVSVP
A0A1Q2CI19      -GY--EGDPALLAK---------------------------------------QITVETQ
W6JTW4          -KY--ADGPFALAR---------------------------------------RIVVAPD
A0A0A0JTY0      -GY--EGDPAVLAS---------------------------------------GLTVVTD
A0A0A0JXF2      -GY--EGDPARLAA---------------------------------------GLTVTPD
E6S8H2          -GY--TGDPAVLAS---------------------------------------GLTVTPD
A0A0A0JGH0      -EF--EGDPAILAS---------------------------------------QVTITSD
N0E4U7          -SF--DGDPALLAS---------------------------------------QITVTPD
A3TMH6          -GY--PGDPALLAA---------------------------------------GLTVKPE
A0A0A0IYK2      -GY--DGDPALLAR---------------------------------------GLTVTPD
A0A0Q9L0H3      -DF--TGDPALLAS---------------------------------------GLTVTPD
A3TMK0          -KF--EGDPALLAR---------------------------------------GLTVTPD
A0A3E2DN22      -KK--HGMPEAANG---------------------------------------QVSASVP
A0A3Q9ULZ9      -GS--KGLSKAADG---------------------------------------TLAAKVV
A0A3S9JFL2      -NK--QGLSKATDG---------------------------------------TLSAKVV
A0A0Q5JKD6      -GL--SDSPESLVQ---------------------------------------RVRVSNP
A0A0Q9TBP0      -SL---ASPPDLSE---------------------------------------LVSVQAV
A0A346XTB0      -DN--RISVGELGS---------------------------------------NFDIESS
A0A2W6DK08      -NT--HHAPQDLLL---------------------------------------KVTAVAD
A0A2S0LQ32      -GL------QDLGG---------------------------------------SLTGAAE
A0A2N6V1R5      -KT------SNMEG---------------------------------------TLSGSAD
G9PHS6          -KT------SNMEG---------------------------------------TLSGSAD
U1PLM7          -KT------SNMEG---------------------------------------TLSGSAD
A0A351ETF8      -AL--LKSPPE-------------------------------------------VKVAAA
A0A349B7N2      -G----VEPDVLVS---------------------------------------QVQVRQN
A0A346Y185      -GG--RLDSDQVRE---------------------------------------QSRIRPA
A0A259S8H9      -GV--SA--AELHG---------------------------------------SLSARVV
A0A0Q5L115      -GG--AASPASLLG---------------------------------------RVTTSLP
A0A2W1Z497      -GT--SASPQELLG---------------------------------------RVQTRLP
A0A1H6YPK1      -GG----DADALRS---------------------------------------RISVSGS
A0A2R7MGI0      -GV--NDSPESLVQ---------------------------------------RVRVSNP
A0A2T7WQY4      -GV--EDSPESLVQ---------------------------------------RVRVSNP
A0A1G6GTN3      -GL--SDPAESLVQ---------------------------------------RIRVSNP
A0A1N7DLV3      -GL--TDSPESLVQ---------------------------------------RIRVSNP
A0A1V2NSB5      -GL--TDSPESLVQ---------------------------------------RVHVSNP
A0A0Q5Q5L3      -GL--SDSPEALVE---------------------------------------RIRVSNP
A0A0Q6DVM4      -GL--SDSPEALVE---------------------------------------RIRVSNP
A0A1R3WWR6      -GI--TDSPEALVQ---------------------------------------RVHVSNP
A0A2S5UYV0      -AL-GLAEGQALTG---------------------------------------RLSASVA
A0A2S5ULV5      -NS-GLAAGETLTG---------------------------------------RLSATVA
A0A2S5X9U6      -DS-GLAEGETLNG---------------------------------------RLSATVA
A0A3Q9IY80      -GL--TSSPESLVN---------------------------------------RVQVSNP
A0A0F0LP73      -KV----PLSKLNG---------------------------------------SLSAQVV
A0A1F1X071      -GL--EASPDEVAG---------------------------------------SLQTTLD
A0A3R8RWC7      -GL--EASPDAVAG---------------------------------------SLQTTLD
E3B8H1          -KGALSPGDFVLAG-------------------------------------------AGS
A0A0Q5AWK6      -EA--NPGGEALNG---------------------------------------RLTASVA
A0A3N1NLD3      -EA--NPGGEPLNG---------------------------------------RLTAAVA
A0A3N2FVI8      -EA--NPGGEPLNG---------------------------------------RLTAAVA
A0A2S5XDQ6      -EA--NPGGEALSG---------------------------------------RLTARVA
A0A2S5XNN6      -EA--NPGGEALSG---------------------------------------RLTARVA
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          VGL----KQDEAKD---------------------------------------SLSVSTS
S3X7T8          LAH----PSNTLDP---------------------------------------TQPLATA
A0A261FE22      LHT----SVAGLRG---------------------------------------NVSASAS
A0A0J6YE86      --M----SADELQA---------------------------------------RITATAK
A0A439DNZ6      LEM----SAGELQN---------------------------------------KVKASSK
A0A1E4BP96      LSA----SPESLVG---------------------------------------NVTVSNP
A0A151BT98      -AK----LGPSVPV---------------------------------------TVSATLS
A0A2Y8ZRF8      -AK----VGPTAAV---------------------------------------NVNATLS
A0A2R9UAT1      LDS----SPEALVR---------------------------------------RVDVTNA
A0A1F1IHY9      FDL----SSGEALR---------------------------------------NVEVAST
A0A3L8NYD3      LDE----TPSDIAS---------------------------------------RFSAVGD
A0A1Y4CKD6      --L----GTDSLDG---------------------------------------TIEAQTI
A0A0Q7KBQ4      TGV----TREELAG---------------------------------------QVTAQII
A0A2S8WHZ8      LDE----SSDVLLG---------------------------------------KVEVTVP
A0A1Y4CTD2      -------VGEPVEG---------------------------------------SVSCSQV
A0A3N3ZPU0      -------LDGTPVH---------------------------------------DVAFSVV
A0A359IQX7      --K----YGKDVPF---------------------------------------SLSPGVT
A0A0Q9LZR0      LGA----QPAGLIG---------------------------------------SITVTQP
A0A1F1J417      --L----SIGTIRG---------------------------------------SLSATTE
A0A2A8D6P2      --L----SIGTIRG---------------------------------------SLSATTE
A0A448USF4      --L----SIGTIRG---------------------------------------SLSATTE
A0A1F1QKB0      --L----SIGTIRG---------------------------------------SLSATTE
A0A1F0THV9      --L----SIGTIRG---------------------------------------SLSATTE
A0A2I1VJQ6      --L----SIGTIRG---------------------------------------SLSATTE
D8USQ4          --L----SIGTIRG---------------------------------------SLSATTE
E3H5W1          --L----SIGTIRG---------------------------------------SLSATTE
A0A448PRK6      MGM----TVSGIRG---------------------------------------SVTASTD
A0A433EDP2      MGM----TVSGIRG---------------------------------------SVTASTD
A0A231VTW0      MGM----TVSGIRG---------------------------------------SVTASTD
A0A433ECD0      MGM----TVSGIRG---------------------------------------SVTASTD
U7V3Z1          MGM----TVSGIRG---------------------------------------SVTASTD
A0A1N7E3F1      --E----DVADVQA---------------------------------------RITANAI
A0A372P1T1      --E----DVTDLQA---------------------------------------RITADAI
A0A1L2ZMV4      EGQ----AVS--WK---------------------------------------GVTFTKD
A0A1N5CK61      IGM----SAEEIKG---------------------------------------HLTASLE
A0A2R7Z032      LDV----DPGAIAG---------------------------------------RFSASVD
A0A1I0W453      LDV----PPEAIAG---------------------------------------RFSASVD
A0A1H4LCS9      LDV----PPEAIAG---------------------------------------NFSASVD
A0A0Q6VV12      LDV----PPSEIAG---------------------------------------RFSATVN
A0A0Q9QB08      LDM----PPSAIAS---------------------------------------RFSATVN
A0A1M6K628      --------LGVQSG---------------------------------------EVSLDAK
A0A1S1CAD0      LSL----TTGQIRS---------------------------------------SITAAAG
G5ET14          LSL----TTGQIRS---------------------------------------SITAAAG
A0A1E9DXX2      LSM----TTGQIRG---------------------------------------SLTATAG
A0A1E8S156      LSM----TTGQIRG---------------------------------------SLTATAG
A0A1E8S5S2      LSM----TTGQIRG---------------------------------------SLTATAG
A0A1S1DFA8      LSM----TTGQIRG---------------------------------------SLTATAG
A0A2I1Z490      LSL----TTGQIRS---------------------------------------SLTATAG
A0A1F0DAA9      LSL----STGQIRS---------------------------------------SLTATAG
A0A1F0PHK9      LSL----STGQIRS---------------------------------------SLTATAG
A0A1F0VZG6      LSL----STGQIRS---------------------------------------SLTATAG
A0A1E9G8X4      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1E9IAW2      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1E9ZBC9      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1E9ZDP4      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1F0R6B5      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1F0Z7N5      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1F1D897      LSM----TTGQIRA---------------------------------------SLTATAG
D2NP38          LSM----TTGQIRA---------------------------------------SLTATAG
A0A1F1FV74      LSL----TTGQIRA---------------------------------------SLTATAG
A0A1E9M791      LSM----TTGQIRA---------------------------------------SLTATAG
A0A291DEI8      LSM----TTGQIRA---------------------------------------SLTATAG
A0A1S1D5T1      LSL----TTGQIRS---------------------------------------SLTATAG
A0A1E8TRD6      LSL----TTGQIRA---------------------------------------SLTATAG
A0A1F0XT88      LSL----TTGQIRA---------------------------------------SLTATAG
A0A1F1EVP5      LSL----TTGQIRA---------------------------------------SLTATAG
C6R548          LSL----TTGQIRS---------------------------------------SLTATAG
A0A0K2RXS2      LSL----STGQIRA---------------------------------------SLTATAG
A0A1F0KX60      LSL----STGQIRA---------------------------------------SLTATAG
A0A2T0UZ65      SDA----PPEVLAA---------------------------------------RVAGSVA
A0A1R4JTI6      LDI----SPEAASG---------------------------------------AVTATVP
A0A0G3V3F3      LDI----TANDAAS---------------------------------------LISASAV
A0A0Q7QDF6      LED----AGDA------------------------------------------EVRGEVV
A0A3S0V9U6      TSL----DAAAIPS---------------------------------------HLEPSVE
A0A261FQA1      LDT----SVDAMAS---------------------------------------SVSAS-V
A0A1Q2CJ92      LPS----TGPVVGN---------------------------------------LEGSV--
A0A2T0S3C8      LEL----TPAEVRE---------------------------------------RITAEAL
A0A285VUW0      LDA----SVPLSVE---------------------------------------AVPGG--
A0A444BL03      IDA----SPEDVAR---------------------------------------RVTGTVA
A0A1C6T1J1      VGL----TAEQIQG---------------------------------------RVSTSTE
A0A2W2CFC8      LGL----TAEQVRG---------------------------------------RISTSTE
R4LD52          VGL----DARHIRE---------------------------------------RVAAQAV
A0A2N3YJR1      VKA----SPASVAS---------------------------------------RVTASVA
A0A2W2A4B0      LDV----KASELAR---------------------------------------SVSATSP
A0A1H7N9P7      VAA----GSRSLAA---------------------------------------QVSASVV
A0A1M7V0F8      VSA----DARSLAG---------------------------------------RVTATVV
A0A1Q2CRV2      LSV----TPEQLAR---------------------------------------RVAVTIP
A0A101KZQ4      IDT----SINQLLS---------------------------------------SISIANP
A0A1H4I042      LDM----SARALRQ---------------------------------------EVSARSK
A0A022KX11      ------------------------------------------------------------
A0A2N3R006      --------MAQLKE---------------------------------------QVSVTNP
A0A255G8R8      ------------------------------------------------------MTTTVP
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ------MSRDAAAS---------------------------------------ALSVHNV
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      --------------------------------------------------------MKRK
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------LD---------------------------------------KERR---
A0A1X6Y1L5      -------MRKTKIK---------------------------------------DKKR---
A0A1U3QN81      --------MGFRKK---------------------------------------KSRR---
A0A1M8I0C2      --------MAFKKE---------------------------------------KKAKVSD
A0A1U3NFN6      --------MLTRKK---------------------------------------DKPG---
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      -----------------------------------------------------MASEGRA
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      --------KPVVGT---------------------------------------IPEEKSF
A0A1I6IST1      --------KPVVGT---------------------------------------IPEEKSF
A0A412JBM5      GMA----MSHELKR---------------------------------------ESGHMRP
A0A023X491      --M----ARSKPLK---------------------------------------KHKKTEN
A0A1Q7WJN6      ---------------------------------------------------------MPH
A0A1C2B334      SPV--------IGL---------------------------------------VPGDSAL
R7Y679          DAI----GVHSLGV---------------------------------------VASDGAF
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------MVKKKI
A0A1U6THY0      -------MAASKRA---------------------------------------KKGGLAL
A0A420ZS11      -------MARKNKT---------------------------------------NQPDMSE
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      LNTVILEIKSSSGDPESAAEIANGV-------------------ADSLTAVVREIS----
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      PDTVLLNVTVEDSDRSVAVVLANSV-------------------AASLQDYVESLE----
A0A1L2ZMQ6      EGSTELRVTASASDPVFAQQLANVW-------------------IDALAEEAHDIESTGV
A0A0Q5M6Z7      ADTAVIEITARASTPDGAAKLANAW-------------------IAGLTKQVRALEAPEG
A0A3L7ADK2      QDTVLIEITAKGPTGDSARTLADAW-------------------ITAMSEQIEAIQGNDG
A0A0G3V3M7      PATGSLAITAQVGDAELAAKVANLF-------------------AAKLVGYVDELGQKQY
A0A1H6WL79      LDSVEIRITARSSDAQTAQNVADAW-------------------VAALASQVYELDKGNA
A0A1Q2CI19      GESASVTITTTASDGERAANVVNTF-------------------ANETIAFF-ETSPPGA
W6JTW4          PAASTISISATDPHATTAESIAQTF-------------------AEAAKAYFAKASPSG-
A0A0A0JTY0      PAAQAITVAATASDGKQAAAVANAF-------------------ANETINYIKEKPRAGV
A0A0A0JXF2      NAAEALTVSATASDGEEAAAVANAF-------------------ATETVKFFKETSPPGA
E6S8H2          FSAGALTVAVTDAEGKRAASIANTF-------------------ADETVTYF-KKNRPGV
A0A0A0JGH0      PSGAALTIAASDRDGAKAAETANAF-------------------AKQTVAFF-AKPRPGV
N0E4U7          PAAAALTIAASAPDGERAAATANAF-------------------ADETVAFF-EKGAPGT
A3TMH6          FIATALTVSATASDGARAAAVANAF-------------------ADEAVSFF-DTPRPGT
A0A0A0IYK2      VVAAAITVSATASDGSRAAAVANAF-------------------ATETVKFFRERSRPGA
A0A0Q9L0H3      TVAQALTVSATASDGKQAAAVANAF-------------------ATETVKFIEERKRPGA
A3TMK0          TVSQALMVSATASDGKQAAAVANAF-------------------ANQTVLFIEQARRPGA
A0A3E2DN22      GDTAFIDIKATGGTAKNAQALANAG-------------------LEALISEALRMETYGQ
A0A3Q9ULZ9      SGTSFIKITATGSSALNAQSLANAA-------------------LVGLQAEALRMETYTQ
A0A3S9JFL2      TGTSFIRITATGSSAQNAQALANAA-------------------LVGVQAEALRMETYSQ
A0A0Q5JKD6      IETVNVRVDATGPTPESARDLAEAW-------------------IRGMTEEVDQLETGGG
A0A0Q9TBP0      GTSRILRVTAQDSSPDRAARTANIVATSYLQFREQDSVGRYEQARDRLAQEQADIESRLS
A0A346XTB0      AETLEIVLVAEDETAEGAAELVNAVAEAYRTQKRAQEVQRAEDAVAELRAQQVRLEEERS
A0A2W6DK08      KPSNAINITASDVDPQNAVALANAFAAGTVDEFRARHAAAAAARFRSLEGQLTEVDNQLK
A0A2S0LQ32      PSSPIVTITAVSSDPSRARDLANAA-------------------IPALGSYIASLEAIGS
A0A2N6V1R5      AVPGLFTLTATASTPERARDIANAG-------------------IKAVSDEANAITTLNA
G9PHS6          AVPGLFTLTATASTPERARDIANAG-------------------IKAVSDEANAITTLNA
U1PLM7          AVPGLFTLTATASTPERARDIANAG-------------------IKAVSDEANAITTLNA
A0A351ETF8      GTGSTLTFNARGAVPEDLAAAANVWAQTYVTARYAETLAQNVESIEFLQALIAEIAEDRD
A0A349B7N2      PQVATLDITSVGTDPDRAVRIADGFAGALLATLTETTQQERAEAQTRLSARLDELEARLA
A0A346Y185      SDLDQLSISATDGTASGAAQIANAIGEAYQAVVREEAERSTQASLSELQTQRAALEDAIA
A0A259S8H9      PGSTLVEVTADAADPKSALKLANGA-------------------LHALAKVVAHIEQVAQ
A0A0Q5L115      EDTAIITVTSRGSTPADAAALTDAW-------------------LAAMGEQIAAMQE---
A0A2W1Z497      EGTAIIDVTASGATPRESADLADAW-------------------IAGMGRQIAAIQS---
A0A1H6YPK1      TETAIMLFTGTGSAPESAQELVNAW-------------------MDATFLVVSDVERTSR
A0A2R7MGI0      VDTVNVRVDATGPTPESARDLAEAW-------------------IRGMTTQVDDLETGGT
A0A2T7WQY4      VETVNVRVDATGSTPESARDLAEAW-------------------IRGMTTQVDELETGGS
A0A1G6GTN3      VDTVNVRVEATGPTPESARDLAEAW-------------------IRGMTVEVDQLETGAG
A0A1N7DLV3      VDTVNVRVDATGPTPEAARDLAQAW-------------------LQGMTVQVDQLESTGG
A0A1V2NSB5      VDTVNVRVDATGPTPEAARDLAQAW-------------------LHGMTVQVDQLESTGG
A0A0Q5Q5L3      VDTVNVRVDATGATPESARDLAEAW-------------------IRAMTTQVDELESGGS
A0A0Q6DVM4      VDTVNVRVDATGATPESARDLAEAW-------------------IRAMTTQVDELESGGS
A0A1R3WWR6      IDTVNVRVDATGPTPESARDLAEAW-------------------IRGMTTEVDQLQSGGN
A0A2S5UYV0      PGSNLIQVQASADSPSSAVALANGA-------------------LQALADVITDLESQAG
A0A2S5ULV5      PNSNLIQVSASASTPSSAVALANGA-------------------LQAMADVITEIETQVG
A0A2S5X9U6      PNSNLINVQATASTPSSAVALANGA-------------------LQAMADVITEIETQVG
A0A3Q9IY80      TDTVNIRVVASASSPEGARDLAQAW-------------------IRAMATEVENLETSGG
A0A0F0LP73      PGSTMVRVTANAPDPQSALRLANGA-------------------LHALANVVARIEDAAG
A0A1F1X071      PNAPIITVEAVAPTAEEASAIANAA-------------------VEATAAEARELETGGN
A0A3R8RWC7      PNAPIITVEAVAPTAEEASAIANAA-------------------VEATAAEARELETGGN
E3B8H1          EGTSNLSLTASSSSAAKAQQAANLA-------------------PAALSQEIKHIETLNG
A0A0Q5AWK6      PGSTLIQVTAEASTPENAAALANGA-------------------LAALAAVIADIETQST
A0A3N1NLD3      PGSTLIEVTASASTPENAAALANGA-------------------LAALADVIADIETQST
A0A3N2FVI8      PGSTLIEVTASAATPENAAALANGA-------------------LAALADVIADIETQST
A0A2S5XDQ6      PGSTLIEVTAAAGTAQNAAALANGA-------------------LAALAAVITDIETQST
A0A2S5XNN6      PGSTLIEVTAEAGTAQNAAALANGA-------------------LAALAAVITDIETQST
A0A2S5WZJ5      -----------------------------------------------MADVITDVE----
K6WHS4          PDTVLLVVTAENANPDLAARLASGV-------------------SQALIEYVEVLE----
S3X7T8          HSYRLFR----DPATTIARNIANSV-------------------ISESSKQVKSLE----
A0A261FE22      DGSAFVSMTVTYSDPNDTVTILNEV-------------------VKQLNKQI--------
A0A0J6YE86      PDTVLIDVAVLDESAVRARDIANTL-------------------SDEFVGRVRELE----
A0A439DNZ6      LDTVLINVSVLDESPVRARDIADAL-------------------SEEFVVMVRELE----
A0A1E4BP96      LDTVVIHVAATAATPESARDLAEAW-------------------IRGMTAAIDDIE----
A0A151BT98      DTANIMTATASSGSAQEAAAIANAT-------------------GPALAAVAPQFS----
A0A2Y8ZRF8      DTANIMTGTASSGSAQEAAAIANAT-------------------GPALAAVAPQFS----
A0A2R9UAT1      TGTVTIKVQASAPTPETARDLAEAW-------------------IQGMATEIDGLE----
A0A1F1IHY9      SGSAQIVVRAEDSSPERAQQLASAW-------------------LGALEAQATEVE----
A0A3L8NYD3      ADNPQLTIYATASSPSQARDLANAV-------------------IGAMSTEAAKLE----
A0A1Y4CKD6      DNSNMVTMWVDSASPENARAILEKA-------------------LEVYPEVSRFVL----
A0A0Q7KBQ4      ATTQTLQVDVTADSAELAQQIAEAE-------------------AEGIVSLVARLE----
A0A2S8WHZ8      TNTAEIRVTASSQGAEEARNLADAW-------------------VVALAAQVEELE----
A0A1Y4CTD2      SGTNLLTLSVTSPTPRQAYLFIQSA-------------------LQNYERVSGYVF----
A0A3N3ZPU0      PGTSQIKVEGRSDSPEGSAKVADAY-------------------AGALTQEVQRIE----
A0A359IQX7      GGSVLFTVTAIAPTPSEAKDAADLG-------------------LTATADAAARLE----
A0A0Q9LZR0      VDTVLLKISARAATPRGAQQLADAW-------------------VAALARQVQAVE----
A0A1F1J417      ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
A0A2A8D6P2      ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
A0A448USF4      ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
A0A1F1QKB0      ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
A0A1F0THV9      ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
A0A2I1VJQ6      ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
D8USQ4          ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
E3H5W1          ENSSLIKVRATASSPEQARVLANSA-------------------LHATAQYIENIE----
A0A448PRK6      ENSSLIKVSAHASTPEQAQVLANSA-------------------LHATAEYIKNIE----
A0A433EDP2      ENSSLIKVSAHASTPEQAQVLANSA-------------------LHATAEYIKNIE----
A0A231VTW0      ENSSLIKVSAHASTPEQAQVLANSA-------------------LHATAEYIKNIE----
A0A433ECD0      ENSSLIKVSAHASTPEQAQVLANSA-------------------LHATAEYIKNIE----
U7V3Z1          ENSSLIKVSAHASTPEQAQVLANSA-------------------LHATAEYIKNIE----
A0A1N7E3F1      PETTLLRATVADSVPTRAAARANAL-------------------GAAFARLIDQIE----
A0A372P1T1      PDTTLLRATVADSVPVRAAARANTL-------------------GATFAALIDRIE----
A0A1L2ZMV4      PSNSQIRVTATAENPEHARASADAF-------------------ASALAEEAERVE----
A0A1N5CK61      GDSALMKVQATASSPEAAQTLANTS-------------------LSATAKVVNDLE----
A0A2R7Z032      TDINLLTVQAIGTTPEEARDLASIV-------------------VQAIADEAEEIE----
A0A1I0W453      ADVNALTVTAIGTTPEEARDLANAV-------------------VDAVVVVAQEIE----
A0A1H4LCS9      TTVNALTVTATASTPQDAQDLANAV-------------------IKAVVVYAAQVD----
A0A0Q6VV12      ADVNALTITAIGSTPEQARDLANGV-------------------VDAVVEYAQEVD----
A0A0Q9QB08      SDVNAITISAVGTTPEEARDLANAV-------------------VDAVVVVAQQYE----
A0A1M6K628      NDGVIFEITAQAPTAEGARLMADAG-------------------IRATSVAANELE----
A0A1S1CAD0      ENAALITVSAKASSPKNAQLLANGA-------------------LQATADYIKEIE----
G5ET14          ENAALITVSAKASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E9DXX2      ENAALITVNAKASSPKNAQLLANSA-------------------LQATADYIKEIE----
A0A1E8S156      ENAALITVSAKASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E8S5S2      ENAALITVSAKASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1S1DFA8      ENAALITVSAKASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A2I1Z490      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F0DAA9      DNAALITVNAKASSPKNAQVLANSA-------------------LQATADYIKEIE----
A0A1F0PHK9      DNAALITVNAKASSPKNAQVLANSA-------------------LQATADYIKEIE----
A0A1F0VZG6      DNAALITVNAKASSPKNAQVLANSA-------------------LQATADYIKEIE----
A0A1E9G8X4      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E9IAW2      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E9ZBC9      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E9ZDP4      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F0R6B5      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F0Z7N5      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F1D897      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
D2NP38          DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F1FV74      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E9M791      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A291DEI8      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1S1D5T1      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1E8TRD6      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F0XT88      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F1EVP5      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
C6R548          DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A0K2RXS2      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A1F0KX60      DNAALITVSAQASSPKNAQLLANGA-------------------LQATADYIKEIE----
A0A2T0UZ65      PGSVILKINATGPTPTDARDLADAT-------------------MEAVAAEANRLE----
A0A1R4JTI6      PDTAEVRLSVVQDSPDAARALADSW-------------------VSSLAEEVSNIENQTL
A0A0G3V3F3      GDLGFLEVYAKGPSVSEAEQLSSAA-------------------TVALIDAVRAQQTASL
A0A0Q7QDF6      GNSSVVRVVVRTTDPERAAQLAGQV-------------------AEELVSWIASYQDRA-
A0A3S0V9U6      DGSTLIRVRATASSPEDAVALANAS-------------------LKATADTVNEID----
A0A261FQA1      DASGLMTVTATSSDSQQAADIANAV-------------------YDSLVQQIEDDS--F-
A0A1Q2CJ92      -DGVIFRIRATADSPELAASLADAA-------------------IRATSVEANALETLT-
A0A2T0S3C8      PETVLLQATVTDGSAERSRLIAGVL-------------------AREFTTMVEALE----
A0A285VUW0      DDTALFDFVVRSDSPDHASAVAEAL-------------------PQQLATTARSYA----
A0A444BL03      ENSVIMQVTATGPTPDESRRLADAV-------------------IKATAQEANRIE----
A0A1C6T1J1      TGTVLLRASVTDTDQTRALKLTELL-------------------SAKFVDLVQKVE----
A0A2W2CFC8      TGTVLLRASVVDTDQTRALRVTEAV-------------------SAKFVELVKQVE----
R4LD52          PETVLLQATVTDTDRDRSARIATVL-------------------AGQFKQLVESLE----
A0A2N3YJR1      PDSVILKVTATAPSPEEARVLADAV-------------------IKATAEEANRIE----
A0A2W2A4B0      TGSVVMQIAVTSPDRQRVAEITDSI-------------------VRSFSSVVQDRL----
A0A1H7N9P7      PETVVVQISATDPSPARAAAIANAV-------------------AAELELAVEGLS----
A0A1M7V0F8      PETVVVRIAATDPSPARAAAIADAV-------------------ADQLERTVEQLS----
A0A1Q2CRV2      AQTATMDLAVTADSPEEAARIAHAI-------------------TERLIVAVDELS----
A0A101KZQ4      VDTATLKVSAESNTPESAQQLAEAW-------------------VKAIENQVSEVE----
A0A1H4I042      MGTVLIDVDVLDPSPVRARDIANTL-------------------SDQFVKMVRELE----
A0A022KX11      -------------------------------------------------MAGEFST----
A0A2N3R006      TNTAFVNISVTDGDPAQAADIANAI-------------------AKSLSSVVETTL----
A0A255G8R8      QKTVIVEVTVTDPDAASAARIANAI-------------------GDQVAETVRELS----
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      PDTVLLTVAASTPDPETSAKLANGV-------------------AAELTDYVSSLE----
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      LKQNLITFYNSKSP----------V-----------------------------------
A0A357ZCV8      -----MARHRKVGREQESPGSRSEV-----------------------------------
A0A2S8MDM2      -KQPAISFETDNAA----------T-----------------------------------
A0A1X6Y1L5      -LNIILNRENAKSI----------P-----------------------------------
A0A1U3QN81      -GLAQISVLHHKSL----------V-----------------------------------
A0A1M8I0C2      FKRKLIVKNDPKSP----------V-----------------------------------
A0A1U3NFN6      -KRSVIAMSEPKSI----------N-----------------------------------
A0A1N1YAY7      --------MAKLELSEKRQALVKKA-----------------------------------
A0A2V2CXY5      GMKELVIRNMPKLP--------FDV-----------------------------------
A0A357ZDL3      ----------MSKKNNKSFSNNHEI-----------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      --MAMKTKSRGSKYLYTKDFPASVL-----------------------------------
A0A1I6GVG4      TADNRLLPFDGGTSRSSESAHLFGI-----------------------------------
A0A1I6IST1      TADNRLLPFDGGTSRSSESAHLFGI-----------------------------------
A0A412JBM5      ACDRKLLTYDSPFA----------I-----------------------------------
A0A023X491      LTDRLVSLSDPGGQ----------A-----------------------------------
A0A1Q7WJN6      VERRNGSGEEGAAG----------V-----------------------------------
A0A1C2B334      DGEGFVDFGAGGSV----------I-----------------------------------
R7Y679          ADRSLIDFRAGGSS----------T-----------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      TLSPLYVHEKPKST----------I-----------------------------------
A0A1U6THY0      NRRKLITKYDPRSP----------I-----------------------------------
A0A420ZS11      KQRSLITEFDQRSP----------V-----------------------------------
A0A1Q7CZ24      MGEHLVSLLNPASF----------E-----------------------------------
A0A2W6VLC6      ----------PTTF----------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      ------------------------------------------------------------
A0A1H6WL79      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      ------------------------------------------------------------
A0A346XTB0      ------------------------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      GQSPSPADAQPPAAGSDQPSTPSPADEQPAAPEPATPEPRQEEPRGGNQDEGANPGTGER
A0A2N6V1R5      ------------------------------------------------------------
G9PHS6          ------------------------------------------------------------
U1PLM7          ------------------------------------------------------------
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      ------------------------------------------------------------
A0A259S8H9      ------------------------------------------------------------
A0A0Q5L115      ------------------------------------------------------------
A0A2W1Z497      ------------------------------------------------------------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
S3X7T8          ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A2I1VJQ6      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A448PRK6      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1N5CK61      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A2N3R006      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1L2ZMQ6      ------------------------------------------------------------
A0A0Q5M6Z7      ------------------------------------------------------------
A0A3L7ADK2      ------------------------------------------------------------
A0A0G3V3M7      -----------------DEQIFGLTISRGNSETLISKIDSQLAAPGLSASEYDSLDIRRE
A0A1H6WL79      ------------------------------------------------------------
A0A1Q2CI19      ------------------------------------------------------------
W6JTW4          ------------------------------------------------------------
A0A0A0JTY0      ------------------------------------------------------------
A0A0A0JXF2      ------------------------------------------------------------
E6S8H2          ------------------------------------------------------------
A0A0A0JGH0      ------------------------------------------------------------
N0E4U7          ------------------------------------------------------------
A3TMH6          ------------------------------------------------------------
A0A0A0IYK2      ------------------------------------------------------------
A0A0Q9L0H3      ------------------------------------------------------------
A3TMK0          ------------------------------------------------------------
A0A3E2DN22      ------------------------------------------------------------
A0A3Q9ULZ9      ------------------------------------------------------------
A0A3S9JFL2      ------------------------------------------------------------
A0A0Q5JKD6      ------------------------------------------------------------
A0A0Q9TBP0      --------------------------------------EVNALLEKNPGGQALQG-----
A0A346XTB0      --------------------------------------GLQSSLEADSSNVALPF-----
A0A2W6DK08      -------------------------------QVTGFTGAVSTPVNPVLQA----------
A0A2S0LQ32      RSTPGRGNGTGEEKEDAAADAQARVVPAVAGTGASLVPAVAGAPQAAVGQ----------
A0A2N6V1R5      -------------------------------------PTVQPTTKTTTNP----------
G9PHS6          -------------------------------------PTVQPTTKTTTNP----------
U1PLM7          -------------------------------------PTVQPTTKTTTNP----------
A0A351ETF8      ---------------------------AIRVEVDFYDDLLAETTDPDEYSRYLSQMVSIE
A0A349B7N2      ---------------------------DLDAQIE------DGAGDLVQAQRDALVREYGI
A0A346Y185      ---------------------------AAEARLA------ASPTDASARA----------
A0A259S8H9      ---------------------------SAAPVDP------SLPPEPKSAT----------
A0A0Q5L115      -----------------------------------------------EST----------
A0A2W1Z497      -----------------------------------------------SGE----------
A0A1H6YPK1      ------------------------------------------------------------
A0A2R7MGI0      ------------------------------------------------------------
A0A2T7WQY4      ------------------------------------------------------------
A0A1G6GTN3      ------------------------------------------------------------
A0A1N7DLV3      ------------------------------------------------------------
A0A1V2NSB5      ------------------------------------------------------------
A0A0Q5Q5L3      ------------------------------------------------------------
A0A0Q6DVM4      ------------------------------------------------------------
A0A1R3WWR6      ------------------------------------------------------------
A0A2S5UYV0      ------------------------------------------------------------
A0A2S5ULV5      ------------------------------------------------------------
A0A2S5X9U6      ------------------------------------------------------------
A0A3Q9IY80      ------------------------------------------------------------
A0A0F0LP73      ------------------------------------------------------------
A0A1F1X071      ------------------------------------------------------------
A0A3R8RWC7      ------------------------------------------------------------
E3B8H1          ------------------------------------------------------------
A0A0Q5AWK6      ------------------------------------------------------------
A0A3N1NLD3      ------------------------------------------------------------
A0A3N2FVI8      ------------------------------------------------------------
A0A2S5XDQ6      ------------------------------------------------------------
A0A2S5XNN6      ------------------------------------------------------------
A0A2S5WZJ5      ------------------------------------------------------------
K6WHS4          ------------------------------------------------------------
S3X7T8          ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      ------------------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A3L8NYD3      ------------------------------------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A2S8WHZ8      ------------------------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      --------------------------------------------------KNGSGNNSTA
A0A2A8D6P2      --------------------------------------------------KNGSGNNSTA
A0A448USF4      --------------------------------------------------KNGSGNNSTA
A0A1F1QKB0      --------------------------------------------------KNGSGNNNTA
A0A1F0THV9      --------------------------------------------------KNGSGNNSTA
A0A2I1VJQ6      --------------------------------------------------KNGSGNNSTA
D8USQ4          --------------------------------------------------KNGSGNNSTA
E3H5W1          --------------------------------------------------KNGSGNNSTA
A0A448PRK6      --------------------------------------------------GNNGGSGNAA
A0A433EDP2      --------------------------------------------------GNNGGSGNAA
A0A231VTW0      --------------------------------------------------GNNGGSGNAA
A0A433ECD0      --------------------------------------------------GNNGGSGNAA
U7V3Z1          --------------------------------------------------GNNGGSGNAA
A0A1N7E3F1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1N5CK61      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ---------------------------------------------PGVEQ----------
A0A0G3V3F3      ---------------------------------------------AQDIAPIQAQRVILQ
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A022KX11      ------------------------------------------------------------
A0A2N3R006      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A345NSU7      ------------------------------------------------------------
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ------------------------------------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ------------------------------------------------------------
A0A348NU28      --------------------------PSSANGSSRISA---NLVDEAVVP-NVQAL----
A0A1M3LEY6      ------------------------------------------------MP-QEPIS----
A0A222TG79      --------------------------TPAGGGSPMAKL---TTVTPAVEP-SVPVS----
A0A1L2ZMQ6      -------------------------DGVDKDFQPAVEL---MPMTEGTLP-TSPYA----
A0A0Q5M6Z7      -----------------------------AIAEPAISF---VALASARPP-YFPSS----
A0A3L7ADK2      -----------------------------VIGAQNTKF---VSVSKAATP-NSPVS----
A0A0G3V3M7      AVLRKLANADSDLSNLQEIGPQTSGLTTLEAATKGRAT---IIVSRAQGS-TSESQ----
A0A1H6WL79      ----------------------------SPGTEPVTKI---VPLAKATLP-SAPVS----
A0A1Q2CI19      ----------------------------------ETTR---LSVLQEATP-IPNES----
W6JTW4          -----------------------------------GTR---LTIVQDAVA-VPDA-----
A0A0A0JTY0      ----------------------------------ENAR---LEVLQTATP-IPTAG----
A0A0A0JXF2      ----------------------------------ENTT---LTILQPATP-IPSTA----
E6S8H2          ----------------------------------GRAN---VSILQRATP-IPNVT----
A0A0A0JGH0      ----------------------------------GRAV---VTILQEATP-IPDEI----
N0E4U7          ----------------------------------GGAA---VSVLQVATP-IPDQI----
A3TMH6          ----------------------------------GTVG---ITVLQSASP-IPNAD----
A0A0A0IYK2      ----------------------------------ENVA---VSILQAASP-VPVAN----
A0A0Q9L0H3      ----------------------------------ETTT---LSLLQPATP-IPSAA----
A3TMK0          ----------------------------------ENAT---LSVLQPATP-IPSAT----
A0A3E2DN22      ------------------IAASDHKSDAQLAKMTSVHV---LGYESAGLP-SGDRG----
A0A3Q9ULZ9      ------------------AQANPGYTQAQLEKLTAIHV---LSYEPAGLP-ATPKQ----
A0A3S9JFL2      ------------------AQANPGYSQAQLEKLTAIHV---LSYEPAGLP-ATPKT----
A0A0Q5JKD6      -------------------------------GQSAVRL---VAGDSARLP-TAPSS----
A0A0Q9TBP0      --------ERRTLIASSAQVAAQIDALTDSLTTAAAGG---ELLHSAEPA-DNPVS----
A0A346XTB0      --------LIQSLDARILDISGRIDATLLAVRLRGDGV---EDFQDAIPP-DFPSR----
A0A2W6DK08      --------RAAALSARYAAIYGLLQETANQANNPTGLD---TLSPAAGAT-FNAGAFSL-
A0A2S0LQ32      --------AGVGQAGQAAPAAPATAAPTDETYNSQTRL---VALEPAQLP-GAPFS----
A0A2N6V1R5      --------DGTQVTTTTQSVDGTTNVTTTDNSYRETRV---TQTLQAVAP-SAPSS----
G9PHS6          --------DGTQVTTTTQSVDGTTNVTTTDNSYRETRV---TQTLQAVAP-SAPSS----
U1PLM7          --------DGTQVTTTTQSVDGTTNVTTTDNSYRETRV---TQTLQAVAP-SAPSS----
A0A351ETF8      TLLQPQLAPLEAQISEYQRQITEFESVARFLDSPDVSA---QVSQLAEVP-TIPVS----
A0A349B7N2      VYEDFQVLSREPEATVGLRTLQPAVAVPISGDAFVAAL---QETLGATDP-SEPTAIEDG
A0A346Y185      --------ERDAAVSQLIMIDSRADQIAVDSTLFGSGV---ELFERADVP-ESPSA----
A0A259S8H9      --------NAAPGGIAIVPMDE------------------------AVAP-TRPSA----
A0A0Q5L115      --------DTGGSATSFVALSS------------------------ASVP-TSPAS----
A0A2W1Z497      --------ALASATTKLVPLAS------------------------ATVP-TSPSS----
A0A1H6YPK1      -------------------GISNPERT-------VINV---MVLQQARLP-SVPAS----
A0A2R7MGI0      -------------------GQG------------AVRL---IAGDSARLP-TSPSS----
A0A2T7WQY4      -------------------GQG------------AVRL---IAGDSARLP-TSPSS----
A0A1G6GTN3      -------------------GRS------------AVRL---VAGDSARLP-TAPSS----
A0A1N7DLV3      -------------------GHG------------AVKL---VAGDSARLP-TAPSS----
A0A1V2NSB5      -------------------AHS------------AVKL---VAGDSARLP-TSPSS----
A0A0Q5Q5L3      -------------------GQG------------AVRL---VAGDSARLP-TSPSS----
A0A0Q6DVM4      -------------------GQG------------AVRL---VAGDSARLP-TSPSS----
A0A1R3WWR6      -------------------GES------------AVRL---IAGDSARLP-TSPSS----
A0A2S5UYV0      -------------------GGVS-----------SVTV---LPLQDAVEP-TSPES----
A0A2S5ULV5      -------------------GGTS-----------GVTV---VPLQNAVEP-TSPVS----
A0A2S5X9U6      -------------------GGAS-----------GVTV---VELQNAVEP-TSPVS----
A0A3Q9IY80      -------------------VSLAT-----------VQL---VPGDTARLP-SSPSS----
A0A0F0LP73      -------------------AGATPPPGSTVVPTEGIVI---VPLDQAVAP-RTPSA----
A0A1F1X071      -------------------ENAAV----------GVQL---TNYQNAVVP-GAPVS----
A0A3R8RWC7      -------------------ENAAV----------GVQL---TNYQNAVVP-GAPVS----
E3B8H1          -------------------A-KST----------VYDA---YPLSRAGLP-ASQTS----
A0A0Q5AWK6      -------------------ADRTP----------QITV---VPLENAEPA-STPTS----
A0A3N1NLD3      -------------------ADRTP----------QITV---VPLENAEPA-AAPTS----
A0A3N2FVI8      -------------------ADRTP----------QITV---VPLENAEPA-AAPTS----
A0A2S5XDQ6      -------------------ADRTP----------QITV---VPLENAEPP-AAPTS----
A0A2S5XNN6      -------------------ADRTP----------QITV---VPLENAEPP-AAPTS----
A0A2S5WZJ5      --------------------------TQVGGGVSNVTV---IPLEDAVPP-TTPVT----
K6WHS4          --------------------------VPSAGGDPLAKL---TVVSPATVD-DAPVS----
S3X7T8          ------------------------------GKNSPVQV---VMMTPADLS-QAKKA----
A0A261FE22      ----------------------------TSDGSSGIQL---SFIQKPYVP-SSPSS----
A0A0J6YE86      --------------------------TPENSTRADSRV---VVEQRASIP-SSPVV----
A0A439DNZ6      --------------------------TPPDGTRPDARV---IVEQRASIP-KSPVI----
A0A1E4BP96      --------------------------GTGVAGSAPVTL---IPGDSARLP-TAPSS----
A0A151BT98      ---------------------------QLLSGAGSVTS---TAVQPAEVP-ASPAS----
A0A2Y8ZRF8      ---------------------------QLLSGAGSVTS---TAVQPATVP-SSPAS----
A0A2R9UAT1      --------------------------SDGGKVQAAVRL---VPADTARLP-TAPSS----
A0A1F1IHY9      --------------------------AGGIAGQSIISL---ETLSDASLP-SAPSS----
A0A3L8NYD3      ----------------------SAARPSGAPVSTLVKL---VATQQAGAP-SAPSS----
A0A1Y4CKD6      ---------------------------------GNIAF---NLIDEISTP-ATPVN----
A0A0Q7KBQ4      -------------------------KPTSGNGSPAFVA---RIVGPPSIS-QTPVA----
A0A2S8WHZ8      -----------------------SVSVGGSDRATAVKL---QPLGQAVLP-SSPVS----
A0A1Y4CTD2      -------------------------------SNATLQLVQEPSVPESPSN-TSPLI----
A0A3N3ZPU0      SIATEGNNYEPPSPSPSEDGGEEASPESSEDGTGLVQV---VPVSSASVP-ESPVS----
A0A359IQX7      -----------------------SLTTTGTPGQSVVKL---QPYISAAES-PNPVS----
A0A0Q9LZR0      --------------------------NPTGKAAQALRV---VPIESAALP-ASPVS----
A0A1F1J417      TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
A0A2A8D6P2      TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
A0A448USF4      TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
A0A1F1QKB0      TP------APAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
A0A1F0THV9      TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
A0A2I1VJQ6      TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
D8USQ4          TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
E3H5W1          TP------TPAGEENQESAQNKVSSTNPSDTTNTLIRV---IPLDNASVN-PPLVS----
A0A448PRK6      SSNGGNNATPNAENGNAAG--ASANTAVSGNAANNIRV---IPLDNASIN-PPLVS----
A0A433EDP2      NSNGGNNATPNAENGNTAGANASANTAVSGNAANNIRV---IPLDNASIN-PPLVS----
A0A231VTW0      NSNGGNNATPNTENGNTAGASASANTAVSGNAANNIRV---IPLDNASIN-PPLVS----
A0A433ECD0      NSNGGNNATPNTENGNTAGASASANTAVSGNAANNIRV---IPLDNASIN-PPLVS----
U7V3Z1          NSNGGNNATPNTENGNTAGASASANTAVSGNAANNIRV---IPLDNASIN-PPLVS----
A0A1N7E3F1      --------------------------RPTPKSPPTIRV---TVVDDAEVP-EDPVA----
A0A372P1T1      --------------------------RPTPKSPPTIRV---TVIDEAEVP-REPVA----
A0A1L2ZMV4      -------------------RVMATGGTDSTSSVPVVQI---IPISSALLP-SAPSA----
A0A1N5CK61      -------------------------------GSTTVRV---VPLDDATLP-GAPSS----
A0A2R7Z032      ----------------------NTGRPAGNKAETLVQV---VPLEQAQLP-GAPFT----
A0A1I0W453      ----------------------TGE--ENPKEPALTRI---IPLEEAQLP-GAPFT----
A0A1H4LCS9      ----------------------NGG--TTPKGDSLATI---VPLEEAQLP-GAPFT----
A0A0Q6VV12      ----------------------TGE--SNPRRDPLTRV---VPVQPAELP-QAPFT----
A0A0Q9QB08      ----------------------TGE--ENPRGPSLTRI---IPVTPAELP-GAPFT----
A0A1M6K628      ----------------------TMTVTGEPTDQLVVKI---APVEPALTP-SRPTS----
A0A1S1CAD0      -----------QNPGNAQALVNGDSTAASPTGGNTVRV---IPLNNASVN-PPLVA----
G5ET14          -----------QNPGNAQALVNGDSTAASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E9DXX2      -----------QNPGNAQALVNGDNAVVSPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E8S156      -----------QNPGNAQALVNGENTGATPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E8S5S2      -----------QNPGNAQALVNGENTGATPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1S1DFA8      -----------QNPGNAQALVNGENTGATPTGGNTVRV---IPLNNASVN-PPLVA----
A0A2I1Z490      -----------QNPSNAQALVNGENTGATPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F0DAA9      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F0PHK9      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F0VZG6      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E9G8X4      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E9IAW2      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E9ZBC9      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E9ZDP4      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F0R6B5      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F0Z7N5      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F1D897      -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
D2NP38          -----------QNPGNAQALVNGENTGASPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1F1FV74      -----------QNPGNAQALVNGENTAASPTTNNTVRV---IPLNNASVN-PPLVA----
A0A1E9M791      -----------QNPGNAQALVNGENTAASPTTNNTVRV---IPLNNASVN-PPLVA----
A0A291DEI8      -----------QNPGNAQALVNGENTAASPTTNNTVRV---IPLNNASVN-PPLVA----
A0A1S1D5T1      -----------QNPSNAQALVNGENTGATPTGGNTVRV---IPLNNASVN-PPLVA----
A0A1E8TRD6      -----------QNPGNAQALVNGENTGASPTTSNTVRV---IPLNNASVN-PPLVA----
A0A1F0XT88      -----------QNPGNAQALVNGENTGASPTTSNTVRV---IPLNNASVN-PPLVA----
A0A1F1EVP5      -----------QNPGNAQALVNGENTGASPTTSNTVRV---IPLNNASVN-PPLVA----
C6R548          -----------QNPGNAQALVNGENTGASPTTNNTVRV---IPLNNASVN-PPLVA----
A0A0K2RXS2      -----------QNPGNAQALVNGENTAASPTTNNTVRV---IPLNNASVN-PPLVA----
A0A1F0KX60      -----------QNPGNAQALVNGENAAASPTTNNTVRV---IPLNNASVN-PPLVA----
A0A2T0UZ65      ----------------------LGGGEVKPGTQALVRI---IPIETALLP-GAPIG----
A0A1R4JTI6      --------------------------SEESSAQSIVKV---LPLVQATQP-QTPHT----
A0A0G3V3F3      KQLSNLPAFDPQAASIQANIDALNKVEAERRAQPANRV---NVAASAHAS-STPIS----
A0A0Q7QDF6      -------------------------AERAGEDAPDLPTLSPIVIQEGTAS-SQPVE----
A0A3S0V9U6      -------------------------------GSRSVRV---IPLDDAQKP-GSPVG----
A0A261FQA1      -------------------------ASNETGLFNGLQF---SVIERAVAP-SSPVS----
A0A1Q2CJ92      -------------------------ITGESSGQTVVRI---VPVELAQTP-TTPVS----
A0A2T0S3C8      --------------------------TPRDRTASPIKV---EVVAGPTGG-DTPVS----
A0A285VUW0      --------------------------PTLAQSGASVAA---QFVDQPTQS-SEPVS----
A0A444BL03      --------------------------TTGSNAK-NIVT---IVPIESALP-GRRIA----
A0A1C6T1J1      --------------------------TPPSGEPGPIKI---EIVSGPRVS-ASPVS----
A0A2W2CFC8      --------------------------TRPDGSAGPIKI---EVISGPGVT-PSPVS----
R4LD52          --------------------------TPPGKQVSSVKV---EVVAGPELA-DAPVS----
A0A2N3YJR1      --------------------------TAGSGRGAASVT---IVPIESALP-GTKIA----
A0A2W2A4B0      --------------------------DANASGV-GVTV---TQTSPAARP-TTPVA----
A0A1H7N9P7      --------------------------PAGEDGSPAVRA---TTVAPAGVP-GAPVS----
A0A1M7V0F8      --------------------------PAGEDGSRAVRA---TTVASADVP-TAPVS----
A0A1Q2CRV2      --------------------------PPGADGQKPVVATVIRQ---PLVP-TAPTS----
A0A101KZQ4      --------------------------NSSATKSSSASIVTFRSFDAAELP-TSPSS----
A0A1H4I042      --------------------------TPGDGSLPDTRVVVEQP---AAIA-SSPAV----
A0A022KX11      ---------------------------LLKSSGQKVVS---TPIQPASAP-AQPVS----
A0A2N3R006      ---------------------------YASGSHSSVKL---SVVQPAAVP-SSPSS----
A0A255G8R8      ---------------------------PKRDGQDTVKA---TTISPALPP-PSPSS----
A0A345NSU7      ---------------------------MLQMSGSAVSA---ETVVPAAVP-GRPVE----
A0A0W8I9Y2      ------------------------------------------------------------
A0A1U2GAT5      ---------------------------SMSDGGPPVAK---ITVVSNARPEADPVV----
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      ----------------------------------------------MDRRI----RSVEE
A0A348NU28      -------------------PNKPRDALLGAVVGLLLGVLAALLWTLLDTRV----PNETV
A0A1M3LEY6      -------------------PNTRLYLSLGLLIGLIVGLAVAILIEVLDTRI----RGEAN
A0A222TG79      -------------------PGIEKNTLIGVAVGLLFGLLAVMFASRLTNRI----QTPAD
A0A1L2ZMQ6      -------------------PNVNQAVLIGAVVGLVLGLIWAAIKHLLDRRV----RSVEA
A0A0Q5M6Z7      -------------------PNVQTALVLAILAGIALAVVYGLLRQHFDRRI----RSVEQ
A0A3L7ADK2      -------------------PNVIIALVLATITGTLLAIAYAVIRQHLDRRI----RSADV
A0A0G3V3M7      ------------------------RLLFGAAIGFIVGLGILLLLEILSARI----RDVPG
A0A1H6WL79      -------------------PLLTATIGIGLAGGLLVGLGYALARNHFDRRI----RAASE
A0A1Q2CI19      ------------TANFVIPPDRWFRTLLAAVLGLLFGIALALVLERLDSRL----RTREE
W6JTW4          ------------NPGSILPPGRPTRTALAALIGLLFGMALAVFVDRIDSRL----RSRTE
A0A0A0JTY0      -----------SDGGFVIPPGRGPRTAIATLLGVLVGLGLALLLDRLDSRL----RTRSE
A0A0A0JXF2      -----------NDGGFVVPPGRGPRTAIATLLGLLVGMGLALLLDRLDSRL----RSRSE
E6S8H2          ------------GGGFVIPPDRTTRTALAAGLGLLLGLGLALVLDRVDSRL----RTRSE
A0A0A0JGH0      ------------GGGFVVPPSRPLRAALAALVGLLLGFALALVLQRVDSRL----RTRDE
N0E4U7          ------------GGGFVVPPSRPLRTAMAAFIGLLLGFALALVIQRVDSRL----RTRDE
A3TMH6          ------------GGGFVVPPSRPVRAALSAVLGLLLGLALALVLDRLDSRL----RTREE
A0A0A0IYK2      -----------SDGGFVVPPGRGPRTAIATVLGLLAGLALALLLDRLDSRL----RTRQE
A0A0Q9L0H3      -----------TDGGFVIPPGRGPRTAIATLLGLLVGLGLALLLDRLDSRL----RTRGE
A3TMK0          -----------TDGGFVVPPGRGPRTAMATLLGLLVGLGAALVMDRLDSRL----RTRAD
A0A3E2DN22      -------------------KSVALYVVAGLAAGFLIGAVVAVVRKQFDVKV----RDQAT
A0A3Q9ULZ9      -------------------DNLLLYLALGLVAGLVVGSVIAVIRRMFDVKI----RSQND
A0A3S9JFL2      -------------------ANLPLYLALGLLAGLVLGGVISVIKRMFDVKI----RSQKD
A0A0Q5JKD6      -------------------PNVRLDVTLGALAGGVAGLIFAFVRRAFDRRV----RSAHD
A0A0Q9TBP0      -------------------PQIVLNLILGALVGLVLGVGAALLRDRLDDVV----HDEEA
A0A346XTB0      -------------------PRPRLTALSFAFLGGVASAMWAYWYAFKSQRV----TSRTD
A0A2W6DK08      -------------------SSTTARTVVGLVLGVVLGCALALALEHFDTRP----RDRAA
A0A2S0LQ32      -------------------PDTTKLAGMGGAGGLALGLAVAFLRRALDNKI----RHNSD
A0A2N6V1R5      -------------------PDFYKLSGMGALAGLVIGYLVVFMRRLMDNRV----RHNSD
G9PHS6          -------------------PDFYKLSGMGALAGLVIGYLVVFMRRLMDNRV----RHNSD
U1PLM7          -------------------PDFYKLSGMGALAGLVIGYLVVFMRRLMDNRV----RHNSD
A0A351ETF8      -------------------PNVTRNLVVAAAFGMALGIALTYLREVINDKI----EGARS
A0A349B7N2      DPDEEDPLLEAFDAGPSEPPSPARRGMLGGGLGLVLSVGAVVLFDRFDDRL----RTKED
A0A346Y185      -------------------PTPVRNAVLACFLGALAAAALAWWRADETATA----DGRND
A0A259S8H9      -------------------PNKPLIAGIGGGAGLVLGLIALLLRRAMDVRV----RAHTD
A0A0Q5L115      -------------------PNVEVALLLGGLSGLMLAGVYLLVRNTLDRRI----RSAAE
A0A2W1Z497      -------------------PDVRAAVTLGVLVGLLLASVYVLVRQALDRRI----RSAAA
A0A1H6YPK1      -------------------PAIKQNTAVGLMLGLALGVAYAFVRATLDRRL----RSRND
A0A2R7MGI0      -------------------PNIKIDVAVGGIAGGVLGVVFALVRRTFDRRV----RTVQD
A0A2T7WQY4      -------------------PNVKVDVAVGAIAGGVLGVVFALVRRTFDRRV----RTVED
A0A1G6GTN3      -------------------PNVRLDVTLGALAGGVAGIIFALVRRAFDRRV----RSTHD
A0A1N7DLV3      -------------------PNEKLAIAVGALAGAVAGVLFALVRRAFDRRV----RSAHD
A0A1V2NSB5      -------------------PNEKLAIAVGALGGAVVGVLFALVRRTFDRRV----RSTQD
A0A0Q5Q5L3      -------------------PNVRLDVMIGALLGLVAGVVFALVRRTFDRRL----RSASD
A0A0Q6DVM4      -------------------PNVRLDVMIGALLGLVAGVVFALVRRTFDRRL----RSASD
A0A1R3WWR6      -------------------PNVRLDIAIGALVGAMAGTVFALVRRAFDRRI----RSAAD
A0A2S5UYV0      -------------------PNLRNNLLIGAGLGLVLAYVFVFLRKALDVKV----RNSKD
A0A2S5ULV5      -------------------PNLRNNLIIGGAIGLVLAYAFALLRRSLDVKV----RDSKD
A0A2S5X9U6      -------------------PNLRNNLIIGGAIGLLLAYAFALLRRSLDVKV----RDSKD
A0A3Q9IY80      -------------------PNVRIALALGALAGLVLGIAYAVLRYTLDRRI----RSADA
A0A0F0LP73      -------------------PDKRAMIIAGALIGLGVGLLLVLLRRALDVRV----RAHTD
A0A1F1X071      -------------------PDREKFLLAGAAFGLLVALGLAWLRDRNDSRL----RTADD
A0A3R8RWC7      -------------------PDREKFLLAGAAFGLLVALGLAWLRDRNDSRL----RTADD
E3B8H1          -------------------PKWPVNLLIGAFLGLVAGTVLVVLRKQLDSRI----RHTSD
A0A0Q5AWK6      -------------------PNWLRNLLLGAAGGLVLGFVVAFLRRALDIRV----RTVDQ
A0A3N1NLD3      -------------------PNWLRNLLLGAAGGLVLGFVLAILRRALDIRV----RTVDD
A0A3N2FVI8      -------------------PNWLRNLLLGAAGGLVLGFVLAILRRALDIRV----RTVDD
A0A2S5XDQ6      -------------------PDWVRNILLGALGGLVLGFGLAFLRRALDIRV----RTVDD
A0A2S5XNN6      -------------------PDWVRNILLGALGGLVLGFGLAFLRRALDIRV----RTVDD
A0A2S5WZJ5      -------------------PNLQTNLLLGAGIGIVLAYVFVFLRKALDVKV----RTSKD
K6WHS4          -------------------PRYGRTVLIALTLGICMGIGIVVLVERADTRI----RSEDS
S3X7T8          -------------------PSPAKYIIAGLLAGIILGYAIALIRHLADRRI----HTTDD
A0A261FE22      -------------------PNVKGNMMMGAFAALIIAAAGAVIREMSDNSI----HTKAE
A0A0J6YE86      -------------------PKRARNIAVGLVLGLVLGVGFALIRDLLDNTV----KDRTT
A0A439DNZ6      -------------------PKTARNIALGLALGLALGIGLAILRDLLDNTV----KDRQN
A0A1E4BP96      -------------------PNTTLNLALGGLVGLALGIAYAVMRSVLDSRI----REPQD
A0A151BT98      -------------------PDLKKALELALAVGLLLGVAMALLRHFMDNRV----RTVED
A0A2Y8ZRF8      -------------------PDIKRTLELAFAVGLLLGVAMALLRHFMDNRV----RTVED
A0A2R9UAT1      -------------------PNVRLALAIGGVAGLVVGLMIALLRFTLDRRI----RSAEL
A0A1F1IHY9      -------------------PNLPLALSIGGALGLLAGLGVAVVRHVLDNKI----RSAAA
A0A3L8NYD3      -------------------PDYRINLLAGGIAGIVAGYLLALVRRQLDSRI----RTVDD
A0A1Y4CKD6      ------------------EPSQSRIWGFGVMGGICTAALVVGLIALFNNTI----KTAED
A0A0Q7KBQ4      -------------------PNVPLNIAVGLLLSLFVAIAGAVLRDLLDRTV----KTRQE
A0A2S8WHZ8      -------------------PNTKLSLALGGVIGLALGLGYALTRNHLDRRI----RSVEA
A0A1Y4CTD2      -------------------AYRYLGAAIAALGAVALIALIYLLRNTV--------KTAEQ
A0A3N3ZPU0      -------------------PDLRLNLLVGVGVGLLLAALYVLARSLFDRKV----RSSEA
A0A359IQX7      -------------------PNWKANLPIGAIAGLVIGYGIAFIRRSIDGRV----RTQAE
A0A0Q9LZR0      -------------------PNTRRNLALGFVLGLMLGLGYALLRSQLDRRV----REPEV
A0A1F1J417      -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
A0A2A8D6P2      -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
A0A448USF4      -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
A0A1F1QKB0      -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
A0A1F0THV9      -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
A0A2I1VJQ6      -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
D8USQ4          -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
E3H5W1          -------------------PNYMQNGLIGAGAGLVLVYLAIFLRRSVDQRI----RTRDD
A0A448PRK6      -------------------PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDD
A0A433EDP2      -------------------PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDD
A0A231VTW0      -------------------PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDD
A0A433ECD0      -------------------PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDD
U7V3Z1          -------------------PNYTRNTLIGAVAGLVLVYVVIFLRRSVDQRI----RTRDD
A0A1N7E3F1      -------------------PQPLTNMALGVLIALFAAVTGLVLRDRLDTTI----KTAET
A0A372P1T1      -------------------PQPLTNMALGALIALFAAVSGLVLRDRLDTTV----KTAET
A0A1L2ZMV4      -------------------PVLRTNLMYGAIAGLILAALFVFIKHLFDVRI----RSTEQ
A0A1N5CK61      -------------------PNTKLNVLAGALAGLVLVFAAIFLRKAIDVKV----RTRDD
A0A2R7Z032      -------------------PNYRNGAIKGAGGGLVLAYVILIARRLIDRRI----RSVKD
A0A1I0W453      -------------------PNYESAAMKGALGGLGLAYAFLIGRRLIDRRI----RTTKH
A0A1H4LCS9      -------------------PNYQKAAMYGAAGGLGLCYAFLVGRRLIDRRI----RSAKH
A0A0Q6VV12      -------------------PDYAKAAMKGAAGGLALAYAFLIARRLIDRRI----RSVKH
A0A0Q9QB08      -------------------PDYRAAAIKGALGGLALAYAFLIARRLIDRRV----RSAKH
A0A1M6K628      -------------------PNWARNLALGLALGLLCGFGAVVLRRSLDRRV----RQADE
A0A1S1CAD0      -------------------PNYEQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
G5ET14          -------------------PNYEQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1E9DXX2      -------------------PNYKQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1E8S156      -------------------PNYQQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1E8S5S2      -------------------PNYQQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1S1DFA8      -------------------PNYQQNVLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A2I1Z490      -------------------PNYQQNVLVGAATGLALVYLAIFLRRALDQRI----RTRDD
A0A1F0DAA9      -------------------PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDD
A0A1F0PHK9      -------------------PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDD
A0A1F0VZG6      -------------------PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDD
A0A1E9G8X4      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1E9IAW2      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1E9ZBC9      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1E9ZDP4      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1F0R6B5      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1F0Z7N5      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1F1D897      -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
D2NP38          -------------------PNYQQNTLIGAGTGLVLVYAAIFLRRALDQRI----RTRDD
A0A1F1FV74      -------------------PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDD
A0A1E9M791      -------------------PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDD
A0A291DEI8      -------------------PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDD
A0A1S1D5T1      -------------------PNYQQNVLVGAATGLALVYLAIFLRRALDQRI----RTRDD
A0A1E8TRD6      -------------------PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDD
A0A1F0XT88      -------------------PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDD
A0A1F1EVP5      -------------------PNYQQNVLVGAAAGLALVYLAIFLRRALDQRI----RTRDD
C6R548          -------------------PNYQQNVLVGAVAGLALVYLAIFLRRALDQRI----RTRDD
A0A0K2RXS2      -------------------PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDD
A0A1F0KX60      -------------------PNYQQNVLIGAVAGLGLVYLAIFLRRALDQRI----RTRDD
A0A2T0UZ65      -------------------PNVTKYVLAGAVAGAALAYAWIFIRRLSDTRI----RTSKD
A0A1R4JTI6      -------------------PNVRMALALGALVGLVVGLGVAALRSLNDRRI----RGVKV
A0A0G3V3F3      -------------------PHPTRSAVVAFLLTCILVGELIVASRAIGDRIGRTGDDDAD
A0A0Q7QDF6      -------------------PDARRTYVLFGLAGLLLGLLLAALRNLATATV----TSSDA
A0A3S0V9U6      -------------------PNVKKYVLFGAAAGLIIVYLVVFIRRFMDVRV----RTTKD
A0A261FQA1      -------------------PNKPRLIFMGTLAGLVLALVVIVVIDVSDKRV----RDTAD
A0A1Q2CJ92      -------------------PNYVRNLALGAALGLLLGLGIVVGRQSFDRRI----RRAHE
A0A2T0S3C8      -------------------PKPLRNLALAALLGLLAGGVAAVLRETLDTTV----KTADA
A0A285VUW0      -------------------PNPTRNLAIATLAGLMLGLAYALGMQALDTRL----RSTAD
A0A444BL03      -------------------PDPPRNVLIGIGLGLLVAYLLVFVRRQLDTRL----RSAQD
A0A1C6T1J1      -------------------PQPLRNFTIGGLLGLVAGVALAVLRGMADVRL----RDAAG
A0A2W2CFC8      -------------------PQPVRNVLIGTLIGLLAGVGLAILRGIADLRV----RDGAS
R4LD52          -------------------PRPVRNLVLAALLGLLTGAAGAVLREVLDTTV----KTVEG
A0A2N3YJR1      -------------------PDPRRNTLVGLVGGLFLAYALIFVRRQLDTRV----RSAED
A0A2W2A4B0      -------------------PRTRANAALGGAAGAGLGVLAAFLRWALDTKV----RGRDE
A0A1H7N9P7      -------------------PRTSLNLAVGVLAGLLLGCGLALARDRLDTRV----RDAAV
A0A1M7V0F8      -------------------PRTSLNLAVGVLAGLLAGCAAALVRDLLDNRV----RDAGV
A0A1Q2CRV2      -------------------PKPLQNLAIGGLVGLLLGAGQALLRDVLNTVV----RSRRD
A0A101KZQ4      -------------------PNFKIAIAVGLLVGLFMAFAYAMLRHAFDRRI----SSIES
A0A1H4I042      -------------------PNLMRNLALGLFAGILFGVACALGREMIDNTV----KKHED
A0A022KX11      -------------------PNPTRNLALGLLAGLVLGLGLAFIRHALDTKV----RGEED
A0A2N3R006      -------------------PKWKLNILVGIVGGLILGVFAALLKDVLSKRI----QDDDE
A0A255G8R8      -------------------PKVAQNLALGLLLGLALGFAAALVRERLDTRV----RNEAD
A0A345NSU7      -------------------PDPERNLALGALAGLLLGVAFALARQALDQRV----RGTAD
A0A0W8I9Y2      -----------------------------------MGLLYAFARFKMDRRI----KSVEE
A0A1U2GAT5      -------------------PRTHRNVALGFGLGLLVGAVAAYLRYRFDNRV----RSVAD
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      VRETFGTPVLGIIPEDDRLADHREIIETGTSGGRGHHAF---------------------
A0A348NU28      LSQVVPAPVLGSISRVRGNGERGLYVAREPLGHT--------------------------
A0A1M3LEY6      VRQITDAPILGGIAFDKLAPKRPLIVQSEPNSPR--------------------------
A0A222TG79      VVEVTESPVLAVVPRFPSAADSPVSFGAGSSPA---------------------------
A0A1L2ZMQ6      IQK-VGMSAVGTLPSDPRLSRGRQVLPVVYSAETRTDRSYHAYS----------------
A0A0Q5M6Z7      IERLLGAPVIGTIPASPALEDRRR------VTDSDSGDDAVELFTI--------------
A0A3L7ADK2      LEQRYGTSVLGTIPMNPFLRKGSQLLSQLTETSTESRHASFAMA----------------
A0A0G3V3M7      TEGAARMPVIAEIPVMNLDRSLRF----------QVTTAVDPTSLM--------------
A0A1H6WL79      IERLFGLAVVGTLPLDKRLSEKSS-----VLESTSVVHRVPGGHAM--------------
A0A1Q2CI19      IAEALDMPIVGVVPKITAAQRRNK----------EILTVTQPLSPY--------------
W6JTW4          IQAALGLPIIAEVPKLPRAKRSDA----------YHMVLDQPLSPF--------------
A0A0A0JTY0      IHNALQMPIIAEVPRLKRAQRSRA----------SIAVATDPLSIY--------------
A0A0A0JXF2      IGDALSMPIIAEVPRLKRSQRNRN----------SIAVVEDPLNLY--------------
E6S8H2          IAAALRLPIIAEVPKMSRSLRRRR----------SIGVADEPLSPY--------------
A0A0A0JGH0      VHAGLRLPIIAEVPRLKRSQKGER----------TITVAVDPLSPY--------------
N0E4U7          VHAALRLPIIAEVPRLSQAQKRKA----------SIMVAADPLDPY--------------
A3TMH6          IAAALALPIVAEVPRLGRTKRRDK----------TIGVAEQPLSPY--------------
A0A0A0IYK2      IHGALRMPIIAEIPRLRRSERHQG----------AIAVAEDPLSNY--------------
A0A0Q9L0H3      IASALRMPIIAEIPRLKRSQRNSA----------SIAVASDPLSNY--------------
A3TMK0          IHSALRMPIIAEVPRLKRSQRNRA----------TLGVLEDPLSLY--------------
A0A3E2DN22      IEELTGSGILSVIPDDKKLAEQRE------------KSIVHISGVT--------------
A0A3Q9ULZ9      VEELTGRGVLAIIPEDRQLSKQRK------------TGDLGLSGIT--------------
A0A3S9JFL2      VEDLTGHGVMAVIPEDRQLTKQRK------------SGDLELAGIA--------------
A0A0Q5JKD6      ITDAVDASVVGVLPVDKELAGGRAVFSFDDIKDGRGSFAHK-------------------
A0A0Q9TBP0      VRQALDAVVLARVPQWSER-----------SHRDRLVTLVDPHSPA--------------
A0A346XTB0      PEIVLGVPPLGEIPLYRMT------------SEDQLTGLLRVDPSA--------------
A0A2W6DK08      AGRAYRLPVLAEIPQARHS----------ERRNFAVITASEPESSA--------------
A0A2S0LQ32      IEDILQSSVLAVVPRSTDL-------------SAKGRRNVDGLGQA--------------
A0A2N6V1R5      VEELLGSSVLAVVPKSTEL-------------NAKGRQNVDGLGQA--------------
G9PHS6          VEELLGSSVLAVVPKSTEL-------------NAKGRQNVDGLGQA--------------
U1PLM7          VEELLGSSVLAVVPKSTEL-------------NAKGRQNVDGLGQA--------------
A0A351ETF8      VEQATGLAILGTIPGYQL------------NSDQVVEVIERPKSLA--------------
A0A349B7N2      AEEAFGLPVVAEIP----------LLRRRQRRNSEVVSAERPRSRI--------------
A0A346Y185      PSRMLKAPLLGTVPSFEEIGLTGSVPTVEAPKSPAG------------------------
A0A259S8H9      VAALVGAGVLGRVPRM--------------RKSGQGRNAALARAVA--------------
A0A0Q5L115      VESRFGVGVIGTIPQNDALAEHGGLVAALPNATADDRHVNFAMS----------------
A0A2W1Z497      IEAAFGVPVLGTIPLNPALTDHRQLVDALPNRTPEERRVNFATS----------------
A0A1H6YPK1      VEIQFGVPVVGTVPWDGAIAKKGP---------LGAVPGFAFT-----------------
A0A2R7MGI0      ITDTVDASVVGVLPVDKELANGRA--VFSFTDIRDGRGSFAHK-----------------
A0A2T7WQY4      ITAAVGASVVGVLPIDKELANGRA--VFSFTDTHDGRGSFAHK-----------------
A0A1G6GTN3      ITDAVDASVVGVLPVDKELASGRA--VFSFDDIKDGRGSFAHK-----------------
A0A1N7DLV3      ISDSVDVSVVGILPVDKELAAGRA--VFSFDDIRDGRGSFAHK-----------------
A0A1V2NSB5      ISDSVDVSVVGILPVDKELAAGRA--VFSFDDIRDGRGSFAHK-----------------
A0A0Q5Q5L3      ITDAVDASVVGVLPVDKELAAGRA--VFSFDDIRDGRGSFAHK-----------------
A0A0Q6DVM4      ITDAVDASVVGVLPVDKELAAGRA--VFSFDDIRDGRGSFAHK-----------------
A0A1R3WWR6      ITDTIAASVVGILPVDKELASGRA--VFSFDDIRDGRGSFAHK-----------------
A0A2S5UYV0      LASAAGVGSLGRIPKSPQLMGKNR--------ASNDADAIAA------------------
A0A2S5ULV5      LATASGAGTLGRIPKSPQLMGKNR--------GTNDADAIAA------------------
A0A2S5X9U6      LAAASGAGTLGRIPKSPQLMGKNR--------GTNDADAIAA------------------
A0A3Q9IY80      VEKETGLSVVGTIPDEKSFTADNRLLPVDGISSGSHADLFGVS-----------------
A0A0F0LP73      VAAIVGAGVLGRVPKFDPDGRSKK-------DAIARAVAH--------------------
A0A1F1X071      VTDVVGLPTLGALPDAKELARGKD-------GVLPEPTSFPSR-----------------
A0A3R8RWC7      VTDVVGLPTLGALPDAKELARGKD-------GVLPEPASFPSR-----------------
E3B8H1          LEKVTGVGTLGVIPKAKNLQTKSR-------GGL-GALGSTS------------------
A0A0Q5AWK6      LTELFGVGVLGRIPKAGR-RAGRK-------GET--VDRITA------------------
A0A3N1NLD3      LTQLFGVGVLGRIPKMGKGRVGRR-------GDARAVDGITA------------------
A0A3N2FVI8      LTQLFGVGVLGRIPKMGKGRGGRR-------GDARAVDGITA------------------
A0A2S5XDQ6      LTELFGVGVLGRIPK--AGRPGRT-------GGRRGTDALTA------------------
A0A2S5XNN6      LTELFGVGVLGRIPK--AGRPGRT-------GGRRGTDALTA------------------
A0A2S5WZJ5      LATATRSGSLGRIPKSPQL--MGKNRG----ANDADAIA---------------------
K6WHS4          VLEVTELPILGDLPDDPAV--DRNVVN----FGVGGSPA---------------------
S3X7T8          ITDRIEKPIFATIPTSSTI---ETLST----DLTDDFKA---------------------
A0A261FE22      IQSIVPAPILAAVPKSPTLAGRTPAVIVKPRGHA--------------------------
A0A0J6YE86      LEQIANVGLVGTVPLDKER-RRHAAIA----FENDNSVI---------------------
A0A439DNZ6      LEEITGVGVVGSIPLDKER-KRSPAKS----LDNDNSAF---------------------
A0A1E4BP96      VERNTGASVVGVLPLDHDLDNRREVLSFT--GASGNVVRGAL------------------
A0A151BT98      LETLVQRPVLSIVPRVG---GGHRVVDT---SDHPSGAM---------------------
A0A2Y8ZRF8      LEALVQRPVLSIVPRVG---SGQRVVDT---SDSPSGAM---------------------
A0A2R9UAT1      VERETGVAVVGTVPVEKSFTAANRLIPVGGQRDERLFAV---------------------
A0A1F1IHY9      LESRFGLTILGTVPESTRSARNRRRRD----GGDVINLAGRVDGETSPKQHQDSFRL---
A0A3L8NYD3      MESLVGTSVLTILPESDELDRVGDDGL----VGSQTGPA---------------------
A0A1Y4CKD6      LESVSSMVCLGALPEVRAK-ARKRSAASRYVSALDKRVSHGF------------------
A0A0Q7KBQ4      AEELSGGAVLATLPFDRQL-KKQAL------TSEGHGAL---------------------
A0A2S8WHZ8      IERL-GVSVVGTIPEDQRLTEGRSVVETGSIVHDDRAAHAF-------------------
A0A1Y4CTD2      ASDLLDGRVLGTVPF-----ERKRVVR----GGDERSVPALVLSSPLVSMGF--------
A0A3N3ZPU0      VANATGLAILGTIPLDKRLTAKRGVIPTAPPRKDREAWAT--------------------
A0A359IQX7      VEELTGAGVIGVIPKVAEL-EQQRVEE----GQVSLGEA---------------------
A0A0Q9LZR0      VERDFGVTVAGAIPETSALVRKKGGLVPLVVAGTSKEKDPVHS-----------------
A0A1F1J417      AIKATNSNILGVLPVSDDL-AEENIVH----ASNDDHIA---------------------
A0A2A8D6P2      AIKATNSNILGVLPVSDDL-AEENIVH----ASNDDHIA---------------------
A0A448USF4      AIKATNSNILGVLPVSDDL-AEENIVR----ASNDDHIA---------------------
A0A1F1QKB0      AIKATNSNILGVLPVSDDL-AEENIVR----ASNDDHIA---------------------
A0A1F0THV9      AIKATNSNILGVLPVSDDL-AEENIVH----ASNDDHIA---------------------
A0A2I1VJQ6      AIKATNSNILGVLPVSDDL-AEENIVH----ASNDDHIA---------------------
D8USQ4          AIKATNSNILGVLPVSDDL-AEENIVH----ASNDDHIA---------------------
E3H5W1          AIKATNSNILGVLPVSDDL-AEENIVH----ASNDDHIA---------------------
A0A448PRK6      AVKATGSSILGVLPTSDDL-TEENIVT----GSSNDHIA---------------------
A0A433EDP2      AVKATGSSILGVLPTSDDL-TEENIVT----GSSNDHIA---------------------
A0A231VTW0      AVKATGSSILGVLPTSDDL-TEENIVT----GSSNDHIA---------------------
A0A433ECD0      AVKATGSSILGVLPTSDDL-TEENIVT----GSSNDHIA---------------------
U7V3Z1          AVKATGSSILGVLPTSDDL-TEENIVT----GSSNDHIA---------------------
A0A1N7E3F1      LRQVAKSSVLGLIGYERDA-RRHPLVL----RDQGRSVR---------------------
A0A372P1T1      LQKVARSSILGVIGYERDA-KRHPLIL----RDQGRSSR---------------------
A0A1L2ZMV4      VETTTGHPVLGTVPQDKRLDHHRQVITVGEPGDKQGWAT---------------------
A0A1N5CK61      VAKATKTGVLGTLPETEQL--SEKNLL----TNQDDHTS---------------------
A0A2R7Z032      VETATGSAVIGIIPKVDALNRTHRGVR----GDLGQA-----------------------
A0A1I0W453      VEEATGASVLGIIPKEDSLGRSHRGVR----GDLGKA-----------------------
A0A1H4LCS9      VEEATGASVLGIIPKEDALGRGHRGVR----GDLGRA-----------------------
A0A0Q6VV12      VEDATGAAVLGIIPKEDALGRTHRGVR----GDLGRA-----------------------
A0A0Q9QB08      VEDATGAAVLGVIPKEDALGRVNRGVR----GDLGRA-----------------------
A0A1M6K628      VEELTSATALGVVPTAVELASGVSLVN----DSGTA------------------------
A0A1S1CAD0      ATKATGASILGVLPVSDDL-NEDNIVK----GDTDDHIA---------------------
G5ET14          ATKATGASILGVLPVSDDL-NEDNIVK----GDTDDHIA---------------------
A0A1E9DXX2      ATKATGASILGVLPISDDL-NEENIVN----GDTDDHIA---------------------
A0A1E8S156      ATKATGASVLGVLPVSDDL-NEDNIVK----GDTDDHIA---------------------
A0A1E8S5S2      ATKATGASVLGVLPVSDDL-NEDNIVK----GDTDDHIA---------------------
A0A1S1DFA8      ATKATGASVLGVLPVSDDL-NEDNIVK----GDTDDHIA---------------------
A0A2I1Z490      ATKATGASVLGVLPVSDDL-NEDNIVK----GDTEDHIA---------------------
A0A1F0DAA9      ATKATGASILGVLPVSDDL-NEENIVK----GNTDDHIA---------------------
A0A1F0PHK9      ATKATGASILGVLPVSDDL-NEENIVK----GNTDDHIA---------------------
A0A1F0VZG6      ATKATGASILGVLPVSDDL-NEENIVK----GNTDDHIA---------------------
A0A1E9G8X4      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1E9IAW2      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1E9ZBC9      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1E9ZDP4      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1F0R6B5      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1F0Z7N5      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1F1D897      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
D2NP38          ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1F1FV74      ATKATGASILGVLPVSEDL-NEENIVK----GDTDDHIA---------------------
A0A1E9M791      ATKATGASILGVLPVSEDL-NEENIVK----GDTDDHIA---------------------
A0A291DEI8      ATKATGASILGVLPVSEDL-NEENIVK----GDTDDHIA---------------------
A0A1S1D5T1      ATKATGASILGVLPVSDDL-SEENIVN----GGTDDHIA---------------------
A0A1E8TRD6      ATKATGASILGVLPVSDDL-SEENIVN----GDTDDHIA---------------------
A0A1F0XT88      ATKATGASILGVLPVSDDL-SEENIVN----GDTDDHIA---------------------
A0A1F1EVP5      ATKATGASILGVLPVSDDL-SEENIVN----GDTDDHIA---------------------
C6R548          ATKATGASILGVLPVSDDL-SEENIVN----GDTDDHIA---------------------
A0A0K2RXS2      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A1F0KX60      ATKATGASILGVLPVSDDL-NEENIVN----GNTDDHIA---------------------
A0A2T0UZ65      VEDLTGSSSLGVIPLSNEL--RKARGG----RSSGLGLA---------------------
A0A1R4JTI6      LEETFGLTVLGTIPAMAGLGRRAQRNR----TQSKDSNAEVESRSALLELTGHTGRDDFH
A0A0G3V3F3      VARITGLPVLGRIPKGEGF------------------ET---------------------
A0A0Q7QDF6      LTEQVKAPVIGAVAQDRHV-ADHPLIS----TLSNQHPR---------------------
A0A3S0V9U6      MEESTGLGVLGVLPKTNAL--DQNSFL----EDAADHQS---------------------
A0A261FQA1      IQRILYSPVISSVPKSDTF-RGTAPAV----ISDPSSKA---------------------
A0A1Q2CJ92      AEEVAETSSLGIVPAAAEL---AGESA----LVTGSSAA---------------------
A0A2T0S3C8      LHELAGAPVLAGVPFDADA-RSGPLRL----TGSGHSPR---------------------
A0A285VUW0      VEALTGRPVLSTVPVLPTAGRTSSMYI----ENDPFGPQ---------------------
A0A444BL03      VEAATGASVLGVVPVTSEL-RVQGGRG----RLDHLGIA---------------------
A0A1C6T1J1      LQRVTGSPLLGEIPLDTAA-RTAPLIV----GEAATSAR---------------------
A0A2W2CFC8      LRRVTDSPLLGEIPLDNDA-RTAPLII----GVAAASAR---------------------
R4LD52          LQALAAAPVLAAVPFDDDA-KEGPRAL----LGTGHSAR---------------------
A0A2N3YJR1      VEKETGASVLGVVPVTPEL-RAARGRG----RLDALGAS---------------------
A0A2W2A4B0      VQELWDLPVLGDIGFDPEA-SKQPLVL----RDARASAR---------------------
A0A1H7N9P7      VAQLTGLPVVGSIPTRPSG-STAHPAV----DADPHGVV---------------------
A0A1M7V0F8      VAELTGVPVVGAIPARSPR-SAPGAVV----ETDSHSVA---------------------
A0A1Q2CRV2      IEQVSDQAILGAIPLDESGDVLVLNSDPHGL------------R----------------
A0A101KZQ4      VESSTGHSVIGTIPQTDTLDREQRLITSIGGNDRNEEHAGEYAV----------------
A0A1H4I042      LESITGVAVVGDIP----MDKARRGTPAISFGTENSQ------I----------------
A0A022KX11      IRAHSDAPMLAGLPLESRGSKRGLISVEED----PHGRH---------------------
A0A2N3R006      ISEYIDAPIIGRIPEEELLNSAKPVIVSE-----PGSPV---------------------
A0A255G8R8      VAAVTTASQVGSIPYVAGTPEHPLELGA------HTDQR---------------------
A0A345NSU7      VEAISDRPVLSTIPMRKADDAHSIYLELD-----PFGPQ---------------------
A0A0W8I9Y2      IRDGFGVAVLGVIPTDDRLADHREIVETGFSAGRGHHEF---------------------
A0A1U2GAT5      LVNVVGDNVLSVVRFQPDLSNGPVAFLD------GGAPV---------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      -SEALRELRTNLSFVS--V----------------------DAP----PRVVVVTSSMPG
A0A348NU28      -SEEFRRIRAALSYSG--V----------------------AEK----VQRLMVTSVSPG
A0A1M3LEY6      -AEAFRSLRTNLQFLD--V----------------------EGG----PRSFVVTSSVPS
A0A222TG79      -SEAYRRLRTNLSFIG--V----------------------DSP----HRRFAVTSALEG
A0A1L2ZMQ6      --EALRELRTNLAYMD--V----------------------DNP----PRVIVVTSSVPG
A0A0Q5M6Z7      -SESLRELRTNLSYID--V----------------------DQP----PKVIVVTSSIPG
A0A3L7ADK2      --ESLRELRTNLSYVD--V----------------------DNP----PQVFVVTSPNPG
A0A0G3V3M7      -AEAYRSFRTSLVAMW--Q-----RHPTNNRPVLAGASEPEATP----LRVLLVTSPGPA
A0A1H6WL79      -AEALRELRTNLNFID--V----------------------DNP----PRILLITSSLPS
A0A1Q2CI19      -ADGYRSVRAALAHGQ--AEAAPA----------------RGHQ----SLVVLVSSAHVA
W6JTW4          -ADAYRAARAATTHSV--E-------TSRAAAPRGPRENDPEPQ----AVAVLVTSAQPS
A0A0A0JTY0      -SDGYRAARTALVHTT--GQVMPGDYTPRRAASEVPEKQ-AATG----ARLIVVTSAHAA
A0A0A0JXF2      -SDAYRAARTALSHTA--GQVMPSDYTPRR--STVEPRR-SASS----ARLVLITSAHAA
E6S8H2          -ADGYRGARTALVHTS--SLLVQGD--DRR--PTSPPEPVSAAS----ASLILVTSAHPR
A0A0A0JGH0      -SDAYRAARTALMHTV--SRQAPGEYMGRR--AARPEPRPVVEG----ARLILVTSGNAA
N0E4U7          -SDAYRAARTALMHTV--SRKMTGDYTGRR--AATAERGGTATG----ARLILVTSANAA
A3TMH6          -ADAYRGARTAIVHTA--SQRLSVGSAPRH--LLDGPAT-QLEG----ARVVLVTSAHPA
A0A0A0IYK2      -SDGYRAARTALVHTT--GQIMPGDYTPRR--SAAGARP-AAKG----ARLILVTSAHAA
A0A0Q9L0H3      -SDGYRAARTALVHTS--GQIMPGDYTPRR--PGGEESR-SRQG----GRLVLITSAHAA
A3TMK0          -ADGYRAARTALTHTA--GQVMPGDYSPRR--SAIEPRR-PANT----ARLVLITSAHAS
A0A3E2DN22      -GEAFRHLRTNLRFAN--V----------------------DNP----PRAVVVTSANPG
A0A3Q9ULZ9      -AEAFRQLRTNLRFIN--V----------------------DHP----PKAVVITSANPG
A0A3S9JFL2      -GEAFRQLRTNLRFIN--V----------------------DHP----PKAVVVTSANPG
A0A0Q5JKD6      --EAMRELRTNLQYVD--V----------------------DRP----ARVLVVTSPLPG
A0A0Q9TBP0      -SEEYQRLGVNVRFMV--ATGA-------------------QES----APIVLLTSGQES
A0A346XTB0      -AEAYEFVLSSIEFAL--A----------------------DLD----GKSLLITSTLPG
A0A2W6DK08      -AEAYRSLRSSIMFTE--NRMNHFDREDMVLDRSAVDT---TQP----PQVILVASACAA
A0A2S0LQ32      -AEAIRLLRTNLRFVD--V----------------------DNP----PRAIVMTSANPG
A0A2N6V1R5      -AEALRHLRTNLRFVD--V----------------------DNP----PRAIVMTSANPG
G9PHS6          -AEALRHLRTNLRFVD--V----------------------DNP----PRAIVMTSANPG
U1PLM7          -AEALRHLRTNLRFVD--V----------------------DNP----PRAIVMTSANPG
A0A351ETF8      -AERYEAVLTAIEFAS--I----------------------GEP----VSSVLFTSAVPG
A0A349B7N2      -AEAYRGLRTSVQYMG--VVTSRVGESPSDLRRQQTKRR-DRSD----GTVVLVTSPGPA
A0A346Y185      --EAYQFLVGALAFAL--A----------------------ETG----GQSVVLTSASPV
A0A259S8H9      -HEAYRQIRTGLRFAS--V----------------------DQE----VRVVMVTSANLG
A0A0Q5L115      --EALRELRTNLAYVK--V----------------------DAQ----PRVIVMTSPQPG
A0A2W1Z497      --EALRELRTNLSYVH--V----------------------DER----PKVLVVTSPLPG
A0A1H6YPK1      --EAMRQLRTNLQFMN--V----------------------DHP----PRVLVVTSPVPG
A0A2R7MGI0      --EAIRELRTNLQYVD--V----------------------DRP----PRVIVVTSPLPG
A0A2T7WQY4      --EAVRELRTNLQYVD--V----------------------DHP----PRVIVVTSPLPG
A0A1G6GTN3      --EAMRELRTNLQYVD--V----------------------DRP----ARIVVVTSPLSG
A0A1N7DLV3      --EAMRELRTNLQYVD--V----------------------DRP----PRVMVVTSPLPG
A0A1V2NSB5      --EAMRELRTNLQYVD--V----------------------DRP----PRVMVVTSPLPG
A0A0Q5Q5L3      --EAMRELRTNLQYVD--V----------------------DRP----ARIMVVTSPLPG
A0A0Q6DVM4      --EAMRELRTNLQYVD--V----------------------DRP----ARIMVVTSPLPG
A0A1R3WWR6      --EAMRELRTNLQYVD--V----------------------DRP----ARVMVITSPLPG
A0A2S5UYV0      --ESFRRLRTNLRFAS--V----------------------DEE----IRSMVITSSNAG
A0A2S5ULV5      --ESFRRLRTNLRFAS--V----------------------DEE----IRSIVVTSANAG
A0A2S5X9U6      --ESFRRLRTNLRFAS--V----------------------DEE----IRSIVVTSANAG
A0A3Q9IY80      --EAMRELRTNLQFMD--V----------------------DNP----PRIIVVTSPLPG
A0A0F0LP73      --EAHRQIRTGLRFAS--V----------------------DQE----VRVVMVTSANLG
A0A1F1X071      --EALRKLRTNLRYID--V----------------------DNP----PRSIVVTSSAPG
A0A3R8RWC7      --EALRKLRTNLRYID--V----------------------DNP----PRSIVVTSSAPG
E3B8H1          --EAFRMLRTNLRYVS--A----------------------EQP----PRSLVITSAVQS
A0A0Q5AWK6      --EAYRALRTGLRFSS--V----------------------DDE----TRSVVITSANQA
A0A3N1NLD3      --EAFRALRTGLRFSS--V----------------------DDE----TRSVVITSANQA
A0A3N2FVI8      --EAFRALRTGLRFSS--V----------------------DDE----TRSVVITSANQA
A0A2S5XDQ6      --EAFRSLRTGLRFSS--V----------------------DEE----TRSVVITSANQA
A0A2S5XNN6      --EAFRSLRTGLRFSS--V----------------------DEE----TRSVVITSANQA
A0A2S5WZJ5      -AESFRRLRTNLRFAS--V----------------------DEE----IRSMVITSSNAG
K6WHS4          -AEAFRHLRTNLSFMD--V----------------------DSP----ARMIAVTSPSPG
S3X7T8          -AEAIRKLRTNLRYAL--I----------------------DST----SKVILVTSSVMG
A0A261FE22      -AEEFRRLITNLSFVK--N----------------------DRGNR--GNVLVVTSAMLG
A0A0J6YE86      -AEAFRKLRTNLQFLS--V----------------------DNP----PRVIVITSSMPH
A0A439DNZ6      -AEAFRKLRTNLQFLA--V----------------------DNP----PRVIVVTSSMPG
A0A1E4BP96      -TEAIRELRTNLQFMD--V----------------------DDP----PRSIVVTSPLPG
A0A151BT98      -VEAMRRLRTNVKFVN--V----------------------TND----VPAVVVTSARPG
A0A2Y8ZRF8      -VEAMRRLRTNVKFVN--V----------------------TND----VPAVVVTSARPG
A0A2R9UAT1      -SEALRELRTNIQFMD--V----------------------DHP----PRVVVVTSPLPG
A0A1F1IHY9      -TESFKELRTNLQFLR--P----------------------DEA----VSIVTVTSAHPG
A0A3L8NYD3      -AEALRQLRTNLRFVD--V----------------------DKP----PQSIVITSANAG
A0A1Y4CKD6      -RESARAMGARVRDAL--S----------------------ERG----AKVVLVTSSIAG
A0A0Q7KBQ4      -AEAFRVLRTNLQFAN--L----------------------DAK----VESILVSSAVPN
A0A2S8WHZ8      -SESLRELRTNLNYID--V----------------------DNP----PRIIVVSSSVPG
A0A1Y4CTD2      -AEANRRTATRLEAHL--R----------------------SGG----FKTVLVASVEEN
A0A3N3ZPU0      -SEAFRQLRTNLTFAN--V----------------------DDP----PRTVVVTSSVAG
A0A359IQX7      -SEAFRHLRTNLRYVN--V----------------------DSP----PKCIVVTSANAS
A0A0Q9LZR0      -AESFLKLRTNLQFMD--I----------------------DNP----PRIIVITSPLPG
A0A1F1J417      -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
A0A2A8D6P2      -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
A0A448USF4      -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
A0A1F1QKB0      -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
A0A1F0THV9      -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
A0A2I1VJQ6      -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
D8USQ4          -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
E3H5W1          -HESIRQLRTNLRFVN--I----------------------DNP----PSSFIVTSAVPG
A0A448PRK6      -QESIRQLRTNLRFVN--I----------------------DEP----PRSFLVTSAVPS
A0A433EDP2      -QESIRQLRTNLRFVN--I----------------------DEP----PRSFLVTSAVPS
A0A231VTW0      -QESIRQLRTNLRFVN--I----------------------DEP----PRSFLVTSAVPS
A0A433ECD0      -QESIRQLRTNLRFVN--I----------------------DEP----PRSFLVTSAVPS
U7V3Z1          -QESIRQLRTNLRFVN--I----------------------DEP----PRSFLVTSAVPS
A0A1N7E3F1      -AEAFRSLRTNLQFIG--V----------------------DRQ----PKSLVVTSCLPG
A0A372P1T1      -SEAFRSLRTNLQFIG--V----------------------DRQ----PKSLVVTSCLPG
A0A1L2ZMV4      -SEALRELRTNLTFSR--V----------------------DNP----PRIIVVTSALAG
A0A1N5CK61      -QEAIRQLRTNLRFVN--V----------------------DNP----PKSVLVTSSEPG
A0A2R7Z032      -AEAFRQLRTNLRFLD--V----------------------DNP----PRRIVITSALAS
A0A1I0W453      -AESFRQLRTNLRFVD--V----------------------DNE----PRKIVVTSALAG
A0A1H4LCS9      -AESFRQLRTNLRFVD--V----------------------DNE----PRRIVVTSALAG
A0A0Q6VV12      -AESFRQLRTNLRFVD--V----------------------DNE----PRKIVVTSALAG
A0A0Q9QB08      -AEAFRVLRTNLRFVD--V----------------------DNE----PRRIVVTSALAG
A0A1M6K628      -AEALRQLRTNLRFVS--V----------------------DTP----VRSIVVTSPSQG
A0A1S1CAD0      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
G5ET14          -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E9DXX2      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E8S156      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E8S5S2      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1S1DFA8      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A2I1Z490      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0DAA9      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0PHK9      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0VZG6      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E9G8X4      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E9IAW2      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E9ZBC9      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E9ZDP4      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0R6B5      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0Z7N5      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F1D897      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
D2NP38          -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F1FV74      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E9M791      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A291DEI8      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1S1D5T1      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1E8TRD6      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0XT88      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F1EVP5      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
C6R548          -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A0K2RXS2      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A1F0KX60      -QESIRQLRTNLRFVN--V----------------------DTP----PRSFIVTSAVPG
A0A2T0UZ65      -GESFRQIRTNLRFVS--P----------------------DAP----PQSIVVTSASPS
A0A1R4JTI6      VVEAFKELRTNLQFLR--P----------------------DNP----PRIIVVTSAAPA
A0A0G3V3F3      -VEAFRVLRTNLMVLE--A----------------------AGR----PRTVAVVSNTQD
A0A0Q7QDF6      -AEAMRIIRTNLQFLD--V----------------------DRV----SNVYVVTSSVAG
A0A3S0V9U6      -AESLRQLRTNLRFVS--V----------------------DQP----PRSIIVTSPNPG
A0A261FQA1      -AEDIRRLALNLDFIV--P----------------------DKTDM--SNVIVVASSDAS
A0A1Q2CJ92      -AEAIRQIRTNLRFVS--V----------------------DNP----AKSIVITSSNEG
A0A2T0S3C8      -SEALRQLRTNLQFVD--V----------------------DRP----VKTLVITSAMPG
A0A285VUW0      -AEAIRKLRTNLVFVD--V----------------------ASD---AGHSFVVTSSLSA
A0A444BL03      -SESFRQIRTNLRFVG--V----------------------DDP----PRSIVVTSANAH
A0A1C6T1J1      -AEAVRKLRTNLRFVD--V----------------------HEP----ARVIAVTSALQG
A0A2W2CFC8      -AEAIRKLRTNLRFVD--A----------------------DEP----ARVIAITSALQG
R4LD52          -AEALRQLRTNLQYVD--V----------------------DRP----VKTLVVTSAVPG
A0A2N3YJR1      -AESFRQIRTNLRFVG--V----------------------DDP----PRSIVVTSANAG
A0A2W2A4B0      -AEAFRSLRTNVQFLA--S----------------------RPE---GARTLAITSSRPS
A0A1H7N9P7      -AEAVRQFRTNLQFLG--M----------------------QDEERAGARIVAVTSSRSG
A0A1M7V0F8      -AEAFRHLRTNLQFVG--V----------------------QDEDQGGARVLAVTSSRPG
A0A1Q2CRV2      -AEAYRSMRTNLQFLA--L----------------------DKG----GRSIVVTSSVPG
A0A101KZQ4      -AESIRELRTNLQFMN--I----------------------DNP----PRTIVITSALPG
A0A1H4I042      -AESFRKLRTNLSFLS--V----------------------DNP----PRVIVVTSSIPN
A0A022KX11      -AEAVRRLRTNLMFVD--V----------------------TTG----RHSFVITSAVPG
A0A2N3R006      -AEGFRRVRTNLSFMAPME----------------------DTN----CQLIVVTSTGAS
A0A255G8R8      -FEAYRRLRTNVQFVA--A----------------------PQG----RTALVVTSSVPG
A0A345NSU7      -AEAVRQLRTNMMFVD--V----------------------TTG----KHSFVISSTLPG
A0A0W8I9Y2      -SEALRELRTNLSFVS--V----------------------DSP----PKMIVVTSALPG
A0A1U2GAT5      -AEDYRKLRTNLGFVG--G----------------------DRA----VRGIVVSSAAAG
A0A1V8PLV6      --------------------------------------------------MIVISSVEPS
A0A1X6X0E0      -SEQIKAVRTSLNFATI------------------------DQD----AQVILITSPTPS
A0A357ZCV8      -QNAAKTLYANIRFLSP------------------------DKP----IKSIAITSSVPN
A0A2S8MDM2      -AEAFRKLRTNLQFLAI------------------------DSP----PRVLVVTSSVPS
A0A1X6Y1L5      -YEQMKNIRSSIQFAST------------------------K-E----LKSLIVTSPESG
A0A1U3QN81      -AEQYRTIRTNIEFSSV------------------------QTH----LRSILVTSSVPG
A0A1M8I0C2      -SEQYRTIRTNIQFSTV------------------------DNE----IRTLMVTSSGPG
A0A1U3NFN6      -SEQYRTIRTNIEFSSV------------------------DTE----VKSLLITSAGPE
A0A1N1YAY7      -EEYYNALRTNIQLS--------------------------GDK----LKVIAVSSVRPG
A0A2V2CXY5      -TEALNQFRINLGFC--------------------------GDE----VKTIMVTSSLPN
A0A357ZDL3      -QNAIKTLYANIRFLSP------------------------DNP----VKTIAITSSVPN
A0A0F0KYJ9      ----MRELRTNLVYMDV------------------------DNP----PRIIVVTSPLPG
A0A419GS64      -AESYRTLRANILLTNV------------------------DSE----IGSVVVTSPDRG
A0A1I6GVG4      -GEAMRELRTNLQYMDV------------------------DNP----PRIIVVTSPLPG
A0A1I6IST1      -GEAMRELRTNLQYMDV------------------------DNP----PRIIVVTSPLPG
A0A412JBM5      -REAYVRLRTNLMFCVNGD----------------------GDP----CTTFLVTSGSPS
A0A023X491      -AEAYRTLRTSLLYSVV------------------------DEP----PHVVAVTSPGQQ
A0A1Q7WJN6      -IEALRGVRLNVAYA-H------------------------GTG----PLLVSITSPGRS
A0A1C2B334      -AESYRRIRTNLAFAAV------------------------DPA----SRRILVTSASVA
R7Y679          -AEQFRKIRTNLTFANV------------------------DNS----VRKILISSPSQS
A0A0K8Q3D9      ----------------------------------------------------MVTSSMQA
A0A2R7RCA1      --------RTNLSFLDV------------------------DQP----PRIIVVTSSVQA
A0A1E2SNF6      ---------------------------------------------------------MPS
Q6ADE8          ---------------------------------------------------------MPS
A0A1N6CE53      -SEKFRGIRSNIMFSNA------------------------ENE----IGSLLVTSEKTA
A0A1U6THY0      -SEQYRNIRTNILYSSI------------------------DEE----IRSILVTSSGPG
A0A420ZS11      -SEQFKTLRTNIQFSSI------------------------DRK----LKTIMVTSSNPG
A0A1Q7CZ24      -AEQYRVLRHLVETLRK------------------------GAN----LQVVAVTSPGVG
A0A2W6VLC6      ----------------------------------------------------VITSSVPG
                                                                            

A0A2N4T4Q5      EGKSSITANLAVAIA-STG-RDVVVVDGDLRRPVMTELF---G--------------L--
A0A348NU28      EGKSMFASNLGLTLA-GLR-NNVLIIDADLRRPRVADYF---G--------------L--
A0A1M3LEY6      EGKSTTSANLAIVMA-QSG-ARVLLIDGDLRSPSVADLF---G--------------I--
A0A222TG79      EGKTTTAVNLAVCLS-EVG-YKVVVVDADLRRPMVAVRL---G--------------V--
A0A1L2ZMQ6      EGKSSLSANLAVTIA-HTG-QKVIVVDGDLRRPVVSEMF---S--------------L--
A0A0Q5M6Z7      EGKSTLTANLADAIA-SAN-SNVVVIDCDLRRPMQSTLF---S--------------L--
A0A3L7ADK2      EGKSTLSANLAETLAVNSG-KNVVVIDCDLRRPTLSKIF---N--------------A--
A0A0G3V3M7      EGKSISVVNIAAAFA-ETG-ISVLLIDGDFRRPQMYKYF---S--------------G--
A0A1H6WL79      EGKSTVTSNLAATIA-AAG-RDVIVVDADLRRPTVHQVF---D--------------V--
A0A1Q2CI19      EGKSTSTANLAASFA-ETG-KQVLVIDADLRSPDVHEKL---D--------------V--
W6JTW4          EGKTTSVANLAASFA-ESG-RRVLVLDADLRSPDAHNLF---D--------------V--
A0A0A0JTY0      EGKTTSVANLAASFA-ETG-QRVLVLDADLRSPDVHNVF---D--------------V--
A0A0A0JXF2      EGKTTSVANLAASFA-ETG-QKVLVVDADLRSPDVHNVF---D--------------V--
E6S8H2          EGKTTSVANLAASFA-ETG-QRILVLDGDLRSPDTHNIF---D--------------V--
A0A0A0JGH0      EGKTTTVANLAASFA-ETG-QRVLVLDADLRSPNTHTLF---D--------------V--
N0E4U7          EGKTTTVANLAASFA-ETG-QRVLVLDADLRSPDTHSLF---D--------------V--
A3TMH6          EGKTTTVANLAVSFA-ESG-QRVLVLDADLRSPDTHTLF---D--------------V--
A0A0A0IYK2      EGKTTSVANLAASFA-ETG-QRVLVLDADLRSPDAHNVF---D--------------V--
A0A0Q9L0H3      EGKTTSVANLAASFA-ETG-QTVLVLDADLRSPDIHTAF---D--------------V--
A3TMK0          EGKTTSVANLAASFA-ETG-QQVLVLDADLRSPDAHNAF---D--------------V--
A0A3E2DN22      EGKSTVSTHLAVVMA-QAG-EKVVLIDADMRRPVQHKAF---G--------------A--
A0A3Q9ULZ9      EGKSTVGSYLARAVA-RSG-QATVLVDADMRRPMQHTAF---G--------------I--
A0A3S9JFL2      EGKSTVCSYLARSVA-RSG-QATVLVDADMRRPMQHTAF---S--------------I--
A0A0Q5JKD6      DGKSTIAANLAVSIA-ATG-QSVVLIDADMRRPVVGGMF---G--------------F--
A0A0Q9TBP0      EGKTVTSCNLAVSAA-RLG-LNVVLIDADFRRASVAPRF---G--------------L--
A0A346XTB0      DGKTTTTLQLAIAAS-RDR-RRVVLVDADIRARGLTRVL---G--------------A--
A0A2W6DK08      EGKTATVVNLAACFA-EVG-KRVLVLDCDFRGPDAHQYL---G--------------V--
A0A2S0LQ32      EGKSTISAVLAQMLA-ASG-QRTILVDTDLRKPVVHRIF---D--------------I--
A0A2N6V1R5      EGKSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G--------------L--
G9PHS6          EGKSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G--------------L--
U1PLM7          EGKSTMSAVLAQMLA-SSG-QRTVLIDTDLRKPVVHKIF---G--------------L--
A0A351ETF8      DGKTTTAVNVAALAS--KY-MNVLLVDGDMRRPRVHRML---G--------------V--
A0A349B7N2      EGKSTTVVNLAAAYA-ESG-SRVLIVDGDFRRPAVHEFLPEAD--------------V--
A0A346Y185      DGKTVTCLNLAVASA-QDG-RDVVLVDADTRVRGLTRRL---G--------------A--
A0A259S8H9      EGKSETTRALARVLA-ESG-QRTLVIDGDLRRPTIAKGF---E--------------I--
A0A0Q5L115      DGKSTLAANLAESLAVSSD-QRVVVIDCDLRRPTLSKVL---G--------------V--
A0A2W1Z497      DGKSTIAANLARSLAVTST-GRVVLIDCDLRRPVLSAVF---G--------------V--
A0A1H6YPK1      DGKSTMAVMLAAAIA-ESG-RDVVLVDADLRRPTLAKAL---G--------------V--
A0A2R7MGI0      DGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVMGGVF---G--------------F--
A0A2T7WQY4      DGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVMGGVF---G--------------F--
A0A1G6GTN3      DGKSTTAANLAVSIA-ATG-QSVVLIDADLRRPVLGGMF---G--------------F--
A0A1N7DLV3      DGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVLGATF---G--------------F--
A0A1V2NSB5      DGKSTTAANLAVSIA-ATG-QSVILIDADLRRPVLGATF---G--------------F--
A0A0Q5Q5L3      DGKSTTAANLAVSIA-ATG-QSVILVDADLRRPVLGGMF---G--------------F--
A0A0Q6DVM4      DGKSTTAANLAVSIA-ATG-QSVILVDADLRRPVLGGMF---G--------------F--
A0A1R3WWR6      DGKSTTAANLAVSIA-ATG-QAVVLIDADLRRPVLGGVF---G--------------F--
A0A2S5UYV0      EGKSTIATSLAQVLA-QSN-TPTILIDADLRRPTVASVL---G--------------I--
A0A2S5ULV5      EGKSTVATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------I--
A0A2S5X9U6      EGKSTVSTSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------I--
A0A3Q9IY80      DGKSTTSANLAITLA-ANG-SKVVLIDGDLRRPMVATIF---R--------------L--
A0A0F0LP73      EGKSSTTRTLARVLA-ESG-QRTLVIDGDLRRPTVAEGF---D--------------L--
A0A1F1X071      EGKSTVAANLARVMA-RAG-QPTLLVDADLRRPMIAQQF---S--------------V--
A0A3R8RWC7      EGKSTVAANLARVMA-RAG-QPTLLVDADLRRPMIAQQF---S--------------V--
E3B8H1          EGKSTVASNLARVLA-AAG-QHVVLVDTDLRRPVIHETF---D--------------V--
A0A0Q5AWK6      EGKSTIASGLARVTA-DSG-QRTLLIDADLRRPTVAKML---G--------------I--
A0A3N1NLD3      EGKSTIASGLARVTA-DSG-QRTLLIDADLRRPTVAKLL---G--------------I--
A0A3N2FVI8      EGKSTIASGLARVMA-DSG-QRTLLIDADLRRPTVAKLL---G--------------I--
A0A2S5XDQ6      EGKSTIAAGLARVTA-ESG-QRTLLVDADLRRPSVARML---D--------------I--
A0A2S5XNN6      EGKSTIAAGLARVTA-ESG-QRTLLVDADLRRPSVARML---D--------------I--
A0A2S5WZJ5      EGKSTIATSLAQVLA-QSN-TPTILIDADLRRPTVATVL---G--------------I--
K6WHS4          DGKTTVALNLAASLA-EAG-HSVLLVDADLRNPSVAGRV---N--------------L--
S3X7T8          EGKSSVAGNLAKVMA-LAG-DDVILIDADLRRPKVQKNF---D--------------L--
A0A261FE22      EGKTTVSVNIAATFV-EKG-ESVLLIDADVRHPSVAKAL---G--------------I--
A0A0J6YE86      EGKSTTAINIALALA-EAE-HNVVLVDGDMRRPTLSKYL---D--------------L--
A0A439DNZ6      EGKSTTAINLALVLA-EAE-HNVVLVDGDLRRPRLDKYL---G--------------L--
A0A1E4BP96      DGKSTTAANLAMSLA-AAG-QRVVLIDGDLRQPVVASLF---D--------------L--
A0A151BT98      DGKTTVAANLALAMA-RDG-YRTVLVDGDLRKPGVGSAI---G--------------I--
A0A2Y8ZRF8      DGKTTVAANLALAMS-RDG-HRTLLVDGDLRKPGVASAV---G--------------I--
A0A2R9UAT1      DGKSTMSANLALAMA-ASG-QQVVLIDGDLRRPMIAAIF---G--------------L--
A0A1F1IHY9      EGKSTVAANLAVPVA-ESG-QRVVLVDGDLRRPVVAENF---G--------------L--
A0A3L8NYD3      EGKSVVTANLARVLA-AAG-QKTILLDGDLRRPMVSTIF---E--------------L--
A0A1Y4CKD6      EGKSTVAINLAEQLA-QDG-SRVLLVDMDLRSQGDGALL---G--------------C--
A0A0Q7KBQ4      EGKTLVATNLAMSMA-QSG-RSVLLIDADMRNPNVADLL---G--------------L--
A0A2S8WHZ8      EGKSSVTANLAVAIA-STG-RNVVLIDADLRRPVQTELF---D--------------M--
A0A1Y4CTD2      EGKSTVAANLAAALA-ERG-RRVLLIDGDFRKPAQRRIF---DEQNLERPSFSDYVLE--
A0A3N3ZPU0      EGKSSVAANLAVTLG-ALG-QPTVLVDADLRRPVQTELF---G--------------L--
A0A359IQX7      EGKSTVAANLARVLA-ESG-QITLLVDADLRRPSQHRTF---D--------------L--
A0A0Q9LZR0      DGKSTVAMNLAAALS-MSD-RRVVLIDGDLRRPVVAESF---G--------------L--
A0A1F1J417      EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
A0A2A8D6P2      EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
A0A448USF4      EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
A0A1F1QKB0      EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
A0A1F0THV9      EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
A0A2I1VJQ6      EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
D8USQ4          EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
E3H5W1          EGKSTVSLAVARSMA-SSG-QPVILIDADLRRPTVAKKL---H--------------I--
A0A448PRK6      EGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------V--
A0A433EDP2      EGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------V--
A0A231VTW0      EGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------V--
A0A433ECD0      EGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------V--
U7V3Z1          EGKSTVSLSLARSMA-ESG-QAVILIDADLRRPTLAKKL---N--------------V--
A0A1N7E3F1      EGKSSTSVNLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------I--
A0A372P1T1      EGKSSTSANLAITMA-QAG-WRVVLVDADLRRPSVPRYL---G--------------I--
A0A1L2ZMV4      EGKSSIAANLAVTIA-QSG-SKVILIDADLRRSVQTDIF---Q--------------L--
A0A1N5CK61      EGKSTVSTSLARSLA-ESG-QPTILIDADLRRPTIGKKF---N--------------I--
A0A2R7Z032      EGKSTVSSNLARLVA-QAG-EKVVLIDADLRRPMLATTF---D--------------I--
A0A1I0W453      EGKSTVSSNIARLVA-QAG-TPVLLIDADLRRPMIATTF---E--------------V--
A0A1H4LCS9      EGKSTVSSNIGRLVA-QAG-TPVLLIDADLRRPQIASTF---E--------------I--
A0A0Q6VV12      EGKSTVSANIARLVA-QAG-TPVLLIDADLRRPQIATTF---E--------------I--
A0A0Q9QB08      EGKSTVSSNVARLVA-QAG-TPVLLIDADLRRPMIATTF---E--------------I--
A0A1M6K628      EGKSTIAMQLAALLA-ESG-EPTVLIDADLRRPRVAQLF---G--------------I--
A0A1S1CAD0      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
G5ET14          EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E9DXX2      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E8S156      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E8S5S2      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1S1DFA8      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A2I1Z490      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0DAA9      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0PHK9      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0VZG6      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E9G8X4      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E9IAW2      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E9ZBC9      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E9ZDP4      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0R6B5      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0Z7N5      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F1D897      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
D2NP38          EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F1FV74      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E9M791      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A291DEI8      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1S1D5T1      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1E8TRD6      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0XT88      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F1EVP5      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
C6R548          EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A0K2RXS2      EGKSTVSLSLARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A1F0KX60      EGKSTVSLALARAMA-DAG-SPVILIDADLRRPTVAKKL---K--------------L--
A0A2T0UZ65      EGKSTVSSTLASIIA-EDG-RPVVIIDADLRRPNIANIL---E--------------V--
A0A1R4JTI6      EGKSTVAANAAITLA-QSD-VPTVLVDADLRRPTVAGSF---H--------------V--
A0A0G3V3F3      AGKSFISINLAQSAS-ALD-DKVVLIDADLRRPTIHEQL---S--------------V--
A0A0Q7QDF6      EGKTTTASNLAISLA-QSG-QNVVLVDGDLRRPRLHEVF---G--------------A--
A0A3S0V9U6      EGKSTVTSSLAHAFA-KAG-QPTVLIDADLRRPTIAKIF---G--------------I--
A0A261FQA1      EGKTTIAVNLAAAIA-ERG-RTVLLIDTDLRKPSMAGVL---G--------------I--
A0A1Q2CJ92      EGKSTLAANIAAMFA-DAG-EPTVLIDADLRRPVQAERL---G--------------L--
A0A2T0S3C8      EGKSSTACTLAGLFA-EAG-QRVLLIDADLRRPRIADYL---G--------------L--
A0A285VUW0      EGKTTTVVNLGMAMA-ESG-RRVLVLDADLRHPSVASEL---G--------------L--
A0A444BL03      EGKSTVSSTLARVLG-EAG-QRVVIVDADLRRPTLAKVF---E--------------A--
A0A1C6T1J1      EGKTTMSCNLAIALA-EAG-WRVLLVDADLRRPKVADYL---G--------------L--
A0A2W2CFC8      EGKTTLSCNLAITLA-EAG-WRVLLVDADLRRSKVGDYL---G--------------I--
R4LD52          EGKSSTACGIAMLFA-QAG-QRVLIVDADLRRPRIAEYL---G--------------L--
A0A2N3YJR1      EGKSTVSATLARVLG-QSG-QSVVIVDADLRRPTLAKVF---D--------------R--
A0A2W2A4B0      EGKTTTAANLAVALA-ESG-LRTVVIDADLRRPNLANVF---G--------------I--
A0A1H7N9P7      EGKSTVAVELAAALA-ETG-TRVLLVDADLRRPTIADRL---G--------------L--
A0A1M7V0F8      EGKSTVAVNLAAALA-ETG-ARVLLVDADLRRPAIADRL---G--------------L--
A0A1Q2CRV2      EGKTSTAINLAATLA-AAG-EKVLLIDADLRRPRVAAQL---Q--------------L--
A0A101KZQ4      EGKSTVAANLAITIA-ASD-QKVVLIDGDLRRPTIAKTF---G--------------L--
A0A1H4I042      EGKSTTAVNIALALV-EVE-NNVLLVDGDMRRSIAHKHL---N--------------V--
A0A022KX11      EGKTTTAVNLALAMA-DSG-RRTLLVDADLRNPSVAKTL---G--------------M--
A0A2N3R006      EGKTTTSVNIAAALA-ENG-AKVLLIDADLRHPSVANKL---D--------------I--
A0A255G8R8      EGKSVTVANLALAMA-DAG-NRTLLIDADMRRPTVADNF---G--------------L--
A0A345NSU7      EGKTTTAVNLALAMS-DAG-TKVLLIDADLRHPSVGTTL---G--------------L--
A0A0W8I9Y2      EGKSSITANLAVAIA-STG-RNVVVVDGDLRRPVITDLF---G--------------L--
A0A1U2GAT5      DGKSTTAINIASAFA-ESG-SRVLLVDGDLRKPVISERF---S--------------L--
A0A1V8PLV6      EGKTTVSVNVAAALA-ENG-AKVLLIDADLRHPSVADHI---G--------------L--
A0A1X6X0E0      SGKSVVSSNLAVSYA-QQD-KKVLIIDGDLRKATQHYQF---K--------------A--
A0A357ZCV8      EGKSTIALSLAQAIA-TSG-QTVLVVDTDMRRRSLAHYM---R--------------L--
A0A2S8MDM2      EGKSTTAINLALALA-EAD-HKVLLVDGDMRRPSLHQYL---D--------------L--
A0A1X6Y1L5      TGKSFVATNLALTYA-EQG-KKVLLVDTDLRRPTIHKMF---G--------------K--
A0A1U3QN81      EGKSFSAANLAAVFA-QQE-KKVLLVDADLRKPTIHETY---Q--------------L--
A0A1M8I0C2      EGKSTTVANLATVFA-QQG-NKVLLVDADMRKPTVHYTF---S--------------I--
A0A1U3NFN6      EGKSTTAANLAVVFA-QQG-KKVLLIDADLRKPTVHFTF---K--------------L--
A0A1N1YAY7      EGKSTTSTNIAWAFA-RAG-YKTLLIDADIRNSVMSGVF---M--------------S--
A0A2V2CXY5      EGKSFLVMQLWRMMA-EVG-TPTLLIDCDYRNSEMRTKY---G--------------IGS
A0A357ZDL3      EGKSTIALNLAQAIA-GSG-KTVLLVDTDLRRRSLAMYL---N--------------L--
A0A0F0KYJ9      DGKSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMIGTVF---G--------------L--
A0A419GS64      EGKSTICANLAIVMA-QAE-KRVLLIDCDLRLPTQHELF---Q--------------I--
A0A1I6GVG4      DGKSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMVDTVF---G--------------L--
A0A1I6IST1      DGKSTISSNLAVTLA-SSG-QPVVLIDGDLRRPMVDTVF---G--------------L--
A0A412JBM5      EGKSLTAANTAISFA-MLG-KKTLLVDADVRKPSQQRLW---A--------------G--
A0A023X491      EGKSTTCANLAVTLA-QAE-KSVLLLDCDLRKPVVHSIF---E--------------L--
A0A1Q7WJN6      DGKSFVASNLALAFA-SVG-YRTLLIDGDVRRGGLHRIL---T--------------V--
A0A1C2B334      EGKTTTAINVAASLA-EYG-HRVVLVDADLRRPTVAKRL------------------S--
R7Y679          EGKTTTSLNLAASLA-ELG-KSVVLVDADLRRPAVASRL---Q--------------A--
A0A0K8Q3D9      EGKSTVTANLAVTMA-AAG-ENVVVVDGDLRRPTLTDVF---N--------------L--
A0A2R7RCA1      EGKSTVTANLAVTLA-AAG-ENVVVVDGDLRRPTLVDVF---N--------------L--
A0A1E2SNF6      EGKSTLSANLAVTIA-RGG-QPVVVVDADMRHPTQGKTF---G--------------I--
Q6ADE8          EGKSTLSANLAVTIA-RGG-QPVVVVDADMRHPTQGKTF---G--------------I--
A0A1N6CE53      SGKSTISANIAVTYA-QAG-YKTLIIDGDMRKPTQHYIF---D--------------L--
A0A1U6THY0      EGKSTTAANLAIVFA-QQG-KTVLLVDADLRKPTVHYTF---N--------------L--
A0A420ZS11      EGKSTTVANLAVVMA-QQH-NRVLLVDTDLRKPTVHFTF---Q--------------V--
A0A1Q7CZ24      DGKTTTAINLAGSLA-QAADARVLLVDMDLRRPAVAGQL---G--------------L--
A0A2W6VLC6      EGKTSSGINIARALA-DVG-THTLLVDADLRRPKTDVYL---G--------------I--
                 **:                   :::* * *                             

A0A2N4T4Q5      VPG-VGITDVLV----GE-A---EVDDVLQVYDKFPNLQV--LGAGRTPPNPTELLASQA
A0A348NU28      EGS-VGLTTVLL----GD-V---SIEDARMTRPG-STLDV--LPSGSIPPNPAEMLTSDA
A0A1M3LEY6      EGG-VGLTDVLI----GR-A---RLSDVTQAWGL-RNLSL--LPAGAMPPNPSELLGSQA
A0A222TG79      NPD-IGFTDFLS----GR-A---ALEDVLQSTSF-SGVDA--LAGGQIPPNPAELLTSQK
A0A1L2ZMQ6      PGD-AGLTDVLA----GQ-A---ELDDVLQDFEPVPNLQV--LAAGRIPPNPSELLASKT
A0A0Q5M6Z7      RSG-VGLTDVLS----GR-V---DLNDALQAPSDSPHLRV--LGAGRVPPNPSELLGSRT
A0A3L7ADK2      VEG-AGLTDVLS----GR-A---ELQQVIQPCGDSEKLWI--LGAGRIPPNPSELLGSRA
A0A0G3V3M7      ATT-PNLTDIPH----QG-----TAADVLAVAQETGIPNIRFIASAPTRTDPGTAIEMVK
A0A1H6WL79      LPD-VGVTDILS----GR-A---SIDDVLQEWGPNPRLRI--LTAGRIPPNPSELLGSRA
A0A1Q2CI19      PQG-AGVSDLLV----DG-QG--SLNSVIRPTNIPG-VRV--VTAGTRLAHPTAL--ASR
W6JTW4          PQG-AGISDYLV----DS-ALE-HLQQLVRPTNMPG-VSI--IVAGTQLDHPTSL--ASR
A0A0A0JTY0      PQG-AGISDYLS----DV-SGDASLASLMRPTSVPG-VRI--MSAGSSLAHPAAL--ASR
A0A0A0JXF2      PQG-AGISDYLS----D--PGGTSLETVVRPTSVPG-VRI--ITAGTVLTHPASL--ASR
E6S8H2          PQG-AGISDYLT----GP-DDT-PLGSLIRPTNVPG-VRI--ITAGTRLEHPASL--ASR
A0A0A0JGH0      PQG-AGISDYIS----DN-EDT-PLEALIRPTNVPA-VRI--ITAGTRLTHPASL--ASR
N0E4U7          PQG-AGISDFIT----DP-GDV-PLEALVRPTSVPG-VRI--ITAGTRLTHPASL--ASR
A3TMH6          PQG-AGISDYLS----RH-NES-SLEALIRPTSIDG-VRI--MTAGTRLSHPASL--ASL
A0A0A0IYK2      PQG-AGISDFLS----DP-SDDASLGSVVRPTSVPG-VRI--ITAGTSLAHPASL--ASR
A0A0Q9L0H3      PQG-AGISDYLS----DP-SDGAALDAVVRPTSVPN-VRI--ITAGTSLAHPAAL--ASR
A3TMK0          PQG-AGISDYLT----DP-GEG-SLSAVVRPTSVPG-VRI--ITAGTSLAHPASL--ASR
A0A3E2DN22      EAG-VGLSQVLA----GD-V---TLDDALMRTETKR-LQM--LAAGRIPPNPSELLGSQR
A0A3Q9ULZ9      DSR-VGLSQVLA----GD-V---SLSDALTPTDVPG-LRV--LVAGRIPPNPSELLGSVR
A0A3S9JFL2      DSH-VGLSQVLA----GD-V---SLEDALNPTDVPG-MRV--LVAGRIPPNPSELLGSVR
A0A0Q5JKD6      SDD-VGLSDVLA----GR-A---QIEQVAHQVDEHGRLFV--VAAGRTPPNPSEMVGSQR
A0A0Q9TBP0      GDP-PGLSDLLV----SE-E---DPSSYLIDIGVDNLTL---LPAGTLPPNPAALLASGQ
A0A346XTB0      DDR-VGLSDLAA----MD-M---EPNEVLRRYKFSEQSQIPVVTAGQRRGDPAALLRTHA
A0A2W6DK08      SPG-TGLSNLLR----ST-T---TV-DLSLHVRQSDIPRVDVVTAGTQLERPSTL--PAR
A0A2S0LQ32      DGS-VGLTQVLA----GD-V---PVSDVAQFVKGHPHLRV--IPAGRIPPNPSELLGSQR
A0A2N6V1R5      DGS-VGLTQILA----GD-M---QLSDVAQKIEGQPNLRV--VPAGRIPPNPSELLGSQR
G9PHS6          DGS-VGLTQILA----GD-M---QLSDVAQKIEGQPNLRV--VPAGRIPPNPSELLGSQR
U1PLM7          DGS-VGLTQILA----GD-M---QLSDVAQKIEGQPNLRV--VPAGRIPPNPSELLGSQR
A0A351ETF8      SNS-VGLSDVLA----GE-A---TRRDARQVFERDGIRFDV-ITSGSKVQDPALLLRGDR
A0A349B7N2      GRG-NGLAPVDA----P------DVSGLIGRSHIPGVSAITHLDERLESVQPADLL--SW
A0A346Y185      KDT-GGLPALAD----PR-N---NLSEIIVPLTADEGQYVPFIPAKSLGDDTAAFFRTPG
A0A259S8H9      DEA-IGLSEVLS----GQ-V---PIGSAIRRTEEA-NLFV--LPAGGIPPNPSEMLGSAA
A0A0Q5L115      SEG-AGLTDVLS----GR-A---QLHQVMQQTEAASNLWV--VGAGRIPPNPSELLGSQT
A0A2W1Z497      ARG-AGLTDVLS----GR-A---DLADVMQQTDDVGNLWI--VGSGRVPPNPSELLGSRM
A0A1H6YPK1      SPE-AGLTSVLA----SQ-A---SIEEVTQQVGDSGRFSV--VTAGVIPPNPSELVGSDT
A0A2R7MGI0      SDD-VGLSDVLA----AR-A---QIEQVAHQVDEEGRLFV--VAAGRTPPNPTEMVGSQR
A0A2T7WQY4      SDD-VGLSDVLA----SR-A---QIEQVAHQVDDHGRLFV--VAAGRTPPNPTEMVGSQR
A0A1G6GTN3      SDD-VGLSDVLA----GR-A---QIEQVARQVDQNGRLFV--VAAGRTPPNPSEMVGSQR
A0A1N7DLV3      SDD-VGLSDVLA----GR-A---RIEQVAHQVDENGRLFV--VAAGRTPPNPSEMVGSQR
A0A1V2NSB5      SDD-VGLSDVLA----GR-A---RIEQVAHQVDEHGRLFV--VAAGRTPPNPSEMVGSQR
A0A0Q5Q5L3      SDD-VGLSDVLA----GR-A---QIEQVAHQVDEHGRLFV--VAAGRTPPNPSEMVGSKR
A0A0Q6DVM4      SDD-VGLSDVLA----GR-A---QIEQVAHQVDEHGRLFV--VAAGRTPPNPSEMVGSKR
A0A1R3WWR6      SDD-VGLSDVLA----GR-A---QIEQVAHQVDENGRLFV--VAAGRTPPNPSEMVGSQR
A0A2S5UYV0      DGS-VGLSEVLS----GQ-V---SLEDALTATKTPG-LYA--LPSGRIPPNPSEMLGSEA
A0A2S5ULV5      DGK-IGLSEVLS----GQ-V---SLEDALVGSKIPG-LYV--LPSGRIPPNPSEMLGSEA
A0A2S5X9U6      DGK-IGLSEVLS----GQ-V---SLEDALVGSKIPG-LYV--LPSGRIPPNPSEMLGSEA
A0A3Q9IY80      VDG-VGVTDVLA----GR-A---TVEDVAQRVGRKGNLLV--LGAGKLPPNPSEVLGSER
A0A0F0LP73      DGT-VGLSEVLS----GQ-M---PIGPAIRQTSDPN-LFV--LPAGGIPPNPSEMLGSTA
A0A1F1X071      DGE-VGLSQLLA----AS-V---SLEDVAEPTTVPL-LTL--LPAGQIPPNPSELLGSRR
A0A3R8RWC7      DGE-VGLSQLLA----AS-V---SLEDVAEPTTVPL-LTL--LPAGQIPPNPSELLGSRR
E3B8H1          DNA-VGLTEVLT----GQ-A---SLRQAIQPGDHKN-LSI--ITSGRIPPNPSELLGSRR
A0A0Q5AWK6      DGA-VGLSEVLS----HQ-I---PVEDAIRPTGTEG-LFA--LPSGHIPPNPSEMLGSAA
A0A3N1NLD3      DGA-VGLSEVLS----HQ-I---PVEDAIRPTATEG-LFA--LPAGHIPPNPSEMLGSSA
A0A3N2FVI8      DGA-VGLSEVLS----HQ-I---PVEDAIRPTATEG-LFA--LPAGHIPPNPSEMLGSSA
A0A2S5XDQ6      DGA-IGLSEVLS----HQ-I---PVDDAIRPTGTAG-LYA--LPAGHIPPNPSEMLGSEA
A0A2S5XNN6      DGA-IGLSEVLS----HQ-I---PVDDAIRPTGTAG-LYA--LPAGHIPPNPSEMLGSEA
A0A2S5WZJ5      DGK-IGLSEVLS----GQ-V---SLEDALVASKI-PGLYV--LPSGRIPPNPSEMLGSAA
K6WHS4          TGS-VGLTTILS----TG-A---TLTDCIQHSSV-AGLDV--LPSGPIAPNPAELLGSRK
S3X7T8          DDG-LGLPEVLI----GA-A---PLDQALRTTPT-TDLSV--LPCTDTPPNPSELLGSEH
A0A261FE22      SNG-VGLMQMLT----NQ-V---DAQTAVQQYWK-PEFQV--LPVEDNQGTAAVMLSSAV
A0A0J6YE86      MSK-VGFSTVLS----GA-V---SIDDSLQKTRF-PGLSV--LTSGAVPPNPSELLGSQS
A0A439DNZ6      VGS-VGLSTVLA----GR-A---SLEDVLQETAF-PGVTV--VTSGAVPPNPSELLGSLA
A0A1E4BP96      PEG-AGLTDILA----GR-A---TTGDVVQPVQGSQNLYI--LASGRVPPNPSEVLGSRR
A0A151BT98      DGS-VGLTNVLV----HE-V---GLKDVLVEPEPSLPLFV--LPAGPVPPNASELLGSSA
A0A2Y8ZRF8      DGS-VGLTNVLV----HE-L---ALKDVLVEPEPSLPLFV--LPAGPVPPNASELLGSAA
A0A2R9UAT1      VEG-AGVTDILA----GR-A---EVDDVAQTFGHLDTLRI--VAAGRTPPNPSEVLGSER
A0A1F1IHY9      IST-VGLTDVVL----GR-V---ELADALQTVGNRPSLQV--LASGPIPPNPSEILASDR
A0A3L8NYD3      DPV-VGLTQVLA----GD-I---DLRATIQDPGL-PNLDV--IAAGRIPPNPSELLGSQR
A0A1Y4CKD6      GAS-HGPAEVLE----DSGL---GVDDCIVLLEE-SGIGF--WGGAGPVQNPVEVLSDER
A0A0Q7KBQ4      ENS-VGLMTVLI----GR-T---SLDEATQVHD--SGISF--LGTGPKPPNPAEVLDTQA
A0A2S8WHZ8      MDG-AGLTDVLS----HS-A---DLEDVLQPYGHLPNLQV--LCSGRIPPNPSELLGSKA
A0A1Y4CTD2      DGV-AGVGPVLN----GR-----------------SGVYE--LFQYKALRDPMAVFSGER
A0A3N3ZPU0      TEG-AGLTDVLA----GA-A---ELEDVLQDWEPGSNVHL--LGAGRTPPNPSELLGSKT
A0A359IQX7      DGS-VGLTQVLA----GD-V---SIDDAIQNSEL-ANLKV--LSAGRIPPNPSELVGSQR
A0A0Q9LZR0      IEG-LGLTDVLI----GS-V---EFEEVVQQVGGLPNLSV--LAAGRVPPNPSEMLGSKA
A0A1F1J417      NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
A0A2A8D6P2      NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
A0A448USF4      NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
A0A1F1QKB0      NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
A0A1F0THV9      NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
A0A2I1VJQ6      NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
D8USQ4          NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
E3H5W1          NAK-IGLTQVLA----GQ-V---DIAEAVHQVED-SKLFV--LPAGRIPPNPSELLGSDK
A0A448PRK6      DAK-VGLTQVLA----GQ-V---DIAEAVYQLEE-SNLFV--LTAGRIPPNPSELLGSDK
A0A433EDP2      DAK-VGLTQVLA----GQ-V---DIAEAVYQLEE-SNLFV--LTAGRIPPNPSELLGSDK
A0A231VTW0      DAK-VGLTQVLA----GQ-V---DIAEAVYQLEE-SNLFV--LTAGRIPPNPSELLGSDK
A0A433ECD0      DAK-VGLTQVLA----GQ-V---DIAEAVYQLEE-SNLFV--LTAGRIPPNPSELLGSDK
U7V3Z1          DAK-VGLTQVLA----GQ-V---DIAEAVYQLEE-SNLFV--LTAGRIPPNPSELLGSDK
A0A1N7E3F1      EGG-TGLTDVLI----ER-A---RLHEVIQTWGQ-PGLSV--LPSGRIPPNPSELLGSRV
A0A372P1T1      EGG-TGLTDVLI----ER-A---RLHDVIQTWGQ-QGLSV--LPSGRIPPNPSELLGSRG
A0A1L2ZMV4      QSG-AGLTDLLS----GA-V---DLDDVLQEWSGDPRLQV--LGAGRVPPNPSELLGSRA
A0A1N5CK61      DAK-IGLTQVLA----GQ-V---ELAEAVRQYED-SQLFL--LPAGRIPPNPSELLGSDK
A0A2R7Z032      DGE-VGLTQVLA----GD-L---RAGEAMVSSGI-DNLWL--LPAGRIPPNPSELLGSLR
A0A1I0W453      DGA-VGLTQALA----GD-V---EIRDVIIDSGM-PNLSL--LPAGRIPPNPSELLGSLR
A0A1H4LCS9      DGA-VGLTQALA----GD-V---DIRDVIVDSGL-TNLSV--LPAGRIPPNPSELLGSLR
A0A0Q6VV12      DGT-VGLTQALA----GD-V---DVRDVIVGSGM-ANLSV--LPAGRIPPNPSELLGSLR
A0A0Q9QB08      DGA-VGLTQALA----GD-V---DVRDVIVESGV-ANLSL--LPAGRIPPNPSELLGSLR
A0A1M6K628      DGA-VGLTQVVA----GS-L---TVADALVSTSQ-PNLSV--LPAGRIPPNPSEIVGSKR
A0A1S1CAD0      DAK-VGLTQVLA----GQ-V---EIANAVHQLGE-SNLFV--LPAGRIPPNPSELLGSDK
G5ET14          DAK-VGLTQVLA----GQ-V---EIANAVHQVGE-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E9DXX2      DAK-VGLTQVLA----GQ-V---EIANAVHQLGE-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E8S156      DAK-VGLTQVLA----GQ-V---EIANAVHQLGE-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E8S5S2      DAK-VGLTQVLA----GQ-V---EIANAVHQLGE-SNLFV--LPAGRIPPNPSELLGSDK
A0A1S1DFA8      DAK-VGLTQVLA----GQ-V---EIANAVHQLGE-SNLFV--LPAGRIPPNPSELLGSDK
A0A2I1Z490      DAK-VGLTQVLA----GQ-V---EIANAVHQVDE-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0DAA9      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0PHK9      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0VZG6      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E9G8X4      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E9IAW2      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E9ZBC9      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E9ZDP4      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0R6B5      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0Z7N5      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F1D897      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
D2NP38          DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F1FV74      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E9M791      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A291DEI8      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1S1D5T1      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1E8TRD6      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0XT88      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F1EVP5      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
C6R548          DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A0K2RXS2      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A1F0KX60      DAK-VGLTQVLA----GQ-V---EIANAVHQLGD-SNLFV--LPAGRIPPNPSELLGSDK
A0A2T0UZ65      SST-VGLSEVLS----GQ-M---DYTDAMQATRH-QDVFV--IAGGQVPPNPSELLGSAR
A0A1R4JTI6      EGS-VGLTNAVV----GN-A---QVDDVLQPVSEVENLTV--LASGPVPPNPSEILGSDR
A0A0G3V3F3      PRT-PGLTSVLL----GS-D---LSEALRKVAES-PFLRV--LSSGPPVEDPSAILGARA
A0A0Q7QDF6      EQN-VGLTSVLV----GK-V---PLDSAVQGTDV-PGLDV--LTSGTRPPNPSEIIQTAA
A0A3S0V9U6      DSG-VGLSQVLS----GQ-V---GIEEAIQRFHE-SELYV--VPAGRIPPNPSELLGSAK
A0A261FQA1      NGK-VGLAHVLA----RQ-A---KLDEAIQQYWK-PTFHV--MPAGEQQANPSILINSKA
A0A1Q2CJ92      DGA-VGLSQVLA----GT-I---KLSDAMQATDH-KHLQV--LPAGRIPPNPAEMVGSSR
A0A2T0S3C8      EGA-VGLTTVLA----GR-A---SIADVVQPWS--EGMWA--LPSGSLPPNPSELLGSQH
A0A285VUW0      EGA-VGLTSVLA----GD-A---RAEDVIQRWRD-TEMYV--LAGGEIPPNPSELLGSRA
A0A444BL03      PGS-IGLSHVLT----DQ-V---DLEDAFQPTDQ-ENVRL--ITSGRTPPNPSELLGSAR
A0A1C6T1J1      DGG-VGLTDVLV----GD-V---QVGDVVQRWGD-KSLLV--LPSGSTPPNPSELLGSKA
A0A2W2CFC8      DSA-VGLTDVLV----GD-V---PVGDVVQRWGD-KSLLV--LPAGSAPPNPSELLGSKA
R4LD52          EGA-AGLTTVLA----GK-A---AVDDVLQRYG--DHLWV--LPSGFLPPNPSELLGSQH
A0A2N3YJR1      ENT-IGLSHVLT----DQ-V---SLVDALQATDQ-PNVRL--ITSGRTPPNPSELLGSAR
A0A2W2A4B0      EGS-AGLSDILV----GR-V---ELADVLQPWGR-AGLSV--IPSGTVPPNPSELVGSPA
A0A1H7N9P7      EAA-AGLTTALL----GR-A---SVADLVQEWGT-AGLHV--LPSGPVPPNPSGLLGSPV
A0A1M7V0F8      EAA-AGLTTVLL----GR-A---TVADLVQDWGT-EGLHV--LASGPVPPNPSELLGSPA
A0A1Q2CRV2      EGA-VGLTTVLI----GD-A---RLGDVVQPYGRTP-LDV--LTAGRVPPNPAELLGHTR
A0A101KZQ4      LEG-VGLTDVLI----GN-A---DIDDVMQPWGESGNLVV--LGAGKIPPNPSELLGSNT
A0A1H4I042      DGA-VGLSTVLS----GA-V---SLSDALQETQFSG-LTV--LAAGATPPNPSELLASHA
A0A022KX11      EGS-VGLTTLLL----GD-A---DLDDVIQTWGS-AGMDV--LPAGPIPPNPSELLGSAP
A0A2N3R006      DGS-AGLTHVLS----GQ-A---SVKDVVQRYWK-PNLHV--MPAGPKPPNASALLNSPI
A0A255G8R8      VGT-AGLSTILA----GQ-A---TLSDLVQPFSGHPDLYV--LTSGVVPPNPTELLDSAQ
A0A345NSU7      EGG-VGLTTVLL----GD-A---DVHDVVQPWGG-NNLHV--LTAGEVPPNPSELLGSSK
A0A0W8I9Y2      VPG-VGVTDVLT----GQ-V---QVDEVLQTYDKFPNLQV--LGAGRTAPNPTELLSSKA
A0A1U2GAT5      SSE-VGFSNVLR----GD-G---NFAEFVQP-SGIDGLWI--LSAGPLPPNPAELLALES
A0A1V8PLV6      EGG-AGLTHVLS----DQ-A---AVKDAVQRYWKP---NLHILPAGPKPLNASMLLNSKT
A0A1X6X0E0      DPY-RGLSSLLI----GK-L---SIADAIQETFVP---NLSVLTSGPMPPNPAELLSTNK
A0A357ZCV8      KPS-VGSYAVLT----GL-A---KLSDAVVSTPIP---NLFFLDTEPNIPSPTDVLSSKS
A0A2S8MDM2      LQP-VGFSTVLS----GR-A---LLGEALQKTRFP---GLTVLTSGSIPPNPSELLGSQS
A0A1X6Y1L5      ENI-LGITSVLT----GQ-E---TIDDCVQDKIFN---SLTILTSGFLPPNPAELLESEE
A0A1U3QN81      ENV-QGLTNVLV----GN-A---SLGETVQKTLID---NLYVLTSGPTPPNPAELLSSKA
A0A1M8I0C2      TNT-FGLTTVLT----KQ-S---NLDGAVTQIDTS---NLYVLPCGPIPPNPSELLSSRA
A0A1U3NFN6      DNG-TGLTSLLL----KQ-M---PFQKAVLPADEA---NLDILTSGPIPPNPAELLSTGA
A0A1N1YAY7      TEKITGLTDYLS----GT-K---DLSHGLCETNVE---NLFVIQSGAVSPNPTALLQSEK
A0A2V2CXY5      TEKIIGGAHYLA----GK-A---DMADVIYQTNIP---NGYMIPTTSAIANPTILLEGTR
A0A357ZDL3      RAP-SGLYAVLA----KQ-V---ALNDAVMTTQAG---NLFFLDAEAGIPNPVDILSSNR
A0A0F0KYJ9      PKG-AGISDVLA----GC-A---TIAEVAQRFGNG---QLLVVAAGKVPPNPSEVLGSAR
A0A419GS64      TLD-HGLTRMISTYDEGD-DPF-AFGDQVMD-------GLTVIGSGPPPPNPSEIISSRR
A0A1I6GVG4      PKG-AGISDVLA----GR-A---TIAEVAQRFGNG---QLLVVTAGKVPPNPSEVLGSAR
A0A1I6IST1      PKG-AGISDVLA----GR-A---TIAEVAQRFGNG---QLLVVTAGKVPPNPSEVLGSAR
A0A412JBM5      RNTSTGLCKYLV----GL-GEL-GLASIEGI-------PLDIAFCGVIPPNPSELLSSTR
A0A023X491      RNT-RGVVDALV----GS-E---NVEELWQ-TPLD---NLSVLTSGPVPPNPAELLGSER
A0A1Q7WJN6      SRK-PGLTDVLA----GD-V---TAEAALQRTPYS---GLSFIGCGSRRHRGPELLSSAA
A0A1C2B334      LNNSIGLTDFLI----GQ-G---DLPDLLQQGGLD---RLDVLATGQLPPNPAELLGSSR
R7Y679          VSPDIGLTDYLR----GS-A---PVGDVLQRSGVG---GFDVLAAGALPPNPAELLGSRR
A0A0K8Q3D9      VPG-AGVTDVLS----GT-A---DLDDVLQPWGAL--PNLSVLGSGRIPPNPSELLGSRA
A0A2R7RCA1      VPG-VGVTDVLT----GT-A---ELADVLQPWGAL--PNLSVLGSGRIPPNPSELLGSQA
A0A1E2SNF6      PNG-AGLSDVLA----GR-V---SLREVLQDPDVSLHTHIRVLTAGRTPPNPSELLGSRT
Q6ADE8          PNG-AGLSDVLA----GR-V---SLREVLQDPDVSLHTHIRVLTAGRTPPNPSELLGSRT
A0A1N6CE53      PNN-SGLSNLII----NK-A---TYSDSIKESNVD---NLAILTAGPTPPNPSELITSSK
A0A1U6THY0      NNT-TGLTSVLT----NQ-L---GLMEAVQENDEK---NLYVLPSGPIPPNPSELLGSRA
A0A420ZS11      PNH-VGLSNVVT----GQ-S---TLDEAALETSIP---RLDVLPSGPVPPNPSELLASKA
A0A1Q7CZ24      SGGKRGLAEALL----AD-SGL-SLEDTVETLAHF---NLSVLPAGRATVAPYELLKSPR
A0A2W6VLC6      EGG-LGLTDVLI----GR-A---RVEDVVIDMAPR---GFSVLPAGRIPPNPSELLSSPR
                     .                                                      

A0A2N4T4Q5      MRTMLAELAEDA-FVLVDAPPLLPVTDAALLTASADGALVVATAQGTTVDELGKALGNIE
A0A348NU28      MKRLLEEATARYDYVIIDSPPVMSVADANLLAPFVDGVIVVVDAGKTRRNQLIQAAASLE
A0A1M3LEY6      MVNLLRHVEKEYDVVLIDGPPLLPVTDSALLSKQVRGALLIVAAGRTHRGQVHGSVEALQ
A0A222TG79      ASEGINSLSSLYDYVIVDTPPVLPVTDAVIASRLVDGVIVVVRSGASRRPDLESMLSHLG
A0A1L2ZMQ6      MGKLLEDLSERA-FVIIDAPPLLPVTDGAVLAKASDGALIVVKAGKPTIDELAKATENLD
A0A0Q5M6Z7      MRELVSALADVA-IVILDAPPLLSVTDAAIMGTIADGVVITVGAKQVTGEQLEKAYRSVV
A0A3L7ADK2      MKELLAALGEQS-IVILDAPPILPVTDAVVLANSADGVVLVASARNTTYEQFGRAQQLIK
A0A0G3V3M7      VAARLG--RDIADLVIVDSPPILLANDAAELSTFCDATVLMVRAGWTRRGGVVAASDLLR
A0A1H6WL79      MEHLLKDLAQRA-IVLIDAPPLLPVTDAAVLSRVADGTLVVARARKTTRDTLYRALSNLT
A0A1Q2CI19      MGPLVASARKRADVVIIDSAPLLEAAEVFDILPHVDDVVLVARSGRLSAASAQRTKEMLA
W6JTW4          MGPLLEEARGLADVVLVDTAPLLAASDVFDILPLVDTVLVVVRSGRITHAAGSRLAELLG
A0A0A0JTY0      MSHLLDEARGMADVVLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTEVAGNRVAELVG
A0A0A0JXF2      MGGLLEEAREMADVVLIDTAPLLEASDVFDILPMVDTILLVVRSGRLTEPDGNRVAELVG
E6S8H2          MGGLLTEARGLADVVLVDSAPLLAASDVFDVLPLVDTVLLVVRSGRLTEVAGHRVSELLG
A0A0A0JGH0      MGHLLAEVRELADVVIIDSAPLLAASDVFDILPIVDTVVLVVRSGRLTDVAARRVAELLG
N0E4U7          MGHLLEEVRGMADVVIIDSAPLLAASDVFDVLPIVDTVLLVVRSGRLTDVAAHRVAELLG
A3TMH6          MGGLIAELRDLADVVLIDTAPLLAASDVFDVLPVVDTVVVVVRHGRITDVAGRRVAELLG
A0A0A0IYK2      LGSLLEEVRGMADVVLIDTAPLLEASDVFDILPMVDTLLLVVRSGRLTELAGNRVAELVG
A0A0Q9L0H3      MGQMLEQARDLADVILIDSAPLLEASDVFDVLPTVDTLLLVVRSGRLTEVSGNRVAELVG
A3TMK0          MGHLLEEARDMADVVLIDTAPLLEASDVFDILPMVDTLLLVVRHGRLTEVAGNRVAELVG
A0A3E2DN22      MKDLLTELRKRGYFVVIDAPPLLAITDAGLLGAIADGTIYVAVVGKTHRDQVSLVAKRLE
A0A3Q9ULZ9      MHNLISRLTKAGYFVVLDAPPLLAVTDAGLLATSTDGVIMVHVVGGTHKEQVTLCTKRLE
A0A3S9JFL2      MHNLIARLTKAGYFVILDAPPLLAVTDAGLLATSTDGVIMVNVVGGTHKEQVTLCTKRLE
A0A0Q5JKD6      MQSLARKLADDM-VVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATDNIA
A0A0Q9TBP0      MHLVLEELAAKADMIVVDSPPVLTGADTLELAALADMVVVVTRERVSRRRQLVAVRETLR
A0A346XTB0      FRKGMERIVDSAELLIVDSSPLLAVADATIVAGSVDGIVIVVS-HGTPFSELQKVKERLK
A0A2W6DK08      MGNLVMQARELADIVLIDSAPMLLANDATDLMPYVDTVLVVSYASRTTSEEARRASELLA
A0A2S0LQ32      MKALLDRLSQEA-VVLLDAPPLLPVTDAALLSALADGAILTFEVGGTYKEQARLTGKILG
A0A2N6V1R5      MKALMDYLKDDA-MVIMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFK
G9PHS6          MKALMDYLKDDA-MVIMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFK
U1PLM7          MKALMDYLKDDA-MVIMDAPPLLPVTDAGLLSALADGAILVMEVGGTYKEQARLCGKIFK
A0A351ETF8      WTSLADELFLYD-LVIIDAPPVLAVTDAVLIGRAVNGQILLTRLGATKRSDLAEAAKLLA
A0A349B7N2      IRSTVQQARPTSDVVLIDTAPFLTVNDARDLLDVADQVVVVARSGKTSRQSADRMSELLA
A0A346Y185      FRQAITRLREVADLIIVDSPPLLLASDASAIATNVDGIVVVVS-RGTSMKLLEEMRERLD
A0A259S8H9      FQQLLTRLRQDF-FIVVDAPPVLAVTDASVLSSVVDGLVFVVAMGRTRRVEIVEARTQLE
A0A0Q5L115      FQDLVSTLAEHA-TVILDAPPVLAVTDAVVLAAKADGVLMTASAARTTFDQLDRALQLVT
A0A2W1Z497      FRDILASLGEHA-TVVLDAPPILAVTDAVVLAAGADGLVVTVSAQGTTIDQLGRALQLVA
A0A1H6YPK1      MRSLLYSFPEDT-MVIVDSPPLVPVSDAAVLAARTDGALVVARAGATSADMLEEALRILD
A0A2R7MGI0      LQSLARKLAEEM-VVIVDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRAIENIS
A0A2T7WQY4      MQALARKLAEDM-VVIVDSPPTLAVADAAVIGSWADGVVLVVTAGRTTDDMLTRAVDNLS
A0A1G6GTN3      MQALARKLADDM-VVIVDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLTRATENIA
A0A1N7DLV3      MQQLARTLADDM-VVIIDSPPTLAVADAAVIANWADGAVLVVTAGRTTDDMLQRAVGNIA
A0A1V2NSB5      MQQLARTLADDM-VVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLQRAVGNIA
A0A0Q5Q5L3      MQALSRKLAEDL-VVIVDSPPTLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATANIA
A0A0Q6DVM4      MQALSRKLAEDL-VVIVDSPPTLAVADAAVIASWADGTVLVVTAGRTTDDMLTRATANIA
A0A1R3WWR6      MQALTRKLAEEL-VVIIDSPPTLAVADAAVIASWADGAVLVVTAGRTTDDMLSRATENIS
A0A2S5UYV0      MRSIIRLLSQDY-IVVIDAPPLLPVTDAAILSTRVDGVVLVATAGRTRREDVGAARDMLS
A0A2S5ULV5      MKSIVSLLSKDY-IVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVMAARDMLK
A0A2S5X9U6      MKSIVSLLSKDY-IVVIDAPPLLPVTDAAVLSTRVDGVVLVASAGRTRREDVSAARDMLK
A0A3Q9IY80      MKNLLRTLAKDY-TVIVDAPPLIPVTDAAVLSHSADGAIIITSVGKTTFEALTKALQNLE
A0A0F0LP73      FQRLLGELRRDF-FIVIDAPPVLPVTDASVMSAFVDGVVFVIAMGRTRKTEVVEARTQLA
A0A1F1X071      MQELIEELSRQY-FVIIDAPPVLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEAIR
A0A3R8RWC7      MQELIEELSRQY-FVIIDAPPVLAVTDAQLLTRHSDGAILVAVPGQTRTAAMQKAVEAIR
E3B8H1          MSAVIDALEEEY-FVVLDAPPLLPVTDAGLLSVAASGAAVVYHHGTTHKEQIALCTKILD
A0A0Q5AWK6      MRTLVERLSKDY-FVIIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRILA
A0A3N1NLD3      MRALIERLAEDY-FVIIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRIVQ
A0A3N2FVI8      MRALIERLAEDY-FVIIDAPPILPVTDASIVATVVDGVVFVVASNRTRRPEVTAARRIVQ
A0A2S5XDQ6      MRALVARLSKDY-FVIIDAPPVLPVTDASIVATVVDGVVFVVASNQTHRPEVVAARRIVQ
A0A2S5XNN6      MRALVARLSKDY-FVIIDAPPVLPVTDASIVATVVDGVVFVVASNQTRRPEVVAARRIVQ
A0A2S5WZJ5      MKSIISLLSTDY-IVVIDAPPLLPVTDAAVLSTRVDGVVLVATAGRTRREDASAARDMID
K6WHS4          ASDVFGSLRDSFEYVVVDTPPCLPVTDAQVVSRLVDGVLVVVRIDKSAKHELSDTTRQMD
S3X7T8          MSELLSFLAQDH-VVIVDAPPVLPVTDSVILSQLADTVIVVAQVGHTTVDQVESAVSSIE
A0A261FE22      MENMIDQAAKHYDHVIIDTAPMQVSNDASLFAREGATLLLVVAQTVGRKKVLRDVAHEFK
A0A0J6YE86      ARKVLAELRSRFDYVIIDSTPLLAVTDAAILAAGADGVLIMARFGQTKREQLAHAVGSLE
A0A439DNZ6      AKKILDELRTGFDYVVVDSSPLLAVTDAAILAAASDGVLIVARYGETKREQLAHAVGNLR
A0A1E4BP96      MRDLVTSLTEHA-LVIVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIA
A0A151BT98      MQGLFQELVAEFDFVVFDSPPMLPVVDALELEKLTGNLILVARGGQVSRRELQITLKALE
A0A2Y8ZRF8      MRNLFQELVAEFDFVVFDSPPMLPVVDALELEKLAGNLILVARGGQVSRRELQVTLKALE
A0A2R9UAT1      MKDLLRELSREA-MVIVDAPPLLPVTDAAVLTHSADGAIVVVGAGRTTIDVLKKAMNNLE
A0A1F1IHY9      FNDLINALAEDA-LVIIDAPPLLPVTDAAILARRFDGCLLVVSAGRTTYDEFSKAVSSIR
A0A3L8NYD3      MQSVIEELVAADYMVLIDAPPLLPVTDAGLLSGIVDGSILVLAVGKTYKEQARLAAKVLQ
A0A1Y4CKD6      LPSLFDGLRGQWDYIVLDASPCGMFQDAAMLANWVDEVLFVVRFDKVGRHNVQDALSMLD
A0A0Q7KBQ4      MRDLLHGLRSEYDVVVIDAPPMLPVADASILMREVDGALMLVRHGSTTREQLRLAVARIE
A0A2S8WHZ8      MKSLLSELALDA-VVLVDAPPLLPVTDAAILSTSADGILVVVRAGSTTGDELGKAIENLK
A0A1Y4CTD2      LADVMAELSERFDYIFVDCSPVAAAADAELWMRQVDTVVLVVRQDMTDVRVINDTVDVAW
A0A3N3ZPU0      MRNLLARMGQDY-MVVIDSPPLLPVTDPSVLAKGADGVVIVTQANKTNLDDLTKAVARLH
A0A359IQX7      MHNLLIALSENR-TVIVDAPPLLPVTDGGLLTAAADGAILVMATGRTYKEQLRVCARILK
A0A0Q9LZR0      MRRLLEGLGETY-TVIVDAPPLLPVTDAAVLTASADGALVVVSAGHTLDTQLRDALANLA
A0A1F1J417      MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
A0A2A8D6P2      MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
A0A448USF4      MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
A0A1F1QKB0      MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
A0A1F0THV9      MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
A0A2I1VJQ6      MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
D8USQ4          MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
E3H5W1          MRQLIEELSKEF-LVIVDAPPLLPVTDASLLSHAVDGVIMVGTVGKSHREQMTEAVAVLE
A0A448PRK6      MRQLVRELSEEF-VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLN
A0A433EDP2      MRQLVRELSEEF-VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLN
A0A231VTW0      MRQLVRELSEEF-VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLN
A0A433ECD0      MRQLVRELSEEF-VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLN
U7V3Z1          MRQLVRELSEEF-VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNNLN
A0A1N7E3F1      MRSVLAQLTEEYDMVIVDAPPLLPVTDAAALGAICDGALLVVRHGKTRNEQVLRAGELLS
A0A372P1T1      MRTVLAQLTEEYDMVIIDAPPLLPVTDAAALGAICDGALLVVRHGKTRREQVLRAAELLS
A0A1L2ZMV4      MKRLLTDLAQES-VVIVDSPPLLPVTDASVLSTSADGVLVVARAGSTSIEALKKATDRLD
A0A1N5CK61      MRQLVKELSSEF-MVIVDVPPLLPVTDASLLSSAVDGVILVVTVGKTRKEHLEEAANMLN
A0A2R7Z032      MSQLIDELARTH-LVLLDAPPLLPVTDAGLLSAFCDGALLVQATGQTYIEQSEHCRRILD
A0A1I0W453      MKQFIDDLAHDY-LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQSCRRILD
A0A1H4LCS9      MKQFIEDLSHDY-FVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQHCRRILD
A0A0Q6VV12      MKQFIDDLSQDH-LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGRTQIEQSQQCRRILD
A0A0Q9QB08      MKQFIDDLSADH-LVILDAPPLLPVTDAGLLSAFCDGALLVQAAGKTQIEQSQQCRRILD
A0A1M6K628      MADLIAHLSETH-LVIIDAAPLLPVADAGLVSAVSDGVLLVVQHGKTLREQIALATRNLD
A0A1S1CAD0      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILK
G5ET14          MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILK
A0A1E9DXX2      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILK
A0A1E8S156      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILK
A0A1E8S5S2      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILK
A0A1S1DFA8      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASNILK
A0A2I1Z490      MRQLINELSEEF-IVVIDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEASSILK
A0A1F0DAA9      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILK
A0A1F0PHK9      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILK
A0A1F0VZG6      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILK
A0A1E9G8X4      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1E9IAW2      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1E9ZBC9      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1E9ZDP4      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1F0R6B5      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1F0Z7N5      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1F1D897      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
D2NP38          MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAANILK
A0A1F1FV74      MRQLIKELSEEF-IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILK
A0A1E9M791      MRQLIKELSEEF-IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILK
A0A291DEI8      MRQLIKELSEEF-IVVVDVPPLLPVTDASLLSNSVDGVILVGSIGRSHREQMTEASSILK
A0A1S1D5T1      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLK
A0A1E8TRD6      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLK
A0A1F0XT88      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLK
A0A1F1EVP5      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLK
C6R548          MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASTLK
A0A0K2RXS2      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILK
A0A1F0KX60      MRQLINELSEEF-IVVVDVPPLLPVTDASLLSHSVDGVILVGSIGRSHREQMTEAASILK
A0A2T0UZ65      MRQLLQELTRD-HFVILDAPPLLPVTDAALLSGAADGTILVFAVGKTHKDQVEACAKMIQ
A0A1R4JTI6      LEAILRSLAQD-HMVIVDAPPLLPVTDAAILAAKYDGCVLVVTAGRTTRDELAKSLGNLE
A0A0G3V3F3      FRVVLDTLRAV-RLVVVDTPPSGLFSDALAVASQCDATIFVLDLKNSKQQQVRQALEELQ
A0A0Q7QDF6      METVLIELGRRYDIVLVDAPPLLPVADAALLSVISDGAILVVRHGRTGHDQVRAASERIT
A0A3S0V9U6      MRKLIEELAREY-LVLIDAPPLLPVTDGSLLSTSVDGAILVTKVGSTRRDQAEGAKAMID
A0A261FQA1      MNMLLHAAAKQYDNVIVDSTPMSVANDSAVFAKEGGTLLMVVGQGVAQKKTLKASAEEFE
A0A1Q2CJ92      MRSLIEHLSKA-HMVIIDAPPLLPVTDATLLSASADGAVVVVQSGTTRREQLEVAAHKLR
A0A2T0S3C8      MADLLEQFREQYDMVIVDCPPLLPVTDGAVVAARADGALLLARSHKTTSSQIQTAARALQ
A0A285VUW0      MERLFKQFLRDFDFVLVDSPPILPVTDALVMSRLTGGLLMVVSAASTRRRHLQEALRTLE
A0A444BL03      MHELVRELTVD-NIVILDAPPLLPVTDAGVLSASCDGSLLVFAVGRTHKEQAELAARMMG
A0A1C6T1J1      MADLLLGLRESADIVIIDTAPLLAVTDGVVVAVQSDGALLVSQQGRTSRTQVAAAARALH
A0A2W2CFC8      MADLLLALRESADIVIIDTAPLLAVTDGVVVAVQADGALLISQHGRTARTQVAAAARALN
R4LD52          MALLMDELRTAFDTIIVDCPPLLPVTDAAVVAARADGALLLARSHKTTTAQVSNAVTALQ
A0A2N3YJR1      MHDLVRELSVD-NIVILDAPPLLPVTDAGVLSASCDGALFVFAVGKTHREQARLAARMMG
A0A2W2A4B0      FTALIEDVAALFDVVIVDTPPLGSVTDAALVSRAVQNMLLVVASGRVRRAEVSSSIESLA
A0A1H7N9P7      MRRLLERLRDDYDHVVLDTAPVLPVSDAAVLSRSVDGLVVLADVTRVRRAQLSQSLHSLA
A0A1M7V0F8      MRRLLERLRDEYDHVVLDTAPVLPVADAAILSRSVDGLLVLANATRVRRPQLTETLRSLA
A0A1Q2CRV2      MRALLEDASKLYDTVIIDSPPLLPVTDAAVLAGETAGVLVVVGSGIVRRPELTASLEVLE
A0A101KZQ4      FQNLIQSLAQE-AIVLIDAPPLLPVTDAAILTARTDGALVVSRVRKTTYDELESALNNLQ
A0A1H4I042      AKNLLEELRGKFDYVIVDSCPLLAVTDAALLAANADGALLLGRYGQTRRDQLKNATDALQ
A0A022KX11      MEALLTRLMQEYDFVLIDSPPVVPVIDAVVIERLTGGLLMVVGVDRTKKRDLAAALKQLE
A0A2N3R006      MVELLNNAIAQYDYVLIDTAPMVVANDAVIFVRRGGSLVMVCRRDQTLKRDLREISEELA
A0A255G8R8      MRALLDEALAEYDVVLIDSPPLLPVSDGLVLGKLVGGALLVTGIERVKKPQLAESLAALG
A0A345NSU7      MHELFERLSEQYDFILVDTPPVLPVTDAMVIEKLTGGMLMVVASGETRKRHVSEAMRVLE
A0A0W8I9Y2      MHAMLETLAED-ALVLVDAPPLLPVTDAALLTASADGAIIVATAQKTTTDELSKALENLH
A0A1U2GAT5      TGRIVNELMDCYDYVIFDSAPILPVTDPVVLSRWVGGIVLVVRADESRTPMLSRAISEVH
A0A1V8PLV6      MSKLLDTALHTYDYVIVDTAPMVVANDAAVFGAKSNGIVLVSGRDMTMKRDLKEIAVQLD
A0A1X6X0E0      LDTLMDEFKKSFDIIIIDTPPVINLTDAVVISRVADGIILVVRANHTQKNEVSRSVEILK
A0A357ZCV8      FAKLVEVLESNFEYVIFDTPPVGTFVDAAIIGTLVDGVIFVVRPKHTKRKEMAFAYDQLG
A0A2S8MDM2      ARRLLSELRSQYDYVVVDSTPLLAVTDAAIMAAGADGVLVIARHGSTKKDQLTHAVSSLH
A0A1X6Y1L5      MKAIIKQLTTDYDIVIFDAPPVLPVVDSALLSTLVDGVIFVIRSRYTEQGAAVKAVEKIK
A0A1U3QN81      MGELIQEMYSRYSLVIFDSPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDALQ
A0A1M8I0C2      MDEFLEAALNVYDLVIFDTPPVLVVTDAQLLANKCDGTVLVVSSGFTEKENAIKAKEQLT
A0A1U3NFN6      MKDLLSEAGAVYDKVILDTPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALD
A0A1N1YAY7      FEVMIETLRKYFDYIIVDTAPIGVVIDAAIIVQKCDASILVTEASATKRREVQKAKTQLE
A0A2V2CXY5      FSHMIESCAKTFSYVLVDTPPLGSVADALNVAPHCDGTVLVVRSGATPRKLVDNSVQLLK
A0A357ZDL3      FKALVKTLREGFDYVVFDSPPLGPFVDAAIVGALVDGVVMVVRPRHTKRKDLLFAYDQLK
A0A0F0KYJ9      MRELLKSIAR-EAIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGKTTYEVLGKAIGNLE
A0A419GS64      FRKFIKNASAAYDTVIIDTPPVGIVSDAAIISTMVDGTILVLDLKGGHRNMSVRAKKTLE
A0A1I6GVG4      MRELLKSIAR-EAIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLE
A0A1I6IST1      MRELLKSIAR-EAIVIIDAPPLIPVTDAAVLAHSADGAIIVGTVGKTTFEVLGKAIGNLE
A0A412JBM5      MKRFLEASRKAYDYVIVDTAPINTVADAQILSPLVDGVILVALSQKSTRGELNAAIDSVS
A0A023X491      FGALLGDLARRFEYVLIDVPPVQVVSDAAIVAAQADGVILVFDAQSTRKLSVRRSIRTIE
A0A1Q7WJN6      MPRLVASLRPHYEAIIVDTPPLVAGVDAFVLGTVTGALVLVLRAGMSDRDVATAKLDVLD
A0A1C2B334      ARELFDTLAASYDYVIVDTPPILPVSDGAVVSQWVPNAILVVRADSTKRPELAAAWQQWK
R7Y679          TGQLLDELCELYDYVLVDSPPVLPVTDAVVVSQWVDGGIIVVRAGGTTRQELVASLAQLH
A0A0K8Q3D9      MKNMLQALAQ-NATVLIDAPPLLPVTDAAVLSRIADGAIVVIRAGKTTQVELENSLGNLQ
A0A2R7RCA1      MKNMLNALAE-NAIVLIDAPPLLPVTDAAVLSRAADGAIVVIRTGRTTQEQLAQSLGNLD
A0A1E2SNF6      MRELLAALSE-LAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLD
Q6ADE8          MRELLAALSE-LAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLD
A0A1N6CE53      FETIFNELLDHYDFIVIDTPPVNTVTDAQVYAQTVKNCVLVIDAEKNNKIEVKKAKDLLN
A0A1U6THY0      MNHFLERALEEFDIVLFDTPPVLAVTDAQVLANLCHGSILVVSSGRTDKEAVVKTKEQLS
A0A420ZS11      FERFVKSVSDAYDYVIFDAPPVNAVTDPQIIASLTDGTVLVIRSGVTEIEDAQHAVANLK
A0A1Q7CZ24      LEALLDEARQRYDYIVLDTPPFVPVPDCRVITKSVDGFLVVVTVHRTPWGVLTEALDLID
A0A2W6VLC6      MKQLIAQLSLAYDVVIIDAPPLLPVSDAAVLAKQTRGALVLVGAGRVTRNQLQESLEGLR
                              :..*  *     :                                 

A0A2N4T4Q5      HVRGRVLGVVLNHVPTT------GADAGFYG--------------YYGKSYYASDDSGGD
A0A348NU28      SAGGRIVGLVLNKVRRK------RKESAYYTANTDA------------------------
A0A1M3LEY6      NVGAHVAGVVLTMLPTR------GPDAYGYG--------------RYGYGAYGYGYGYGR
A0A222TG79      RANAAVVGVVLGDAQSR-----------------------------AGYYANSYALEYGQ
A0A1L2ZMQ6      RVGANKLGVILNQVPTR--------------------GAE-----ASRYGYYGKYYSKKE
A0A0Q5M6Z7      RVNGKVLGVVLNKIPPR--------------------GID-----SHDYGYYRSNYYTSN
A0A3L7ADK2      RGGAHLLGTVLNRVPTS--------------------GQD-----AHQYGYYGGTYYANE
A0A0G3V3M7      RLEATTVGVVLVGAEHG------A---------------------RAGYYGYYGYYGYGY
A0A1H6WL79      RVQGRVLGVILNCVATK--------------------GQG-----DLNYGYYGAYVSADE
A0A1Q2CI19      RFNIPVVGAVIVGAPLR--------------------KGDIGYGSGYGYG-------YGE
W6JTW4          RFKVPVSGVLLIGSKAS--------------------RSR-----SYGYG-------YGY
A0A0A0JTY0      RFQVPVSGVLIVGAPTK--------------------RAD-----AYGYG-------YGD
A0A0A0JXF2      RFQVPVSGVILVGAKAR--------------------RGD-----AYGYG-------YGE
E6S8H2          RFQVPVAGVVVVGAQSK--------------------RSA-----GYGYG-------YGY
A0A0A0JGH0      RFQVPISGVVLVGARGR--------------------RAD-----GYGHS-------YGY
N0E4U7          RFQVPISGVVLVGARGR--------------------RAD-----GYGYG-------YGH
A3TMH6          RFHVPVTGVVIVGAPTR--------------------GAG-----RYGYG-------YGS
A0A0A0IYK2      RFQVPVSGVILLGAPEK--------------------RAD-----AYGYG-------YGE
A0A0Q9L0H3      RFQVPVSGVIIVGAQTM--------------------RAD-----AYGYG-------YGE
A3TMK0          RFQVPVSGVIIVGAKAK--------------------LGD-----TYGYG-------YGD
A0A3E2DN22      QVGAPLLGSVLTRVPRK------KMGDVLYGY-----GAA-----NYGYGSYYGDYGKRG
A0A3Q9ULZ9      QVGAVLLGSVLTRAPRK------AMGDVLYGY-----GAG-----SFGYSSYNSYYTDKN
A0A3S9JFL2      QVGAVLLGSVLTRAPKK------AMGDVLYGY-----GAG-----SFGYSSYNAYYTDEN
A0A0Q5JKD6      KTRGHLLGVVLNRMPLR------GADS----------GYY-----GSQYGGYYGYGVPSS
A0A0Q9TBP0      QVSVESVGIVYNGVGDS--------AR----------ATY-----SY-------------
A0A346XTB0      FVSTPLLGYVFNRSDSS------TAGA----------YGY-----GYGVAEDDDGQRRLL
A0A2W6DK08      RTRAPAIGVALVGVKGR-------------------------------------------
A0A2S0LQ32      QVDARLLGVVLNRASRR------SMGS----------VYY-----GYGYGSYGHHYYYGE
A0A2N6V1R5      QVDGRLLGVVLNRASRR------NLGS----------VYY-----GYGYGGYGQNYYYYE
G9PHS6          QVDGRLLGVVLNRASRR------NLGS----------VYY-----GYGYGGYGQNYYYYE
U1PLM7          QVDGRLLGVVLNRASRR------NLGS----------VYY-----GYGYGGYGQNYYYYE
A0A351ETF8      TNGSRSLGVVVNRDQES--------PD----------KYS-----YYGQY----------
A0A349B7N2      RLSAKVVGVVL----------------------------V-----GSGDTPATKRYYYSK
A0A346Y185      RIGTPVLGYIYTKAKLD--------GA----------GYG-----DYAYRY-GYSYAYGY
A0A259S8H9      QVRARVLGVVLNLVSLR--------GG----------D-N-----GYGYYRKNSRYYMKS
A0A0Q5L115      RGGGDVLGVVLNRVPTK--------GR----------DAR-----EYGYF--GGSYYYYE
A0A2W1Z497      RGGGTVLGAVLNRVPTR--------GQ----------DAR-----DYGYY--GGAYYAGD
A0A1H6YPK1      RVQGRALGVILDGVAPV------GPRV----------KHY-----GYGNTSPGLSSLGGA
A0A2R7MGI0      KTRGRLLGIVLNRVPLR------G-------------PDS-----SYYGARYGGHYGYGE
A0A2T7WQY4      KTRGRLLGIVLNRAPLR------G-------------PDS-----SYYGARYGGAYGYSE
A0A1G6GTN3      KTRGHLLGVVLNRMPVR------G-------------VDS-----GYYGAQYGGYYGYGA
A0A1N7DLV3      KTRGRLLGVVLNRVPLR------G-------------ADS-----NYYGSQYGGYYGYGA
A0A1V2NSB5      KTRGRLLGVVLNRVPLR------G-------------ADS-----NYYGSQYGGYYGYGA
A0A0Q5Q5L3      KTRGHLLGVVLNRAPLR------G-------------ADS-----GYYGMQYGGYYGYGI
A0A0Q6DVM4      KTRGHLLGVVLNRAPLR------G-------------ADS-----GYYGMQYGGYYGYGI
A0A1R3WWR6      KTRGHLLGVVLNRAPLR------G-------------VDS-----TYYGGRYGGYYGYGA
A0A2S5UYV0      QVHGRLLGTVLNMVPPR------D-------------TAD-----GYEYRRNRSYYVTAD
A0A2S5ULV5      QVHSRMLGTVLNMVPPR------D-------------SAD-----GYEYRRNRSYYVTAD
A0A2S5X9U6      QVHSRMLGTVLNMVPPR------D-------------TAD-----GYEYRRNRSYYVTAD
A0A3Q9IY80      RAGSRALGVVLNRVPRK--------------------GRG-----GYHDYRYAGDYYRSK
A0A0F0LP73      QIRARILGVVLNFVAMR------N-------------SAN-----GYGYYRKNSHYYAQT
A0A1F1X071      AVNGTVYGAVLNRASTG------RLNRLAY-------GDA-----VYGYSAYGKYGY---
A0A3R8RWC7      AVNGTAYGAVLNRASTG------RLNRLAY-------GDA-----VYGYSAYGKYGY---
E3B8H1          QVGAHYFGSILNMTPPR------SMGSTVYGYGAGNYATA-----GYGYGYGYGYGHTDE
A0A0Q5AWK6      QVRGRVLGTVLNMVTAQ------D-------------GDT-----GY-YYYDRKNSYYTQ
A0A3N1NLD3      QVRGRVLGTVLNMVSAQ------D-------------GDA-----GYSYYYDRKNPYYAE
A0A3N2FVI8      QVRGRVLGTVLNMVSAQ------D-------------GDA-----GYSYYYDRKNPYYAE
A0A2S5XDQ6      QVRARVLGTVLNMVTAR------D-------------GDT-----GY-YYYDRKNAYYAE
A0A2S5XNN6      QVRARVLGTVLNMVTAR------D-------------GDT-----GY-YYYDRKNAYYAE
A0A2S5WZJ5      QVNGRLLGTVLNMVPPR---------DTADG---------------YEYRRNRSYYVTAD
K6WHS4          TAGVHAMGVVINGTPVR---------QSPYR---------------FRY-----------
S3X7T8          NAGGMVSGIVLNRADSS------KLSHLRYG--------------ESAYG--YGYTKY--
A0A261FE22      VSRVKISGVAFNRVAHERS----RKGNYYYY-----------------------------
A0A0J6YE86      SVGAPLLGAVFTMVPTR------GTGSYSYN--------------YGYYGEDEGRRGG--
A0A439DNZ6      SVGAPILGAVFTITPTR------GGASDNYS--------------YYGYSYGDG------
A0A1E4BP96      KVNGRLLGVVLNKATRR------GRPD-------------------YGYA----------
A0A151BT98      TVDANLSGTVL------------NYADHFSD--------------DYGYG----------
A0A2Y8ZRF8      TVDANLSGTVL------------NYADSFSD--------------DYGYG----------
A0A2R9UAT1      RAGGRALGVVLNRVPRS--------GGGYYD---------------YRYT----------
A0A1F1IHY9      KIDGEVLGAVLNRVPAS------GTAASAYQ--------------YYG------------
A0A3L8NYD3      QVGGHVLGSVLNRAPLG------GIGGVVYG---------------YGHA--THSQDY--
A0A1Y4CKD6      GERASVLGYVLNGCPQTAGSYGYGYGRYGYG--------------KYGYG--SYGDGY--
A0A0Q7KBQ4      TVGGKLFGTILNRTPRR------AGDVYGYG---------------YGYG----------
A0A2S8WHZ8      KVDANILGAILNQVPTK------GAGAAQYG--------------YYG------------
A0A1Y4CTD2      KSAGDFSGFVLN---------------AFQG--------------EWSLTHGRGYSAY--
A0A3N3ZPU0      TVGATILGAVLNQVPRK------GSGANEYG--------------YY-------------
A0A359IQX7      QVNGRLLGSVMNLAPLR------GIGAVVYG---------------YGYG---TYTYS--
A0A0Q9LZR0      TVNGHTLGVVLNRVSPK------SSSAGYY------------------------------
A0A1F1J417      RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A2A8D6P2      RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A448USF4      RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A1F1QKB0      RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A1F0THV9      RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A2I1VJQ6      RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
D8USQ4          RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
E3H5W1          RVNSHLFGVVLNKAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A448PRK6      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A433EDP2      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A231VTW0      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A433ECD0      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--NSYVGY--
U7V3Z1          KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--NSYVGY--
A0A1N7E3F1      SINARLVGTVLNFVPAK------HGSY--YG---------------YGYG----------
A0A372P1T1      SINARLVGTVLNFVPAK------HGSYYGYG---------------YGYG----------
A0A1L2ZMV4      RVNGHVLGVVLNQVPRK------GSSAGQYG--------------YYSDS--YYYTST--
A0A1N5CK61      KVGAALIGVVINRTPLK------GLGNSYYG---------------FGYA--GSYGGY--
A0A2R7Z032      QVGSRLLGIVLNKAPLK------GVGAIAYG---------------DGYG-YGGYGA---
A0A1I0W453      QVGSRLLGVVLNKAPVK------GASAIAYG---------------GGYGGYGGYGGY--
A0A1H4LCS9      QVGGRLLGVVLNKAPIK------GAAAIAYG---------------GGYGGYGGYGGY--
A0A0Q6VV12      QVGSRLLGVVLNKAPVK------GASAIAYG---------------GGYSGYGGYGGY--
A0A0Q9QB08      QVGSRLLGVVLNKAPVK------GAASIAYG---------------GGYGTYGGYGGY--
A0A1M6K628      NVDAALLGFVMNQVPKK------DLGAAAFG---------------YGYS--GASPRYYY
A0A1S1CAD0      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
G5ET14          KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E9DXX2      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E8S156      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E8S5S2      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1S1DFA8      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A2I1Z490      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F0DAA9      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F0PHK9      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F0VZG6      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E9G8X4      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E9IAW2      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E9ZBC9      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1E9ZDP4      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F0R6B5      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F0Z7N5      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F1D897      KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
D2NP38          KVNANLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F1FV74      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--STYVGY--
A0A1E9M791      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--STYVGY--
A0A291DEI8      KVNANLFGLVLNRAPRK------GLGNSYYG---------------FGYA--STYVGY--
A0A1S1D5T1      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SSYVGY--
A0A1E8TRD6      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SSYVGY--
A0A1F0XT88      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SSYVGY--
A0A1F1EVP5      KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SSYVGY--
C6R548          KVNANLFGMVLNRAPRK------GLGNSYYG---------------FGYA--SSYVGY--
A0A0K2RXS2      KVNAKLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A1F0KX60      KVNAKLLGMVLNRAPRK------GLGNSYYG---------------FGYA--SAYVGY--
A0A2T0UZ65      QVGGRILGIVLNMAPKR------GMGSVMYG---------------DGYS--TYYSHG--
A0A1R4JTI6      KVNGDVLGTVLNRVPTR------GKEAGYYG--------------YYGKS--YYSSSA--
A0A0G3V3F3      RAGANVVGVVVNRTEVV------NRSAYYEA-----------------------------
A0A0Q7QDF6      TVGGRLLGTIISMSPKK------ETARYGYG---------------YGYD--DGKGRR--
A0A3S0V9U6      KVQGNVLGAVMNMAPAK------GIGSQYYG---------------FGYG--GYRSEY--
A0A261FQA1      LVGVKPAGAVVDMVKEQ------RGKGDYYY--------------SDKAA--KHSSQG--
A0A1Q2CJ92      QVDGNLLGVVLNKVAKK------DLGEATFG---------------YGYG--SYTSKY--
A0A2T0S3C8      SVDARLLGCVFNMVSAK------GPEGYYYE--------------QYGMT--SQHRRG--
A0A285VUW0      AAEAEVSGFVLTKTPAE------RSGSYN-----------------YQYY--GRETPV--
A0A444BL03      QVGGRVLGVVLNMAPKR------RAGGVMYG---------------YGYG--GYASYA--
A0A1C6T1J1      AVSVRLLGCVLNMAKVP------KADA-------------------YQYE--AYRVVA--
A0A2W2CFC8      AVSVRLLGCVLNMAKLA------KAEA-------------------YQYE--AYQVL---
R4LD52          SVDARLLGCVLNMVAAK------GPDAYHY----------------YDEY--STRGRG--
A0A2N3YJR1      QVGGRVLGVVLNLAPKG------RAGAVMYG---------------YGYG--GYATYA--
A0A2W2A4B0      TVGASVQGVVVTMARSR------GARDA------------------YAVY--GADVPP--
A0A1H7N9P7      QVQATVLGVV--LNQVR------REAEV------------------YGYA--ADVVAG--
A0A1M7V0F8      QVGGTVLGVV--LNQVR------RDEDV------------------YGYA--AEAQPP--
A0A1Q2CRV2      RVEARVLGLVFNRVKRS------EGEA--YG---------------YRH-----------
A0A101KZQ4      RVNAHALGLILNGVPLK------GAQASNYG---------------YAYK----------
A0A1H4I042      NVGAALLGSVFVMTPPR------SRSA--YG---------------GAY-----------
A0A022KX11      TVGAHVSGFARNFVASK------G-SDYRYG--------------YHRYEEEMTRRARKA
A0A2N3R006      TLDLSANGVIFNCARES------KKSLEYSN--------------YYYYYSDSNKKRSKK
A0A255G8R8      TVDVKVQGVVLNMVRRK------E-RGDAYG--------------YYAYGSEPGRQRSSS
A0A345NSU7      TTGTHVAGFVLTKAPAQ------P--SAYYS--------------YYGGEHASTRPDGPR
A0A0W8I9Y2      QVHGNVLGVVLNRVPTT------GADAGYYG--------------YYGKSYYANSDDQPA
A0A1U2GAT5      SGDGVLLGTVLNGVTLS------D------G--------------YYGESLY--------
A0A1V8PLV6      NLNVPVMGFVFNFAKER------KVSANGNY---------------YYYYDEGGKKSRKK
A0A1X6X0E0      TTNKKLFGTILNDAKHE------VSDYYYY------------------------------
A0A357ZCV8      KADVHILGACANYRESV------ASESYYAY---------------YSADGKRVKDRPAA
A0A2S8MDM2      SVGAPVLGAVFTMMPTR------GSSSYGYS---------------YSYYGTETPRHAPP
A0A1X6Y1L5      SAGSRIIGTILNDKSSK------DSGYEAEY---------------Y-------------
A0A1U3QN81      QSKAKLLGALLNKKKIK------KTEHYSY------------------------------
A0A1M8I0C2      TSKAKLLGVILNNKKQD------QSQYYYYY---------------GGK-----------
A0A1U3NFN6      YCPCKLLGAVMNGKKQT------KHSDYAYY---------------GQ------------
A0A1N1YAY7      QTGVPFLGVILNKFNIH------LEKYGTYG---------------T-YGGYGNYGAYGK
A0A2V2CXY5      RTETPLLGIVLNRADMN------SKSNMYYH---------------RYYRSSYYYNSYGS
A0A357ZDL3      KSESRILGACASYNDRA------SADS-YYA---------------Y-YTVTGHRVRDKY
A0A0F0KYJ9      RAGARALGLVLNKVPRR------GSGAAYYG---------------YQYHGDYYRNDGQE
A0A419GS64      KVNANILGLVMNNLKID------KDAR-PYQ---------------Y-------------
A0A1I6GVG4      RAGARALGLVLNKVPRR------GSGAAYYG---------------YQYHGDYYRSDEQE
A0A1I6IST1      RAGARALGLVLNKVPRR------GSGAAYYG---------------YQYHGDYYRSDEQE
A0A412JBM5      RAGGNLCGVVINGMDMK------ATKYSYRY---------------K-YEDKYGGAKDYG
A0A023X491      SVGAKVLGTVMNNARPA------RNG--TYG---------------G-YTYSYGEAAGS-
A0A1Q7WJN6      RLPVRLLGAVVNDVRSG--------G--DYR---------------Q-YSYYLAGYEVAD
A0A1C2B334      ATNVRLVGVVVNDASDR------AGAY-HNT---------------Y-YGDTDTPRMASQ
R7Y679          ASRVSILGVVLNGVNLK------ARDN-RYG---------------Y-YAQASREGVTA-
A0A0K8Q3D9      KVRGRVLGAVLNYVPTK------GTD--AYA---------------Y-HGTYT-------
A0A2R7RCA1      KVKGRILGAVLNYVPTK------GTD--AYS---------------Y-YGTYT-------
A0A1E2SNF6      QAAGKLTGVVLNRVPRR------GADAVNYG---------------Y-YGAKYGYGYYHD
Q6ADE8          QAAGKLTGVVLNRVPRR------GADAVNYG---------------Y-YGAKYGYGYYHD
A0A1N6CE53      KSDGKLLGAVLNKMPVD------KNS--SYY---------------Y-YYGED-------
A0A1U6THY0      ASSGKVLGVVLNNKKAD------KKG--DYY---------------Y-YGTN--------
A0A420ZS11      KVEAHLLGTVLNDRAVE------KSN--YYY---------------Y-YTEGN-------
A0A1Q7CZ24      P--AKVVGLVVNGDDTR------RSS--YY------------------------------
A0A2W6VLC6      AVGATVAGVVLSMAPTR------GPD--AYG---------------Y-GYGSYGTYSASV
                       *                                                    

A0A2N4T4Q5      APEAPLRPAKEVPDAGTAAPASRAPDTGSTAALETESPADAAVSDLPADESERFDLAAWQ
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      TAQAGFSQIISPAESPGRRQSSAVPPSGPARTTAQARQESV-------------------
A0A222TG79      VGVRDSAER---------------------------------------------------
A0A1L2ZMQ6      TKAKAAADLQEPSVTDNPPTEQIQTPAS--------------------------------
A0A0Q5M6Z7      ADE---------------------------------------------------------
A0A3L7ADK2      ETPAT-------------------------------------------------------
A0A0G3V3M7      GYAHPGEVPKMSRLFPWRKPTNGAGTVRRKPDPEQVGVSASNQGANSSSEAFDDPSF---
A0A1H6WL79      SRDTIPPRSGMNPTSQPGHAGVSVDGNGFEAHSPWQGPAKAAEITSQAM-----------
A0A1Q2CI19      TKGKAKGKRGGARAVADE--KPEASLV---------------------------------
W6JTW4          GSPRSTSKKPRSGGHGPR--SAHGTSASRRDRLGRAEAPSTIRGGGEARH----------
A0A0A0JTY0      DRMSKRKAKRARKGARSRQSGPVGP-----------------------------------
A0A0A0JXF2      TRKAKKKVKRERKLAEKR--GPVAPATPSTSSRPTTGPAEETRSRDAV------------
E6S8H2          GYG------------YGD--KKKGKARKRLPSSAVQGPPELSE-----------------
A0A0A0JGH0      GDTARPQRDSPSPKMELD--PRQQPSAPSVAVPQHASAPEVDR-----------------
N0E4U7          GDT-KKRKGARSARVEAD--RSLRPTRADAST-QFAGSEDGAR-----------------
A3TMH6          GYGQGYDAERSKGIRRVL--PGRRGTTDG-------------------------------
A0A0A0IYK2      NRQSKRKAKRARK-RAQS--RSARSAAEQETTFVDSRTPGASPVHSAESRDTSRNPEDAP
A0A0Q9L0H3      NRQSKKKARRGRK-RQQL--RAAEPVA---------------------------------
A3TMK0          ARKTKKKVKRGRRLADQR--RPAAPVV---------------------------------
A0A3E2DN22      -------------YSSYGSEEQESRESIAVVQEAQ-------------------------
A0A3Q9ULZ9      GKKKRRKKKMSLEEDYFGAVEPAPLGSHPTQDQPSSEGEQ--------------------
A0A3S9JFL2      GKKKRRKKRMSLEEDYFGRVELAPVNSRPTEDEPT-------------------------
A0A0Q5JKD6      SPNGRWRLGL---------------------------------RRRGKKAEVVDAEQEAT
A0A0Q9TBP0      -----------------------------------------------------------T
A0A346XTB0      PGSRRRNGGNEGTRG---------------------------------------------
A0A2W6DK08      ------------------------------------------------------------
A0A2S0LQ32      RPRGWRRL----LPG-------------------------------GRRHTRHQEPAETQ
A0A2N6V1R5      EDEKRKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVP
G9PHS6          EDEKRKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQSNRRSSRRAARSEAPAQVP
U1PLM7          EDEKRKLLGFIPLPGHRKRKRENQIVSIQEEEVHPLPKDKQS-RRSSRRAARSEAPAQVP
A0A351ETF8      ------------------------------------------------------------
A0A349B7N2      ------------------------------------------------------------
A0A346Y185      GE----------------------------------------------------------
A0A259S8H9      HRAATAEDGDDAVDAFAAMANLSPAPLGDAAATAEAPRDGGATVEEGTFTTSSGPADIIT
A0A0Q5L115      GD---------------------------------VGTGGAVGAGAGSGTAPA-------
A0A2W1Z497      DDGSEPAPGTD--------------------GGAEHGTDGDAEARAARGARPSGGSRLTP
A0A1H6YPK1      PAQHDEDDSWEHDEALRKVFPEDVLHRADDVPVLAERDDELVFGQAPEG-----------
A0A2R7MGI0      SHA-TGAEGIKRSTRRGARGVAAKSGPAETGPRRRSNAAPDDARAL--------------
A0A2T7WQY4      PDA-DTRKGAKRTRGRDRRPSSVMGAPGATGPRRRSGTASDDARVG--------------
A0A1G6GTN3      ERS--STKAWWRFRRRGQTTPVAAAEDREAGSRTQPADPPPENVSGL-------------
A0A1N7DLV3      PSSGVDRPRWWRRPWRRATVEKKDAGEQAPGPRRRSAELPPSNVRGL-------------
A0A1V2NSB5      PGSGAERTRWWRRPWRRQVGDAGDAGASAPGPRRRSAELPPSNVSGL-------------
A0A0Q5Q5L3      GRT--EKSTWWRRVLRKSSTEPGAAEEH--GKRRTSADLPAENVSAL-------------
A0A0Q6DVM4      GRT--EKSTWWRRVLRKSSTEPGAAEEH--GKRRTSADLPAENVSAL-------------
A0A1R3WWR6      PRG--TTRSWWRFGRRPRTADSENTTDT--GPRRQSADPPPENVRGL-------------
A0A2S5UYV0      KKGMPVFKSSKGHVDLLEPQPEKNASAAISLAPRPNSQ----------------------
A0A2S5ULV5      KKGMPKFKAVKGHTD-----PSEHFGAQPDVAAPQRES----------------------
A0A2S5X9U6      KKGMPKFKAVKGHAD-----PSEQFRAQNDAVPAQRES----------------------
A0A3Q9IY80      GGEDGFDIDLTEDTAGTMVSAGAPGAASTPSPSSATRPASG-------------------
A0A0F0LP73      SRNDDAAGDDEVAALISEAELSPAAFDGEPPAPEESGAEDEGAS----------------
A0A1F1X071      ---GALGGYDESAVVPDAEEVDVEQAGGPAEPGPASAPA---------------------
A0A3R8RWC7      ---GALGGYDESAVVPDSEEVDVEQAGGPAEPGPVSAPAAAVAAPDAPRPADTEAPRRAA
E3B8H1          SDEASALTPAHELADITLHAPESTPAAGPQVDRGNAGVPLDTTRHDPMRGESSQAPSASA
A0A0Q5AWK6      PQQAATENAAVGRS----------------------------------------------
A0A3N1NLD3      PDGGRSRGRSAGRRAAAEEPARSLPAVRPAEPARAVEPERT-------------------
A0A3N2FVI8      PDGGRSRGRSTGRRAAAEEPARSLPAVRPAEPARAVEPERTRAAEPERAAEPERAAEPER
A0A2S5XDQ6      PQPATGRKR---------------------------------------------------
A0A2S5XNN6      PQPATGRKR---------------------------------------------------
A0A2S5WZJ5      RKGMPVMKSIKRGHEQPEAFAVQTDASAAQTPQPTFAAVAPAAAPARESLAPTRPSASSA
K6WHS4          -------------------YGVNVENNA-------------------DDMSVDKVGTSSA
S3X7T8          --------------DSDYSSSPATASQPTPQKQETSGSKSIPRRATSKHHNAHV------
A0A261FE22      --------------EESETKAKKSSKRSSRKASASAPATQARPQVQAQAPRSARTAVSGK
A0A0J6YE86      --------------NSSTRGGSAESSKTTSANASESRDRSAGDLPARPVTQRRYKTT---
A0A439DNZ6      -----------------TSNSAVATTPRMKVMRRLRRYRPAYQSPGTDPASENEN-----
A0A1E4BP96      -----------------YGSGAADTRPAFVPR----------------------------
A0A151BT98      ---------------SKYGYGEQEMAASGRTRSRRSDKRG--------------------
A0A2Y8ZRF8      ---------------HKYGYGEQPPAARG--QSRRTGKRG--------------------
A0A2R9UAT1      --------------GDYYQADQTPYDEAVHNPPNNVDGITRPVVETQPAATGDPQDQLAP
A0A1F1IHY9      --------------ATYYTASQQQDVAGRS------------------------------
A0A3L8NYD3      ----------------YSAYDRTGGDRSNGNTLRARFLYRRMRRREEREQAQREQTLRER
A0A1Y4CKD6      --------------GGLADEVDEGVKPVVEPEIVEEEVVPPRGKHFRV------------
A0A0Q7KBQ4      -YGQEQHEPIGEQARRMVGALGRGESRSSSGRRVSR------------------------
A0A2S8WHZ8      --------------KYYYSNTEQDPKADAKPSRRLQDPVPVDQPVISSNRFGEIPGLGAH
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      --------------SDAYYYSSSSRH----------------------------------
A0A359IQX7      --------------SKYYRYARDTAQQRGRRAGKPKADRPARAK----------------
A0A0Q9LZR0      --------------SGNYGPLQETPQRAVRSEAGTAATR---------------------
A0A1F1J417      --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
A0A2A8D6P2      --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
A0A448USF4      --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
A0A1F1QKB0      --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
A0A1F0THV9      --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
A0A2I1VJQ6      --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
D8USQ4          --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
E3H5W1          --------------ASYYGYSKDGKKKVSSGAHGA-------------------------
A0A448PRK6      --------------ATYYGYSKDGTKKKVKSRKKAKK-----------------------
A0A433EDP2      --------------ATYYGYSKDGTKKKVKSRKKAKK-----------------------
A0A231VTW0      --------------ATYYGYSKDGTKKKVKSRKKAKK-----------------------
A0A433ECD0      --------------ATYYGYSKDGTKKKVKSRKKAKK-----------------------
U7V3Z1          --------------ATYYGYSKDGTKKKVKSRKKAKK-----------------------
A0A1N7E3F1      -----------------YEADPVEQETSSRTPQPQTPMPV--------------------
A0A372P1T1      -----------------YGYDAAAQEATPETPQPQAPIPV--------------------
A0A1L2ZMV4      --------------DGQRTRRQSGKRRAASSSSK--------------------------
A0A1N5CK61      --------------SSYYGEDASKNSKKKRGSKRAKRNK---------------------
A0A2R7Z032      --------QAEYASREAYSTAGKGKRRSK-------------------------------
A0A1I0W453      --------RAEYTSREAYSTAGKGRRRKEAKAKAAKVDKVEKVDTAEKPSASEKAGTS--
A0A1H4LCS9      --------KSEYASREAYSTAGKGRRKLLKVGKKD-------------------------
A0A0Q6VV12      --------RAEEATREAYSTAGKGRRRKLVRSSSDKA-----------------------
A0A0Q9QB08      --------EADDTSREADATAGGGRRRKHPKKAAKNAAKKDAEAEAQTEADAGV------
A0A1M6K628      AEDDGRRRPAAEVSGARQGRGRSQSTPRPRRVAADDQRVEVVDASADAVVMEPASTQL--
A0A1S1CAD0      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
G5ET14          --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1E9DXX2      --------------ATYYGYGKEGDKKSSKKSSAKK------------------------
A0A1E8S156      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1E8S5S2      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1S1DFA8      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A2I1Z490      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1F0DAA9      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1F0PHK9      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1F0VZG6      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A1E9G8X4      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1E9IAW2      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1E9ZBC9      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1E9ZDP4      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1F0R6B5      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1F0Z7N5      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1F1D897      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
D2NP38          --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1F1FV74      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1E9M791      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A291DEI8      --------------ATYYGYGKDGDKKSSKKSSAKK------------------------
A0A1S1D5T1      --------------STYYGYGKDGDKKSSKKSSAKK------------------------
A0A1E8TRD6      --------------STYYGYSKDGDKKSSKKSSAKK------------------------
A0A1F0XT88      --------------STYYGYSKDGDKKSSKKSSAKK------------------------
A0A1F1EVP5      --------------STYYGYSKDGDKKSSKKSSAKK------------------------
C6R548          --------------STYYGYGKDGDKKSSKKSSAKK------------------------
A0A0K2RXS2      --------------ATYYGYSKDGDKKSSKKSSTKK------------------------
A0A1F0KX60      --------------ATYYGYGKEGDKKSSKKSSTKK------------------------
A0A2T0UZ65      --------------SYEYYKSGPKKGRRRAAKKAKDRVGAGRRG----------------
A0A1R4JTI6      --------------TPDQDFDVTSRNAGSTRE----------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      --------------RR--------------------------------------------
A0A3S0V9U6      --------------KSYYGRSGQGSESAGTKK----------------------------
A0A261FQA1      --------------TSEKSHEPTEKAEQ--------------------------------
A0A1Q2CJ92      --------------YRTDEAQKPHRRERARRVTKLVETDDQAAELAEPRRPVA-------
A0A2T0S3C8      --------------AWRDRMRAPATTELRDLMACGEPESAPERRLDEPIGSGR-------
A0A285VUW0      --------------TAGETRGSRRQSGGARRLARRKGARAARR-----------------
A0A444BL03      --------------SDTKTRKDYAKAASRGKHAE--------------------------
A0A1C6T1J1      --------------GLGTPSVPADRATS-GRHAEHAAAGVS-DRTQELTRLPR-------
A0A2W2CFC8      -----------------SSSLPVDRATA-GRHAEQTAADEPVDNAEELTRLSR-------
R4LD52          --------------SRRAGPVAPVRVAV-GRLPELMGAGRP-GKERSKVGSAS-------
A0A2N3YJR1      --------------SDTKSRRDYEKASR-GRHGTD-------------------------
A0A2W2A4B0      --------------ETQRSHRSAVPGST-SEVTP--------------------------
A0A1H7N9P7      --------------TDRPVPTAPAPLPA-ARSAEAADRPAS-RR----------------
A0A1M7V0F8      --------------A-RVGELPAVPVPA-GRIGQL-------------------------
A0A1Q2CRV2      --------------SYYSDHPRAAPKKGDRKSKKRRARAEVAA-----------------
A0A101KZQ4      --------------AYYRQDTKGRRSAVANPVANDEA-----------------------
A0A1H4I042      ---------------YYYGDNRGSNSRHSRKT----------------------------
A0A022KX11      ARTEPR------------------------------------------------------
A0A2N3R006      GRFSLK------------------------------------------------------
A0A255G8R8      AATGRR--------------------------------AAPSGQRPDDLVLTPRQARE--
A0A345NSU7      KRKRRQ---------------------------GKRDKRMSKSRPHAEAAASARAERAVD
A0A0W8I9Y2      PKTGAQPVVAAPAAKQPWGTAPRAESSDAHQPAGASTRQEPTVPSAEDAAPAPRAERSNG
A0A1U2GAT5      ------------------------------------------------------------
A0A1V8PLV6      SKHKS-------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      DAASQL------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      K-----------------------------------------------------------
A0A2V2CXY5      RSQKQK------------------------------------------------------
A0A357ZDL3      NEDGAYEFLGGEQESVKVEGLSAAVALDTAAPDPAADYVSLAGKGGKKKSKKSRRA----
A0A0F0KYJ9      LPTGTVRGDNANIYAKSK------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      LPSGTVRGDS--------PRRRGESEAA--------------------------------
A0A1I6IST1      LPSGTVRGDSLAPTRPRMPRRASKTRVGS-------------------------------
A0A412JBM5      YGYGYGYGNSGHRRQARGRSGQS-------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      EDELREPAQSLLRDPQ--------------------------------------------
A0A1C2B334      RSRSHDIAQVGLRR----------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ----------SAVAPSVLGEDADLLQRDSDASGS-WVGENYEVDHAMIEEYVPPRRRVKS
A0A2R7RCA1      ----------SAPTSA----PGPVAEAEPDLTGPFWEGPGESVQ---VPESVSAGRRARG
A0A1E2SNF6      ASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPANRGRRAARHG
Q6ADE8          ASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPANRGRRAARHG
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------DVYAGSSRGARGRGAWSRA-----------------------------
A0A2W6VLC6      PDTGWSVSHAAAEASAGVAGAARTESTAGREGTPHREAPFS-------------------
                                                                            

A0A2N4T4Q5      RPGKGTHRA---------------------------------------------------
A0A348NU28      ------------------------------------------------------------
A0A1M3LEY6      ------------------------------------------------------------
A0A222TG79      ------------------------------------------------------------
A0A1L2ZMQ6      -----VASRSRHNEGTRGTSSQSMTVTKPAPDNFDEIVFRGTRAKRSDES----------
A0A0Q5M6Z7      -----------------SGEAQPVASIEAGGDTSVDGQANEQRSRRASRS----------
A0A3L7ADK2      -----TATAQPSDESTVVEGDSATPIAAATPLAAPEEATSRRTVRRSGH-----------
A0A0G3V3M7      ------------------------------------------------------------
A0A1H6WL79      -----LSGLGHAIAGPSNSLTNSSDTPSFLAPESQWRSPSDGRGRRSAPPS---------
A0A1Q2CI19      ---------------------------------EPAEDVQAQRSK---------------
W6JTW4          -----------------DAAGPRPA--------VVEASPDDSVSDRSGG-----------
A0A0A0JTY0      ---------------------PTGHMGDFF---DDAEQPESRRSRRTSSSA---------
A0A0A0JXF2      -----------------GTADPTTTVDPVLGVDDDDVEPDSRRTRRRASSL---------
E6S8H2          -----------------ERVPESRS--------ARREASRKRSSRRTSSSA---------
A0A0A0JGH0      -----------------WSLPPRVD--------DPQDAAPSRRSRHSSH-----------
N0E4U7          -----------------PFSPQADG--------APDDAALSRRARRTSSSA---------
A3TMH6          -----------------SSTPPHPA--------ESEPGAESRRDRRTTSA----------
A0A0A0IYK2      DDLQLDVTPGGEVPTATDEAHAATR--------GEVGEERRRSRRRSSSSA---------
A0A0Q9L0H3      -----------------DELHPPTT--------GDERPRESRHDRRTSSSL---------
A3TMK0          -----------------TESEPDDF--------LDDASRESRRTRRASSA----------
A0A3E2DN22      --------------PAEGLVRVPKKDRADTDTEITP--------RRAK------------
A0A3Q9ULZ9      -----EDATSGGSQPSRAVRTNGSDT-DQIPAGLRPVGPQPKPARRAR------------
A0A3S9JFL2      --------------PSRVTSSSASRSQENRPADLTPVGPRPRPARRAR------------
A0A0Q5JKD6      PRRRSGGLPPENVSGLRTLSQRRMSATAEGEATSEIAVASTAEPDTVDTMSRRRARRG--
A0A0Q9TBP0      SRERAVTGTDAAPDSAPTRAGKDQAGDPVPSAGTPPPSGDTHHGSAPTGHRDTPPVAPAG
A0A346XTB0      ---------------------------------------SHRDADRDADRDADPDGEGA-
A0A2W6DK08      ---------------------------------SYRNLMSYSNGSRGSDRDARFAAVISA
A0A2S0LQ32      EHVPAAS-----------------------------------------------------
A0A2N6V1R5      AQLPAATITSSPVSSRTSAASPRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMP
G9PHS6          AQLPAATITSSPVSSRTSAASPRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMP
U1PLM7          AQLPAATITSSPVSSRTSAASPRVSTVVNPEPVSVPSVQDSGDDTATTEAVASPVGTGMP
A0A351ETF8      -------------------------------------------AEQTAETADA-------
A0A349B7N2      --------------------------DPTSEPLPPPTDGQEQRGIESDELDALDAEGELP
A0A346Y185      --------------------------TPDDRRPQKEVKPRRRPGGRHREKATTK------
A0A259S8H9      DGDAADAGEEASPAIVRPHGSNGRAAAARARRSVPPVEVAEPVGERVDGEDEAHDAAKPR
A0A0Q5L115      ---SREAVTAPAPVV-----------APTPPAAPTPAPVPAPAGAAAAAAAAAAPGGEPA
A0A2W1Z497      SLPDRDASVPRSPVV-----------SPYDPSLELPSRRSRRRAAAVGGTDDTRP-----
A0A1H6YPK1      -----AEKGPGGHESIDETHSEERPPGEISFGHSVDAVEVAVSGRSAVRDTMHLRRLFRT
A0A2R7MGI0      --------------------HAGE-------------------VFRDLG-----------
A0A2T7WQY4      --------------------ASGE-------------------VRRSRG-----------
A0A1G6GTN3      -----RTLAPVTTPAVPGGEVTDEITVPATSGETAAGTLPR--RRTRRG-----------
A0A1N7DLV3      -----RTLAPGRKGSPVPGDSGGE-GVVPVAAPAADVPDDRTSRRRQRG-----------
A0A1V2NSB5      -----RTLSARRNPVAASGDFTGE-GAVAVAPPAAVVADERTPRRRRRG-----------
A0A0Q5Q5L3      -----RPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPR--RRRTTP-----------
A0A0Q6DVM4      -----RPLSHRRTKDRDAGEATSEVEVVRTSEPPVDAGAPR--RRRTTP-----------
A0A1R3WWR6      -----RTLSHGRTSASNQDDSSGE-NVASVTTAPSPVGRRR--QR---------------
A0A2S5UYV0      -----SSEQPPQAVVAQQQAPASET----PSDLSSTPEVQGAPTRRSRRGA---------
A0A2S5ULV5      -----LSPSRPAQPAAEQAAPSQPQAGPVPSSAPTAVATEQPQSRRSRRGA---------
A0A2S5X9U6      -----LAPSQPAQVRSAPVVPAQLE------TQSAEPVSEQPQSRRSRRGA---------
A0A3Q9IY80      -----VTGSPAATGTATPTVVATDS---------------TRRSRRSKR-----------
A0A0F0LP73      -----RERRASRSRTVSDDAASSRATHARPRIAQTGQRSTPVRARRAKDANDLDPDATA-
A0A1F1X071      ------EPGPVVEP------------DGHEPEGDSAAAARTSPRGRRAASTWGR------
A0A3R8RWC7      QASPRPEAQPVAHPARAADESAPVEHDENEPEGDSAPAARTSPRGRRAASTWGR------
E3B8H1          N----VERAPRQATPATSDSDGAP----------------PSRRARRFRANDDA------
A0A0Q5AWK6      -----ARRSPRTQALEPVESRAER----------------PTASRRTLR-----------
A0A3N1NLD3      -----RAAEPERTRVAEPERAVEPARSLEHVVRAAPKAEVPSSFRRPAR-----------
A0A3N2FVI8      AAEPERAAEPERTRVTEPERAAEPARSLEHVVRAAPKAEVPSSFRRPAR-----------
A0A2S5XDQ6      -----AAAAPRRSELAPVESRALP----------------PQTSRRAAR-----------
A0A2S5XNN6      -----AAAAPRRSELAPVESRALP----------------PQTSRRAAR-----------
A0A2S5WZJ5      PRATPAASQPTPPPQTPGSELPSRRSRRGA------------------------------
K6WHS4          S-----------------------------------------------------------
S3X7T8          ------------------------------------------------------------
A0A261FE22      ------------------------------------------------------------
A0A0J6YE86      ------------------------------------------------------------
A0A439DNZ6      ------------------------------------------------------------
A0A1E4BP96      ------------------------------------------------------------
A0A151BT98      ------------------------------------------------------------
A0A2Y8ZRF8      ------------------------------------------------------------
A0A2R9UAT1      LRRTRRRAG---------------------------------------------------
A0A1F1IHY9      ------------------------------------------------------------
A0A3L8NYD3      TAARENEHGQPPVELTSIAGKRRSS-----------------------------------
A0A1Y4CKD6      ------------------------------------------------------------
A0A0Q7KBQ4      ------------------------------------------------------------
A0A2S8WHZ8      AGSSEPEFRRLRRRR---------------------------------------------
A0A1Y4CTD2      ------------------------------------------------------------
A0A3N3ZPU0      ------------------------------------------------------------
A0A359IQX7      ------------------------------------------------------------
A0A0Q9LZR0      ------------------------------------------------------------
A0A1F1J417      ------------------------------------------------------------
A0A2A8D6P2      ------------------------------------------------------------
A0A448USF4      ------------------------------------------------------------
A0A1F1QKB0      ------------------------------------------------------------
A0A1F0THV9      ------------------------------------------------------------
A0A2I1VJQ6      ------------------------------------------------------------
D8USQ4          ------------------------------------------------------------
E3H5W1          ------------------------------------------------------------
A0A448PRK6      ------------------------------------------------------------
A0A433EDP2      ------------------------------------------------------------
A0A231VTW0      ------------------------------------------------------------
A0A433ECD0      ------------------------------------------------------------
U7V3Z1          ------------------------------------------------------------
A0A1N7E3F1      ------------------------------------------------------------
A0A372P1T1      ------------------------------------------------------------
A0A1L2ZMV4      ------------------------------------------------------------
A0A1N5CK61      ------------------------------------------------------------
A0A2R7Z032      ------------------------------------------------------------
A0A1I0W453      ------------------------------------------------------------
A0A1H4LCS9      ------------------------------------------------------------
A0A0Q6VV12      ------------------------------------------------------------
A0A0Q9QB08      ------------------------------------------------------------
A0A1M6K628      ------------------------------------------------------------
A0A1S1CAD0      ------------------------------------------------------------
G5ET14          ------------------------------------------------------------
A0A1E9DXX2      ------------------------------------------------------------
A0A1E8S156      ------------------------------------------------------------
A0A1E8S5S2      ------------------------------------------------------------
A0A1S1DFA8      ------------------------------------------------------------
A0A2I1Z490      ------------------------------------------------------------
A0A1F0DAA9      ------------------------------------------------------------
A0A1F0PHK9      ------------------------------------------------------------
A0A1F0VZG6      ------------------------------------------------------------
A0A1E9G8X4      ------------------------------------------------------------
A0A1E9IAW2      ------------------------------------------------------------
A0A1E9ZBC9      ------------------------------------------------------------
A0A1E9ZDP4      ------------------------------------------------------------
A0A1F0R6B5      ------------------------------------------------------------
A0A1F0Z7N5      ------------------------------------------------------------
A0A1F1D897      ------------------------------------------------------------
D2NP38          ------------------------------------------------------------
A0A1F1FV74      ------------------------------------------------------------
A0A1E9M791      ------------------------------------------------------------
A0A291DEI8      ------------------------------------------------------------
A0A1S1D5T1      ------------------------------------------------------------
A0A1E8TRD6      ------------------------------------------------------------
A0A1F0XT88      ------------------------------------------------------------
A0A1F1EVP5      ------------------------------------------------------------
C6R548          ------------------------------------------------------------
A0A0K2RXS2      ------------------------------------------------------------
A0A1F0KX60      ------------------------------------------------------------
A0A2T0UZ65      ------------------------------------------------------------
A0A1R4JTI6      ------------------------------------------------------------
A0A0G3V3F3      ------------------------------------------------------------
A0A0Q7QDF6      ------------------------------------------------------------
A0A3S0V9U6      ------------------------------------------------------------
A0A261FQA1      ------------------------------------------------------------
A0A1Q2CJ92      ------------------------------------------------------------
A0A2T0S3C8      ------------------------------------------------------------
A0A285VUW0      ------------------------------------------------------------
A0A444BL03      ------------------------------------------------------------
A0A1C6T1J1      ------------------------------------------------------------
A0A2W2CFC8      ------------------------------------------------------------
R4LD52          ------------------------------------------------------------
A0A2N3YJR1      ------------------------------------------------------------
A0A2W2A4B0      ------------------------------------------------------------
A0A1H7N9P7      ------------------------------------------------------------
A0A1M7V0F8      ------------------------------------------------------------
A0A1Q2CRV2      ------------------------------------------------------------
A0A101KZQ4      ------------------------------------------------------------
A0A1H4I042      ------------------------------------------------------------
A0A022KX11      ---------------------AKQRARG--------------------------------
A0A2N3R006      ------------------------------------------------------------
A0A255G8R8      ------------------------------------------------------------
A0A345NSU7      GGEA------LEFRSRARQRLDRRNGSG--------------------------------
A0A0W8I9Y2      QGSAEHESFGLEAWGRSGSSTGSTAQGH--------------------------------
A0A1U2GAT5      --------------------YGKSADGV--------------------------------
A0A1V8PLV6      ------------------------------------------------------------
A0A1X6X0E0      ------------------------------------------------------------
A0A357ZCV8      ------------------------------------------------------------
A0A2S8MDM2      ------------------------------------------------------------
A0A1X6Y1L5      ------------------------------------------------------------
A0A1U3QN81      ------------------------------------------------------------
A0A1M8I0C2      ------------------------------------------------------------
A0A1U3NFN6      ------------------------------------------------------------
A0A1N1YAY7      ------------------------------------------------------------
A0A2V2CXY5      ------------------------------------------------------------
A0A357ZDL3      ------------------------------------------------------------
A0A0F0KYJ9      ------------------------------------------------------------
A0A419GS64      ------------------------------------------------------------
A0A1I6GVG4      ------------------------------------------------------------
A0A1I6IST1      ------------------------------------------------------------
A0A412JBM5      ------------------------------------------------------------
A0A023X491      ------------------------------------------------------------
A0A1Q7WJN6      ------------------------------------------------------------
A0A1C2B334      ------------------------------------------------------------
R7Y679          ------------------------------------------------------------
A0A0K8Q3D9      ------------------------------------------------------------
A0A2R7RCA1      ------------------------------------------------------------
A0A1E2SNF6      ------------------------------------------------------------
Q6ADE8          ------------------------------------------------------------
A0A1N6CE53      ------------------------------------------------------------
A0A1U6THY0      ------------------------------------------------------------
A0A420ZS11      ------------------------------------------------------------
A0A1Q7CZ24      ------------------------------------------------------------
A0A2W6VLC6      ------------------------------------------------------------
                                                                            

A0A2N4T4Q5      -------------------------------------------
A0A348NU28      -------------------------------------------
A0A1M3LEY6      -------------------------------------------
A0A222TG79      -------------------------------------------
A0A1L2ZMQ6      -------------------------------------------
A0A0Q5M6Z7      -------------------------------------------
A0A3L7ADK2      -------------------------------------------
A0A0G3V3M7      -------------------------------------------
A0A1H6WL79      -------------------------------------------
A0A1Q2CI19      -------------------------------------------
W6JTW4          -------------------------------------------
A0A0A0JTY0      -------------------------------------------
A0A0A0JXF2      -------------------------------------------
E6S8H2          -------------------------------------------
A0A0A0JGH0      -------------------------------------------
N0E4U7          -------------------------------------------
A3TMH6          -------------------------------------------
A0A0A0IYK2      -------------------------------------------
A0A0Q9L0H3      -------------------------------------------
A3TMK0          -------------------------------------------
A0A3E2DN22      -------------------------------------------
A0A3Q9ULZ9      -------------------------------------------
A0A3S9JFL2      -------------------------------------------
A0A0Q5JKD6      -------------------------------------------
A0A0Q9TBP0      HGDSRKTAVAEPGDDVA--------------------------
A0A346XTB0      -------------------------------------------
A0A2W6DK08      NDRAHSDRHWRRAEMSELIWHPSTPAPNGFLPERRP-------
A0A2S0LQ32      -------------------------------------------
A0A2N6V1R5      VPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
G9PHS6          VPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
U1PLM7          VPPPAASISQPVGEETAVQTSAAFGAPQASVPTRRSLRERRNG
A0A351ETF8      -------------------------------------------
A0A349B7N2      EVHPADR------------------------------------
A0A346Y185      -------------------------------------------
A0A259S8H9      YARRNARP-----------------------------------
A0A0Q5L115      PARVPASPASPAAPTSPAVPASPVEAPGGALTRREIRERERTR
A0A2W1Z497      -------------------------------------------
A0A1H6YPK1      -------------------------------------------
A0A2R7MGI0      -------------------------------------------
A0A2T7WQY4      -------------------------------------------
A0A1G6GTN3      -------------------------------------------
A0A1N7DLV3      -------------------------------------------
A0A1V2NSB5      -------------------------------------------
A0A0Q5Q5L3      -------------------------------------------
A0A0Q6DVM4      -------------------------------------------
A0A1R3WWR6      -------------------------------------------
A0A2S5UYV0      -------------------------------------------
A0A2S5ULV5      -------------------------------------------
A0A2S5X9U6      -------------------------------------------
A0A3Q9IY80      -------------------------------------------
A0A0F0LP73      -------------------------------------------
A0A1F1X071      -------------------------------------------
A0A3R8RWC7      -------------------------------------------
E3B8H1          -------------------------------------------
A0A0Q5AWK6      -------------------------------------------
A0A3N1NLD3      -------------------------------------------
A0A3N2FVI8      -------------------------------------------
A0A2S5XDQ6      -------------------------------------------
A0A2S5XNN6      -------------------------------------------
A0A2S5WZJ5      -------------------------------------------
K6WHS4          -------------------------------------------
S3X7T8          -------------------------------------------
A0A261FE22      -------------------------------------------
A0A0J6YE86      -------------------------------------------
A0A439DNZ6      -------------------------------------------
A0A1E4BP96      -------------------------------------------
A0A151BT98      -------------------------------------------
A0A2Y8ZRF8      -------------------------------------------
A0A2R9UAT1      -------------------------------------------
A0A1F1IHY9      -------------------------------------------
A0A3L8NYD3      -------------------------------------------
A0A1Y4CKD6      -------------------------------------------
A0A0Q7KBQ4      -------------------------------------------
A0A2S8WHZ8      -------------------------------------------
A0A1Y4CTD2      -------------------------------------------
A0A3N3ZPU0      -------------------------------------------
A0A359IQX7      -------------------------------------------
A0A0Q9LZR0      -------------------------------------------
A0A1F1J417      -------------------------------------------
A0A2A8D6P2      -------------------------------------------
A0A448USF4      -------------------------------------------
A0A1F1QKB0      -------------------------------------------
A0A1F0THV9      -------------------------------------------
A0A2I1VJQ6      -------------------------------------------
D8USQ4          -------------------------------------------
E3H5W1          -------------------------------------------
A0A448PRK6      -------------------------------------------
A0A433EDP2      -------------------------------------------
A0A231VTW0      -------------------------------------------
A0A433ECD0      -------------------------------------------
U7V3Z1          -------------------------------------------
A0A1N7E3F1      -------------------------------------------
A0A372P1T1      -------------------------------------------
A0A1L2ZMV4      -------------------------------------------
A0A1N5CK61      -------------------------------------------
A0A2R7Z032      -------------------------------------------
A0A1I0W453      -------------------------------------------
A0A1H4LCS9      -------------------------------------------
A0A0Q6VV12      -------------------------------------------
A0A0Q9QB08      -------------------------------------------
A0A1M6K628      -------------------------------------------
A0A1S1CAD0      -------------------------------------------
G5ET14          -------------------------------------------
A0A1E9DXX2      -------------------------------------------
A0A1E8S156      -------------------------------------------
A0A1E8S5S2      -------------------------------------------
A0A1S1DFA8      -------------------------------------------
A0A2I1Z490      -------------------------------------------
A0A1F0DAA9      -------------------------------------------
A0A1F0PHK9      -------------------------------------------
A0A1F0VZG6      -------------------------------------------
A0A1E9G8X4      -------------------------------------------
A0A1E9IAW2      -------------------------------------------
A0A1E9ZBC9      -------------------------------------------
A0A1E9ZDP4      -------------------------------------------
A0A1F0R6B5      -------------------------------------------
A0A1F0Z7N5      -------------------------------------------
A0A1F1D897      -------------------------------------------
D2NP38          -------------------------------------------
A0A1F1FV74      -------------------------------------------
A0A1E9M791      -------------------------------------------
A0A291DEI8      -------------------------------------------
A0A1S1D5T1      -------------------------------------------
A0A1E8TRD6      -------------------------------------------
A0A1F0XT88      -------------------------------------------
A0A1F1EVP5      -------------------------------------------
C6R548          -------------------------------------------
A0A0K2RXS2      -------------------------------------------
A0A1F0KX60      -------------------------------------------
A0A2T0UZ65      -------------------------------------------
A0A1R4JTI6      -------------------------------------------
A0A0G3V3F3      -------------------------------------------
A0A0Q7QDF6      -------------------------------------------
A0A3S0V9U6      -------------------------------------------
A0A261FQA1      -------------------------------------------
A0A1Q2CJ92      -------------------------------------------
A0A2T0S3C8      -------------------------------------------
A0A285VUW0      -------------------------------------------
A0A444BL03      -------------------------------------------
A0A1C6T1J1      -------------------------------------------
A0A2W2CFC8      -------------------------------------------
R4LD52          -------------------------------------------
A0A2N3YJR1      -------------------------------------------
A0A2W2A4B0      -------------------------------------------
A0A1H7N9P7      -------------------------------------------
A0A1M7V0F8      -------------------------------------------
A0A1Q2CRV2      -------------------------------------------
A0A101KZQ4      -------------------------------------------
A0A1H4I042      -------------------------------------------
A0A022KX11      -------------------------------------------
A0A2N3R006      -------------------------------------------
A0A255G8R8      -------------------------------------------
A0A345NSU7      -------------------------------------------
A0A0W8I9Y2      -------------------------------------------
A0A1U2GAT5      -------------------------------------------
A0A1V8PLV6      -------------------------------------------
A0A1X6X0E0      -------------------------------------------
A0A357ZCV8      -------------------------------------------
A0A2S8MDM2      -------------------------------------------
A0A1X6Y1L5      -------------------------------------------
A0A1U3QN81      -------------------------------------------
A0A1M8I0C2      -------------------------------------------
A0A1U3NFN6      -------------------------------------------
A0A1N1YAY7      -------------------------------------------
A0A2V2CXY5      -------------------------------------------
A0A357ZDL3      -------------------------------------------
A0A0F0KYJ9      -------------------------------------------
A0A419GS64      -------------------------------------------
A0A1I6GVG4      -------------------------------------------
A0A1I6IST1      -------------------------------------------
A0A412JBM5      -------------------------------------------
A0A023X491      -------------------------------------------
A0A1Q7WJN6      -------------------------------------------
A0A1C2B334      -------------------------------------------
R7Y679          -------------------------------------------
A0A0K8Q3D9      -------------------------------------------
A0A2R7RCA1      -------------------------------------------
A0A1E2SNF6      -------------------------------------------
Q6ADE8          -------------------------------------------
A0A1N6CE53      -------------------------------------------
A0A1U6THY0      -------------------------------------------
A0A420ZS11      -------------------------------------------
A0A1Q7CZ24      -------------------------------------------
A0A2W6VLC6      -------------------------------------------
                                                           

© 1998-2019