BYKdb

Dataset for cluster tad of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I0UTA4      MYGAAIAFGTTLVVSNGIGPAGAGEFFRLMALFAIATSTAVFGADTGLVRTISAQNALGR
Q1AUN7      -------MSTDTTTAREAAPAGRDAFFSAKEFL---------------------------
                   :.*  ..:.  .*** . **    ::                           

I0UTA4      YSAIPRLIRYAVLPPLALSLGITAVACIYSVAVPMPHEYAVALRMSALFVIVAAVMSVYF
Q1AUN7      ------------------------------------------------------------
                                                                        

I0UTA4      GALRGLNHVVTFTVMQNVLLPTLRFGAIALVVFASGHLLDLVFAWTLPVAATALLTLWVV
Q1AUN7      ------------------------------------------------------------
                                                                        

I0UTA4      ESYMPRSKDRPQSEAAATTPQESAHSFWTFSSARGVATIVETILEWIDVLTVTTVLGPAA
Q1AUN7      ------------------------------------------------------------
                                                                        

I0UTA4      GGVYGAVNRCVRVGTMVEHTGRIVTGPSISAALATQNIDRARQIFLATTRVLTAISWPFY
Q1AUN7      -------------------------------------------------KVLRRRAWAVV
                                                             .**   :*.. 

I0UTA4      LTLAAFGPTLLGFFGKGFEEGAGILWVICPAAMLSMSAGGVQSILLMSGKSRWQLLNKLS
Q1AUN7      FVASALAASAVGF-----------------------------------------------
            :. :*:..: :**                                               

I0UTA4      SLAVAIILNVALVPLWGLYGAVTAWASALLIDTFLASYQVFRLVGIRTSLTEMAPALTLG
Q1AUN7      ------------------------------------------------------------
                                                                        

I0UTA4      ALVPLGCSFVVLTVVGQGLLGLVLYVILLAPSYVALLYYFRTQLGIERFLASRKGGGKGA
Q1AUN7      -----------------GLLQTPVYEASIT------------------ILVGQKSGEEGP
                             ***   :*   ::                  :*...*.* :*.

I0UTA4      GTRSALAHQLSIQGENTMSKLSATTDAPAVSLREQLHRVWRHKMIVIITIVVCTLIAVAF
Q1AUN7      RNLS--------------------------------------------------------
             . *                                                        

I0UTA4      SFLAPPKYTAKSSVLVNPLVTDPAAGGNANSLKVDISTESRAAGSREVADKAADNLRSEG
Q1AUN7      --------------------------GDVEGLQQLAQTVAEAVATRPIAEAAAQKLGL--
                                      *:.:.*:   .* : *..:* :*: **::*    

I0UTA4      VDTDSKLTDKLMNSTKVVPTSQTAVLDIEVSDSNAKRSAQYANAIAKAYLEVRQNNLKET
Q1AUN7      --SEEYAQKTLLGNLRVEQRPGTMFVEVRYRDPDPQRAQRVANAVGEVF-----------
              ::.   ..*:.. .*   . * .:::   *.:.:*: . ***:.:.:           

I0UTA4      ITDSVKKLDAQIKQLEDEDKNNNGNANSAKISQMRERRNQIQLTSTVGGRVLTEAQPPKK
Q1AUN7      ---------------------------SERVSEVSPGANAITAT------VWEEAVAPET
                                       * .:*::    * *  *      *  ** .*:.

I0UTA4      ATGLGHRKTALAGVGTGLLLGVLIAYVYDRMMRTVGYSDRLKDL-GIPVQTVRPRSSDED
Q1AUN7      PVSPDPLLNGLVALALGLLLGLGLAFLLEYLDDSWESPEEVERVSGVPTFGVIPG-----
            ... .   ..*..:. *****: :*:: : :  :   .: :: : *:*.  * *      

I0UTA4      TLLLMRRIGSPDGNLRASNISGIVIVSDSPALADQLHRQLYRTIPSGKAYFTDYPALSKV
Q1AUN7      ------------------------------------------------------------
                                                                        

I0UTA4      LEHYSPEQVIESNEIPMVINLADEAPLSTLLRLSEACRVCLVPVGELSSRAQVRELFSHL
Q1AUN7      ------------------------------------------------------------
                                                                        

I0UTA4      RTLENTVSIAIFMDTDPEKEKVDGATA
Q1AUN7      -----------FQVKTSEKKKGGG---
                       *  . .**:* .*   

© 1998-2019