BYKdb

Dataset for cluster tadcd of phylum actinobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

1020 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      ------------------------------------------------------------
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      MAGLSAATADQLVRLGGAAALGVLAVVLLRRSPQLGVGGWLAVVCLVPVWAGVGLGAYFE
A0A0B2BAQ1      ------------------------------------------------------------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ------------------------------------------------------------
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      ------------------------------------------------------------
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      ------------------------------------------------------------
A0A317DND7      ------------------------------------------------------------
C4FFN7          ------------------------------------------------------------
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ------------------------------------------------------------
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ------------------------------------------------------------
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      ------------------------------------------------------------
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ------------------------------------------------------------
D3R6R7          ------------------------------------------------------------
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      ------------------------------------------------------------
A0A3E0W260      ------------------------------------------------------------
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      ------------------------------------------------------------
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------------
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ------------------------------------------------------------
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ------------------------------------------------------------
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      ------------------------------------------------------------
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      ------------------------------------------------------------
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      PQVLAGLAAVGALVLVRRCVPLSPVGADLLIAAFALSALLPALVGRGTANGVFVLLAHWA
A0A0B2BAQ1      ------------------------------------------------------------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ------------------------------------------------------------
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      ------------------------------------------------------------
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      ------------------------------------------------------------
A0A317DND7      ------------------------------------------------------------
C4FFN7          ------------------------------------------------------------
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ------------------------------------------------------------
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ------------------------------------------------------------
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      ------------------------------------------------------------
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ------------------------------------------------------------
D3R6R7          ------------------------------------------------------------
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      ------------------------------------------------------------
A0A3E0W260      ------------------------------------------------------------
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      ------------------------------------------------------------
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------------
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ------------------------------------------------------------
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ------------------------------------------------------------
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      ------------------------------------------------------------
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      ------------------------------------------------------------
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      SAYLLGRLAGHRLPLGRVYALVAVAFTAVAVLALVEWVAGWNPFHLVPGSGGLREVWATI
A0A0B2BAQ1      ------------------------------------------------------------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ------------------------------------------------------------
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      ------------------------------------------------------------
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      ------------------------------------------------------------
A0A317DND7      ------------------------------------------------------------
C4FFN7          ------------------------------------------------------------
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ------------------------------------------------------------
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ------------------------------------------------------------
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      ------------------------------------------------------------
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ------------------------------------------------------------
D3R6R7          ------------------------------------------------------------
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      ------------------------------------------------------------
A0A3E0W260      ------------------------------------------------------------
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      ------------------------------------------------------------
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------------
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ------------------------------------------------------------
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ------------------------------------------------------------
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      ------------------------------------------------------------
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      ------------------------------------------------------------
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      QERGGVARAEGAFGHSIALGGSLALALPLTLAAPLRPAVRLGMAVLMGAACAVTFSRIGL
A0A0B2BAQ1      ------------------------------------------------------------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ------------------------------------------------------------
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      ------------------------------------------------------------
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      ------------------------------------------------------------
A0A317DND7      ------------------------------------------------------------
C4FFN7          ------------------------------------------------------------
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ------------------------------------------------------------
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ------------------------------------------------------------
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      ------------------------------------------------------------
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ------------------------------------------------------------
D3R6R7          ------------------------------------------------------------
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      ------------------------------------------------------------
A0A3E0W260      ------------------------------------------------------------
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      ------------------------------------------------------------
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------------
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ------------------------------------------------------------
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ------------------------------------------------------------
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      ------------------------------------------------------------
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      ----------------------------------------------------MRGFPRKK
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      GTAVLGVLLSIAFLRTGLPGRLRLLICGGLLVGAAAAAPLVTQVFAAAGDEASGSAGYRA
A0A0B2BAQ1      ------------------------------------------------------------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ------------------------------------------------------------
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      ------------------------------------------------------------
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      ------------------------------------------------------------
A0A317DND7      ------------------------------------------------------------
C4FFN7          ------------------------------------------------------------
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ------------------------------------------------------------
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ------------------------------------------------------------
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      ------------------------------------------------------------
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ------------------------------------------------------------
D3R6R7          ------------------------------------------------------------
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      ------------------------------------------------------------
A0A3E0W260      ------------------------------------------------------------
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      ------------------------------------------------------------
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------------
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ------------------------------------------------------------
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ------------------------------------------------------------
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      ------------------------------------------------------------
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      PRDGLIIFPTDERRVESGPPSADRAGRGRAESGPASERPADQGRSSRRTAAPAPPGREAA
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      DLLSLLGEARLLGLSPSYWRSPTGEASFGTFRSIDSALVLTTLTYGWIPLAFLGAAVLSA
A0A0B2BAQ1      ------------------------------------------------------------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      ------------------------------------------------------------
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ------------------------------------------------------------
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      ------------------------------------------------------------
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      -----------------------------------------------------MWLSTIA
A0A317DND7      ------------------------------------------------------------
C4FFN7          ------------------------------------------------------------
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ------------------------------------------------------------
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ------------------------------------------------------------
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      ------------------------------------------------------------
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ------------------------------------------------------------
D3R6R7          ------------------------------------------------------------
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      ---------------------------------------------------------MPR
A0A3E0W260      ------------------------------------------------------------
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      ------------------------------------------------------------
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------------
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ------------------------------------------------------------
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ------------------------------------------------------------
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      ------------------------------------------------------------
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      ------------------------------------------------------------
A0A2W6BNW8      RPVKPDPPTAPSGSEGPSASERTAASLAARAAQAQPPPAASLPSSRGPEAQGPPRPEHQV
A0A399VFU7      ------------------------------------------------------------
A0A0Q7MSV5      ------------------------------------------------------------
A0A0B2BPU3      ------------------------------------------------------------
A0A2T7V028      ------------------------------------------------------------
A0A2A9EEP9      ------------------------------------------------------------
A0A372J6J7      VVVVVRGQATAPTVALVAQLPAFATVALITQYASLVWFVAGLAVAAQALAPRGERAADPP
A0A0B2BAQ1      -------------------------------------------------------MTQPS
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      -------------------------------------------------------MASIP
A0A1S1CQC5      ------------------------------------------------------------
A0A1E9T6I0      ------------------------------------------------------------
A0A1F1GHA7      ------------------------------------------------------------
A0A1Y1RLX5      ------------------------------------------------------------
A0A1U4M0Y5      ------------------------------------------------------------
A0A3D3LZQ2      ------------------------------------------------------------
A0A176UCN8      ------------------------------------------------------------
A0A3D1Z248      ------------------------------------------------------------
A0A0A0UDT2      ------------------------------------------------------------
A0A0S2MGZ8      ------------------------------------------------------------
A0A151C7E4      ------------------------------------------------------------
A0A1X2YST6      ------------------------------------------------------------
A0A1X2ZYS4      ------------------------------------------------------------
I3BG34          ------------------------------------------------------------
A0A229W018      ------------------------------------------------------------
A0A430FEG8      ------------------------------------------------------------
A0A087CXM2      ------------------------------------------------------------
A0A1Q6F212      ------------------------------------------------------------
C0BRP2          ------------------------------------------------------------
A0A3C0AT24      ------------------------------------------------------------
A0A3D0PUZ0      ------------------------------------------------------------
A0A086ZSZ1      ------------------------------------------------------------
A0A087BBC7      ------------------------------------------------------------
A0A087BEY8      ------------------------------------------------------------
A0A2N3QE62      ------------------------------------------------------------
A0A2N3QZ25      ------------------------------------------------------------
A0A1C7FTC7      ------------------------------------------------------------
A0A315S2E9      ------------------------------------------------------------
B8DWQ4          ------------------------------------------------------------
A0A087B589      ------------------------------------------------------------
A0A2N3R436      ------------------------------------------------------------
A0A395XCD7      ------------------------------------------------------------
A0A3A9A6J6      ------------------------------------------------------------
A0A0A7I958      ------------------------------------------------------------
A0A248X5N3      ------------------------------------------------------------
A0A2A2EI34      ------------------------------------------------------------
A0A430F4X9      ------------------------------------------------------------
A0A2A2EMB5      ------------------------------------------------------------
A0A2N5IVW1      ------------------------------------------------------------
A0A087ADW7      ------------------------------------------------------------
A0A2D3D401      ------------------------------------------------------------
A0A126SX27      ------------------------------------------------------------
A0A413KCG4      ------------------------------------------------------------
A0A1V8PLX8      ------------------------------------------------------------
A0A2G5PT07      ------------------------------------------------------------
A0A415BXP4      ------------------------------------------------------------
A7A7K6          ------------------------------------------------------------
A0A1X2ZA33      ---------------------------------------------------MRSMYEGMR
A0A0C2V870      ------------------------------------------------------------
A0A1X2YSY1      ------------------------------------------------------------
A0A0B5BIW6      ------------------------------------------------------------
A0A1X2ZAM7      ------------------------------------------------------------
A0A1X3A4T4      ------------------------------------------------------------
A0A087DNN8      ------------------------------------------------------------
A0A1X2ZG21      ------------------------------------------------------------
A0A415AYL8      ------------------------------------------------------------
A0A076JNF6      ------------------------------------------------------------
R5H175          ------------------------------------------------------------
A0A174A3G1      ------------------------------------------------------------
A0A174BGC0      ------------------------------------------------------------
A0A1X2YTE2      ------------------------------------------------------------
A0A1X3A989      ------------------------------------------------------------
A0A0G9MCI5      ------------------------------------------------------------
A0A3D1TNE2      ------------------------------------------------------------
A0A1E7XZI4      ------------------------------------------------------------
A0A1V8Q806      ------------------------------------------------------------
A0A261GBL8      ------------------------------------------------------------
A0A087CP34      ------------------------------------------------------------
A0A087ASS3      ------------------------------------------------------------
A0A087CKX0      ------------------------------------------------------------
A0A430FBN0      ------------------------------------------------------------
A0A229VWJ7      ------------------------------------------------------------
A0A261FK83      --------------------------------------------------------MNGR
A0A0A6VNM8      ------------------------------------------------------------
A0A2N0STP1      ------------------------------------------------------------
E5Y0V8          ------------------------------------------------------------
A0A1D7UM15      ------------------------------------------------------------
A0A2N0TGF7      ------------------------------------------------------------
V6XUQ8          ------------------------------------------------------------
A0A430FFY5      ------------------------------------------------------------
A0A2T3GJ40      ------------------------------------------------------------
A0A261FRA0      ------------------------------------------------------------
A0A2U2N5R0      ------------------------------------------------------------
T2HZI3          ------------------------------------------------------------
A0A087A7B6      ------------------------------------------------------------
A0A2T3G840      ------------------------------------------------------------
A0A0A1GPZ1      ------------------------------------------------------------
A0A083X494      ------------------------------------------------------------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ------------------------------------------------------------
A0A374SXN6      ------------------------------------------------------------
A0A414V4B5      ------------------------------------------------------------
C5E898          ------------------------------------------------------------
A0A2I1IYZ4      ------------------------------------------------------------
I3AR06          ------------------------------------------------------------
A0A2N5J0F3      ------------------------------------------------------------
A0A3A4WFE0      ------------------------------------------------------------
A0A086ZYI3      ------------------------------------------------------------
A0A087DKU0      ------------------------------------------------------------
A0A2T3C430      PTTHSGAFPVSGFPLSNDGGPPGSDWLARTSCPSTFPPTRRTTNHSLPAHHFAASSGRFS
A0A317DND7      ------------------------------------------------------------
C4FFN7          ----------------------------------------------------------MI
A0A087BKW6      ------------------------------------------------------------
A0A126SYB4      ----------------------------------------------------------MI
A0A0F0L1W1      ------------------------------------------------------------
A0A1I6JH27      ------------------------------------------------------------
A0A0D8BLB2      ------------------------------------------------------------
A0A3Q9CQB2      ------------------------------------------------------------
A0A1H1SPW6      ------------------------------------------------------------
A0A2R4G4T8      ------------------------------------------------------------
B6XVL3          ----------------------------------------------MPSFLGTGHTIILS
A0A430FRP4      ------------------------------------------------------------
A0A2U2RJU3      -------------------------------------------MRAGRRSRVGGTLGDVR
A0A1P8U1C6      ------------------------------------------------------------
K7S215          ------------------------------------------------------------
A0A344UWM2      ------------------------------------------------------------
A0A3M9MHZ0      ------------------------------------------------------------
A0A127A501      ------------------------------------------------------------
A0A2W6DJY1      ------------------------------------------------------------
A0A2N3QQ61      ------------------------------------------------------------
A0A0L7BSV7      ----------------------------------------------------------MR
D3R6R7          ----------------------------------------------------------MR
E8NEF0          ------------------------------------------------------------
A0A2R9UAE0      ------------------------------------------------------------
A0A165I7L3      ------------------------------------------------------------
A0A443JMZ6      ------------------------------------------------------------
R6NVA8          ------------------------------------------------------------
A0A174B9F5      ------------------------------------------------------------
A0A3E5ATI8      ------------------------------------------------------------
A0A267WLK2      ------------------------------------------------------------
A0A2G5Q517      ------------------------------------------------------------
A1A356          ------------------------------------------------------------
A0A1X2ZNC3      ------------------------------------------------------------
A0A412K6M4      ------------------------------------------------------------
A0A261FZA3      ------------------------------------------------------------
A0A087D923      ------------------------------------------------------------
A0A2N5IRG9      ------------------------------------------------------------
A0A448R4J3      ------------------------------------------------------------
A0A3A5HBN2      SRLAPCQPRRPPARSRSRHVRPPASPKSRRPVGTLTYARTTPRARPSRRTVRERGPRRRS
A0A3E0W260      -------------------------------------MRHERTDLRRGRVPLPSSLSSST
A0A371NXN9      ------------------------------------------------------------
A0A1U7MRN3      ------------------------------------------------------------
A0A285VW57      ------------------------------------------------------------
A0A448NYH5      ------------------------------------------------------------
A0A1X6X4B5      ------------------------------------------------------------
A0A366ILB0      ------------------------------------------------------------
A0A3N4Z5J3      ------------------------------------------------------------
A0A1I2I8S9      ------------------------------------------------------------
A0A1Q8LIL7      ------------------------------------------------------------
A0A430FVU4      ------------------------------------------------------------
A0A1G8DY24      ------------------------------------------------------------
A0A2W5XV31      ------------------------------------------------------------
A0A417Z5F8      ------------------------------------------------------------
A0A2C7B062      ------------------------------------------------------------
A0A3Q9UNX8      ------------------------------------------------------------
A0A344UX64      ------------------------------------------------------------
A0A3S9JFD4      ------------------------------------------------------------
A0A2S5W2F7      ------------------------------------------------------------
A0A3E0VYJ0      ------------------------------------------------------------
A0A399NHL8      ------------------------------------------------------------
A0A3S8SNK3      ------------------------------------------------------------
A0A260DSD5      ------------------------------------------------------------
A0A1B3PZG7      ------------------------------------------------------------
G4CXH7          ------------------------------------------------------------
U7IS15          ------------------------------------------------------------
U7J8K7          ------------------------------------------------------------
U7K617          ------------------------------------------------------------
U7MEN9          ------------------------------------------------------------
S3WQQ9          ------------------------------------------------------------
A0A2W1QU49      --------------------------------------------------------MARG
A0A413RMG9      ------------------------------------------------------------
A0A1I4JX94      ------------------------------------------------------------
A0A1M3AX45      ------------------------------------------------------------
A0A0Q8LJ68      ------------------------------------------------------------
A0A1H3U5E8      ------------------------------------------------------------
N1V0H1          ------------------------------------------------------------
A0A2V5FP96      ------------------------------------------------------------
A0A0A1D2Z9      ------------------------------------------------------------
A0A0S2M268      ------------------------------------------------------------
A0A2V5ITQ5      ------------------------------------------------------------
A0A0B8ZYB5      ------------------------------------------------------------
A0A2A3X2J3      ------------------------------------------------------------
A0A444BN88      ------------------------------------------------------------
C5C9H1          ------------------------------------------------------------
A0A022KTD5      ------------------------------------------------------------
A0A345YSE8      ------------------------------------------------------------
A0A2N6TZM8      ------------------------------------------------------------
A0A2A3YKI1      ------------------------------------------------------------
A0A0N0RHI0      ------------------------------------------------------------
Z9JT73          ------------------------------------------------------------
A0A3E0VFB7      ------------------------------------------------------MSDYTN
A0A3L8P6G2      ------------------------------------------------------------
A0A0V8STB2      ------------------------------------------------------------
A0A221R7G9      ------------------------------------------------------------
A0A3N4YN11      ------------------------------------------------------------
A0A2J8IE59      ----------------------------------------------------------MA
A0A2V1M0F1      ------------------------------------------------------------
A0A1Q9SDR8      ------------------------------------------------------------
A0A2A2FUY1      ------------------------------------------------------------
A0A378GSQ8      ------------------------------------------------------------
A0A1F1W0J5      ------------------------------------------------------------
A0A0M8KP53      ------------------------------------------------------------
A0A3R8QM28      ------------------------------------------------------------
D1NRU2          ------------------------------------------------------------
H0E7B2          ------------------------------------------------------------
A0A2U1ZYD2      ------------------------------------------------------------
A0A371NYG9      ------------------------------------------------------------
A0A2U1EFT5      ------------------------------------------------------------
A0A2A9EIV3      ------------------------------------------------------------
A0A1G8B900      ------------------------------------------------------------
A0A2W6UWF7      ------------------------------------------------------------
A0A3N2BDL8      ------------------------------------------------------------
A0A401UV75      ------------------------------------------------------------
F4GZE0          ------------------------------------------------------------
A0A021VVD9      ------------------------------------------------------------
A0A222XDN9      ------------------------------------------------------------
A0A1X7CQL8      ------------------------------------------------------------
A0A1N6RXV3      ------------------------------------------------------------
A0A1Y0HXU8      ------------------------------------------------------------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------------------
A0A2M7T4M9      ------------------------------------------------------------
A0A0Q6VGV2      ------------------------------------------------------------
A0A0Q8W6H9      ------------------------------------------------------------
A0A0Q5E3I1      ------------------------------------------------------------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ------------------------------------------------------------
A0A0F0KEG5      ------------------------------------------------------------
A0A0U3XWM6      ------------------------------------------------------------
A0A3N2AWG3      ------------------------------------------------------------
A0A2W6UMX9      ------------------------------------------------------------
A0A1X6Y1Z1      ------------------------------------------------------------
C7MGH5          ------------------------------------------------------------
A0A1X6XXM6      ------------------------------------------------------------
A0A220UD04      ------------------------------------------------------------
A0A1S2MX30      ------------------------------------------------------------
A0A1H1UMF0      ------------------------------------------------------------
A0A1Y2KJJ2      ------------------------------------------------------------
A0A2S9BL32      ------------------------------------------------------------
A0A022L4I4      ------------------------------------------------------------
A0A0Q6PIE9      ------------------------------------------------------------
A0A0Q7RV30      ------------------------------------------------------------
A0A3S9X0U7      ------------------------------------------------------------
T5KGY5          ------------------------------------------------------------
A0A0F0KLV0      ------------------------------------------------------------
A0A366CQZ6      ------------------------------------------------------------
A0A3S9WH06      ------------------------------------------------------------
A0A2S8UC18      ------------------------------------------------------------
A0A3D1YWU2      ------------------------------------------------------------
A0A087CJ39      ------------------------------------------------------------
A0A2J9IL43      ------------------------------------------------------------
A0A1H4BJZ8      ------------------------------------------------------------
A0A1V3ZHZ8      ------------------------------------------------------------
A0A3S5K1S4      ------------------------------------------------------------
A0A031HPL6      ------------------------------------------------------------
A0A2A9K6H4      ------------------------------------------------------------
A0A031GRT8      ------------------------------------------------------------
A0A366DF83      ------------------------------------------------------------
A0A3G2SMN6      ------------------------------------------------------------
A0A031G2F4      ------------------------------------------------------------
A0A2N6RS04      ------------------------------------------------------------
A0A261G2E3      ------------------------------------------------------------
A0A151C1L8      ------------------------------------------------------------
A0A3G9J2B6      ------------------------------------------------------------
A0A1F2UPP7      ------------------------------------------------------------
A0A0Q7PFQ8      ------------------------------------------------------------
A0A0Q8A3C4      ------------------------------------------------------------
A0A0Q9RI09      ------------------------------------------------------------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      ------------------------------------------------------------
A0A0P7FX18      ------------------------------------------------------------
A0A087BSB6      ------------------------------------------------------------
A0A3T0DDC5      ------------------------------------------------------------
A0A1H9SLE3      ------------------------------------------------------------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ------------------------------------------------------------
A0A1G8AQG9      ------------------------------------------------------------
A0A011U0Z3      ------------------------------------------------------------
A0A1E4C6A4      ------------------------------------------------------------
H8E5G6          ------------------------------------------------------------
S3BBS2          ------------------------------------------------------------
A0A2M9HDE4      ------------------------------------------------------------
A0A086ZQ72      ------------------------------------------------------------
A0A087EH01      ------------------------------------------------------------
A0A2N3QN49      ------------------------------------------------------------
M4RDM8          ------------------------------------------------------------
A0A087DXR0      ------------------------------------------------------------
A0A087E3D8      ------------------------------------------------------------
A0A316TK00      ------------------------------------------------------------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      ------------------------------------------------------------
A0A2A3XQJ7      ------------------------------------------------------------
A0A3B7D7I9      ------------------------------------------------------------
A0A1I2LBW7      ------------------------------------------------------------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      ------------------------------------------------------------
A0A243RSJ6      ------------------------------------------------------------
A0A2Z3V1Q8      ------------------------------------------------------------
A0A259VFQ3      ------------------------------------------------------------
H0RH30          ------------------------------------------------------------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ------------------------------------------------------------
A0A423UFR1      ------------------------------------------------------------
A0A087BEI6      ------------------------------------------------------------
C4FH22          ------------------------------------------------------------
A0A2M9HPB2      ------------------------------------------------------------
C2GUY9          ------------------------------------------------------------
D6ZYB6          ------------------------------------------------------------
A0A366KE79      ------------------------------------------------------------
A0A2M9HJL0      ------------------------------------------------------------
A0A2K9BH83      ------------------------------------------------------------
A0A2N0TKZ2      ------------------------------------------------------------
A0A2K9BJ14      ------------------------------------------------------------
A0A0M4N206      ------------------------------------------------------------
A0A2U2RVH5      ------------------------------------------------------------
B7GUK0          ------------------------------------------------------------
A0A1S2VWI2      ------------------------------------------------------------
A0A396G475      ------------------------------------------------------------
A0A3D8UF99      ------------------------------------------------------------
A0A087BLR1      ------------------------------------------------------------
A0A083XFV9      ------------------------------------------------------------
A0A0L7D1M8      ------------------------------------------------------------
A0A3G8WK80      ------------------------------------------------------------
A0A0M3T8W0      ------------------------------------------------------------
W6F7E0          ------------------------------------------------------------
A0A2N6TV90      ------------------------------------------------------------
A0A395XYP7      ------------------------------------------------------------
A0A1S2VZH5      ------------------------------------------------------------
A0A2N0T384      ------------------------------------------------------------
E8MRZ7          ------------------------------------------------------------
A0A0M4LFJ1      ------------------------------------------------------------
A0A083XXD1      ------------------------------------------------------------
A0A133LT97      ------------------------------------------------------------
A0A2K9BTQ3      ------------------------------------------------------------
A0A0M0VLI6      ------------------------------------------------------------
A0A1V8RGW6      ------------------------------------------------------------
A0A414FCG0      ------------------------------------------------------------
F8ASQ4          ------------------------------------------------------------
A0A0L0LU29      ------------------------------------------------------------
A0A0L7AYJ9      ------------------------------------------------------------
A0A0L7BTF3      ------------------------------------------------------------
A0A133L2Q6      ------------------------------------------------------------
D4BMS0          ------------------------------------------------------------
S2ZR30          ------------------------------------------------------------
A0A2K9B393      ------------------------------------------------------------
A0A3D8UCA0      ------------------------------------------------------------
Q8G4Z0          ------------------------------------------------------------
A0A3E4S4A8      ------------------------------------------------------------
A0A0L7C1M1      ------------------------------------------------------------
A0A2K9B7Z0      ------------------------------------------------------------
A0A2X1B539      ------------------------------------------------------------
F9Y1Z6          ------------------------------------------------------------
A0A2K9B8Q4      ------------------------------------------------------------
A0A087D5G1      ------------------------------------------------------------
A0A0A7I7A4      ------------------------------------------------------------
E0Q4N5          ------------------------------------------------------------
D2Q677          ------------------------------------------------------------
W2VDM0          ------------------------------------------------------------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ------------------------------------------------------------
A0A2A3Y8D9      ------------------------------------------------------------
A0A365YAB1      ------------------------------------------------------------
A0A367FIB3      ------------------------------------------------------------
A0A2W1WC71      ------------------------------------------------------------
A0A261G0Y1      ------------------------------------------------------------
A0A3L7ALP7      ------------------------------------------------------------
A0A1G9HLU0      ------------------------------------------------------------
A0A261F1K2      ------------------------------------------------------------
A0A1R4J952      ------------------------------------------------------------
A0A2J9INQ6      ------------------------------------------------------------
A0A031GSP3      ------------------------------------------------------------
A0A1F1KDB3      ------------------------------------------------------------
A0A1F1U7J4      ------------------------------------------------------------
A0A2I1XYT0      ------------------------------------------------------------
A0A1M7BYB6      ------------------------------------------------------------
A0A2W5EY44      ------------------------------------------------------------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ------------------------------------------------------------
A0A1G9N5Q8      ------------------------------------------------------------
A0A3M0GWZ7      ------------------------------------------------------------
A0A255EG83      ------------------------------------------------------------
A0A255EM53      ------------------------------------------------------------
A0A3S8Z6W5      ------------------------------------------------------------
A0A3S9PWP4      ------------------------------------------------------------
A0A1E5MK42      ------------------------------------------------------------
A0A2W0DAU9      ------------------------------------------------------------
A0A3S0TBD3      ------------------------------------------------------------
A0A0M3DDN8      ------------------------------------------------------------
A0A147E2K4      ------------------------------------------------------------
A0A420X5L5      ------------------------------------------------------------
A0A2V1K647      ------------------------------------------------------------
A0A417XT21      ------------------------------------------------------------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ------------------------------------------------------------
A0A3D9UM43      ------------------------------------------------------------
A0A430FR71      ------------------------------------------------------------
A0A1I7MP88      ------------------------------------------------------------
A0A031FRH9      ------------------------------------------------------------
Q1AYJ4          ------------------------------------------------------------
A0A371PBX8      ------------------------------------------------------------
A0A0Q7QIS8      ------------------------------------------------------------
A0A0S9R0B0      ------------------------------------------------------------
E2SFH2          ------------------------------------------------------------
A0A2M9HB57      ------------------------------------------------------------
A0A2U2MQ51      ------------------------------------------------------------
A0A2W6VZZ9      ------------------------------------------------------------
A0A0F0LA25      ------------------------------------------------------------
A0A196LJH7      ------------------------------------------------------------
A0A0L6I3R0      ------------------------------------------------------------
A0A2A4EEF2      ------------------------------------------------------------
L7K558          ------------------------------------------------------------
A0A261D338      ------------------------------------------------------------
A0A2W6RXY2      ------------------------------------------------------------
A0A151BXD8      ------------------------------------------------------------
A0A2Y8ZUF1      ------------------------------------------------------------
A0A3N4YTR5      ------------------------------------------------------------
A0A0F0EUD4      ------------------------------------------------------------
A0A0Q9U1Y8      ------------------------------------------------------------
A0A0Q9U9A8      ------------------------------------------------------------
A0A315S789      ------------------------------------------------------------
V8CT75          ------------------------------------------------------------
A0A1X1B7C9      ------------------------------------------------------------
A0A2G3PHT3      ------------------------------------------------------------
A0A318RQJ0      ------------------------------------------------------------
U1F9K1          ------------------------------------------------------------
A0A2W5CP38      ------------------------------------------------------------
A0A239WF29      ------------------------------------------------------------
U7JI33          ------------------------------------------------------------
A0A3D4PTL2      ------------------------------------------------------------
A0A2P7ADF2      ------------------------------------------------------------
A0A2S5WZL9      ------------------------------------------------------------
A0A2S5UWU5      ------------------------------------------------------------
A0A2S5UM02      ------------------------------------------------------------
A0A2S5XAY1      ------------------------------------------------------------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------------------------------------
A0A243Q8C5      ------------------------------------------------------------
A0A1A0XID5      ------------------------------------------------------------
A0A3N1NCT6      ------------------------------------------------------------
A0A3N4VQ98      ------------------------------------------------------------
A0A2W0CXJ5      ------------------------------------------------------------
A0A1S2HW50      ------------------------------------------------------------
A0A2W1WMU4      ------------------------------------------------------------
A0A2W1V7N1      ------------------------------------------------------------
A0A1S2JHN3      ------------------------------------------------------------
A0A2W1TGI6      ------------------------------------------------------------
A0A2W1VQ01      ------------------------------------------------------------
A0A022LGD7      ------------------------------------------------------------
A0A0Q5KQN1      ------------------------------------------------------------
A0A2A9CNB3      ------------------------------------------------------------
A0A316AE69      ------------------------------------------------------------
A0A251XS70      ------------------------------------------------------------
B0RH06          ------------------------------------------------------------
A0A3D9PPQ8      ------------------------------------------------------------
A0A0D5CJH1      ------------------------------------------------------------
A0A399SS87      ------------------------------------------------------------
A0A225CHC3      ------------------------------------------------------------
A0A251YVY8      ------------------------------------------------------------
A0A0M5JNB0      ------------------------------------------------------------
A0A251Z2T9      ------------------------------------------------------------
A0A251YT31      ------------------------------------------------------------
A0A251XZK8      ------------------------------------------------------------
A5CP66          ------------------------------------------------------------
A0A067LLP2      ------------------------------------------------------------
A0A399NXI4      ------------------------------------------------------------
A0A251YE20      ------------------------------------------------------------
A0A399QFM2      ------------------------------------------------------------
M5BCW7          ------------------------------------------------------------
A0A2M9CDB4      ------------------------------------------------------------
A0A1G7N987      ------------------------------------------------------------
A0A2T5N7W6      ------------------------------------------------------------
A0A1N6VAF4      ------------------------------------------------------------
A0A1W6DP77      ------------------------------------------------------------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ------------------------------------------------------------
A0A1A3GKG5      ------------------------------------------------------------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ------------------------------------------------------------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ------------------------------------------------------------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ------------------------------------------------------------
A0A2N8LPQ5      ------------------------------------------------------------
A0A1P8XIF4      ------------------------------------------------------------
A0A1G4WVQ3      ------------------------------------------------------------
A0A255DMT6      ------------------------------------------------------------
V5X881          ------------------------------------------------------------
A0A0Q9AGY3      ------------------------------------------------------------
A0A024QWT2      ------------------------------------------------------------
I4BFP2          ------------------------------------------------------------
A0A101AMP3      ------------------------------------------------------------
A0A1W9Z322      ------------------------------------------------------------
A0A1A0TFG1      ------------------------------------------------------------
A0A2S8KZ97      ------------------------------------------------------------
A0A378SHC9      ------------------------------------------------------------
A0A0J6WEP7      ------------------------------------------------------------
A4TF38          ------------------------------------------------------------
E6TBM9          ------------------------------------------------------------
A1UBH0          ------------------------------------------------------------
K0VJQ1          ------------------------------------------------------------
A0A2S8KQU3      ------------------------------------------------------------
A0A2A7N7U2      ------------------------------------------------------------
A0A2S7NEL0      ------------------------------------------------------------
A0A1V4PWI5      ------------------------------------------------------------
A0A1X1TB04      ------------------------------------------------------------
L0IR94          ------------------------------------------------------------
A0A2T0RDM1      ------------------------------------------------------------
A0A2I1XJP9      ------------------------------------------------------------
A0A212TD96      ------------------------------------------------------------
A0A1Q9TIH3      ------------------------------------------------------------
A0A1F1JVB2      ------------------------------------------------------------
A0A2I1PC09      ------------------------------------------------------------
M0QJM7          ------------------------------------------------------------
A0A1G6VTP3      ------------------------------------------------------------
A0A2A9K6M4      ------------------------------------------------------------
A0A151D6I5      ------------------------------------------------------------
A0A031HPS9      ------------------------------------------------------------
A0A3S1BFT1      ------------------------------------------------------------
A0A454U3A0      ------------------------------------------------------------
D3LLI8          ------------------------------------------------------------
A0A031G3E4      ------------------------------------------------------------
A0A229HLR2      ------------------------------------------------------------
A0A270AW52      ------------------------------------------------------------
A0A1M7A465      ------------------------------------------------------------
A0A2I1XXG4      ------------------------------------------------------------
A0A132I1I7      ------------------------------------------------------------
A0A2I1XJV6      ------------------------------------------------------------
A0A3G2SMM6      ------------------------------------------------------------
A0A2N6RS10      ------------------------------------------------------------
A0A1V3ZKT1      ------------------------------------------------------------
A0A1F1KI99      ------------------------------------------------------------
A0A366DF60      ------------------------------------------------------------
A0A433IPI0      ------------------------------------------------------------
A0A1F1UP25      ------------------------------------------------------------
A0A3A1TUK9      ------------------------------------------------------------
A0A1S2N0P2      ------------------------------------------------------------
A0A1N5XHQ5      ------------------------------------------------------------
A0A2X3GKL3      ------------------------------------------------------------
A0A0Q3BEY5      ------------------------------------------------------------
A0A401Y7Z0      ------------------------------------------------------------
A0A0Q5I075      ------------------------------------------------------------
A0A0Q7GBJ4      ------------------------------------------------------------
A0A0Q8CQ58      ------------------------------------------------------------
A0A0Q9K1Q8      ------------------------------------------------------------
A0A1W1Y507      ------------------------------------------------------------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ------------------------------------------------------------
A0A420ZVG0      ------------------------------------------------------------
A0A1H4BPM4      ------------------------------------------------------------
A0A1I4KI63      ------------------------------------------------------------
A0A3E0VGJ6      ------------------------------------------------------------
A0A3E0WC79      ------------------------------------------------------------
A0A3E0VTS3      ------------------------------------------------------------
A0A3E0VY43      ------------------------------------------------------------
A0A317ZJF6      ------------------------------------------------------------
A0A1I3D4A2      ------------------------------------------------------------
A0A1H0IXS2      ------------------------------------------------------------
A0A1H8BMX3      ------------------------------------------------------------
C7NFS0          ------------------------------------------------------------
A0A2J8IJ34      ----------------------------------------------------MPTENLPQ
A0A2W1TJJ1      ------------------------------------------------------------
A0A1S7B6R2      ------------------------------------------------------------
A0A1T5J523      ------------------------------------------------------------
A0A3A5H3U9      ------------------------------------------------------------
A0A3N1K9V0      ------------------------------------------------------------
A0A2T0YQH3      ------------------------------------------------------------
A0A2A9GST2      ------------------------------------------------------------
A0A1Y6FE39      ------------------------------------------------------------
A0A3N2BZR7      ------------------------------------------------------------
A0A2P8GSE2      ------------------------------------------------------------
A0A3S4AKV9      ------------------------------------------------------------
A0A444Q6M2      ------------------------------------------------------------
A0A2W1W5T8      ------------------------------------------------------------
A0A1I1EJA4      ------------------------------------------------------------
A0A2S9AA20      ------------------------------------------------------------
A0A0J6DDB5      ------------------------------------------------------------
A0A0C5BB48      ------------------------------------------------------------
A0A3T0T1X6      ------------------------------------------------------------
A0A3N1HM47      ------------------------------------------------------------
A0A3N1MQN7      ------------------------------------------------------------
A0A3N2FLV7      ------------------------------------------------------------
A0A2S5XFS5      ------------------------------------------------------------
A0A2S5XT69      ------------------------------------------------------------
A0A2S5YDZ2      ------------------------------------------------------------
A0A160KVA5      ------------------------------------------------------------
A0A286H2T6      ------------------------------------------------------------
A0A2S5XYU9      ------------------------------------------------------------
A0A3T0SSY7      ------------------------------------------------------------
A0A0Q5ASZ3      ------------------------------------------------------------
A0A1X7P790      ------------------------------------------------------------
B8HEG4          ------------------------------------------------------------
A0A1H1CWF7      ------------------------------------------------------------
A0A3N0BZS5      ------------------------------------------------------------
A0A0Q5E5W5      ------------------------------------------------------------
A0A1Y6EYH1      ------------------------------------------------------------
A0A1T5JTI1      ------------------------------------------------------------
A0A1S7B8B7      ------------------------------------------------------------
A0A3G8VEK9      ------------------------------------------------------------
A0A3N2C1T7      ------------------------------------------------------------
A0A399TA45      ------------------------------------------------------------
A0A154V2D9      ------------------------------------------------------------
A0A2S5VSE7      ------------------------------------------------------------
A0A2A9CSQ3      ------------------------------------------------------------
C5C078          ------------------------------------------------------------
A0A1R1LV55      ------------------------------------------------------------
A0A1I1HU33      ------------------------------------------------------------
A0A1G9G6G1      ------------------------------------------------------------
A0A1J4MWA9      ------------------------------------------------------------
E9V2I9          ------------------------------------------------------------
A0A1G6RFZ6      ------------------------------------------------------------
A0A1C4ZLL7      ------------------------------------------------------------
A0A1C6SCX7      ------------------------------------------------------------
A0A2P8ATT4      ------------------------------------------------------------
A0A3A9XK63      ------------------------------------------------------------
A0A1C3N102      ------------------------------------------------------------
A0A318NCD5      ------------------------------------------------------------
A0A3N9XL76      ------------------------------------------------------------
A0A1C5I042      ------------------------------------------------------------
A0A2G6XLC8      ------------------------------------------------------------
A0A1C4Y4C1      ------------------------------------------------------------
A0A3N9W7A4      ------------------------------------------------------------
A0A1C4VS21      ------------------------------------------------------------
A0A3N9XFS0      ------------------------------------------------------------
A0A420F753      ------------------------------------------------------------
A0A1N7D4C7      ------------------------------------------------------------
A0A3A9ZIB5      ------------------------------------------------------------
I0L4P4          ------------------------------------------------------------
A0A0M8XEP1      ------------------------------------------------------------
A0A317CT00      ------------------------------------------------------------
A0A3L7B488      ------------------------------------------------------------
A0A3L7BEY7      ------------------------------------------------------------
A0A1C4XRD3      ------------------------------------------------------------
A0A1N5VMM0      ------------------------------------------------------------
A0A3N2P6W2      ------------------------------------------------------------
A0A2N3S3T8      ------------------------------------------------------------
A0A2R4FCN3      ------------------------------------------------------------
A0A317JTD7      ------------------------------------------------------------
A0A1C6SUF3      ------------------------------------------------------------
A0A328MVK7      ------------------------------------------------------------
A0A328NYI0      ------------------------------------------------------------
A0A109IIZ3      ------------------------------------------------------------
A0A1C5AG23      ------------------------------------------------------------
A0A246RHJ0      ------------------------------------------------------------
A0A1C4Y9N1      ------------------------------------------------------------
A0A1C5H5Y4      ------------------------------------------------------------
A0A1C5HF13      ------------------------------------------------------------
A0A2W2BV95      ------------------------------------------------------------
A0A1H6YQS5      ------------------------------------------------------------
A0A3A9YX36      ------------------------------------------------------------
A0A2W2E7U9      ------------------------------------------------------------
A0A1I1J043      ------------------------------------------------------------
A0A2G7D493      ------------------------------------------------------------
A0A372FUT0      ------------------------------------------------------------
A0A418N1I2      ------------------------------------------------------------
A0A2N7T841      ------------------------------------------------------------
A0A3S0SJN0      ------------------------------------------------------------
F4F8R2          ------------------------------------------------------------
A0A1C5HYD2      ------------------------------------------------------------
A0A317KP48      ------------------------------------------------------------
A0A1C6TUT1      ------------------------------------------------------------
A0A1C6VZN9      ------------------------------------------------------------
A0A1C5G976      ------------------------------------------------------------
A0A2N3YZF6      ------------------------------------------------------------
A0A1C5JCL2      ------------------------------------------------------------
A0A317DJW6      ------------------------------------------------------------
A0A1C4YLW4      ------------------------------------------------------------
A0A1C6UFA3      ------------------------------------------------------------
A0A2T3V950      ------------------------------------------------------------
A0A1C5GRE8      ------------------------------------------------------------
A0A1A9BBH4      ------------------------------------------------------------
A0A2D1I5I3      ------------------------------------------------------------
A0A1Q5HLU3      ------------------------------------------------------------
A0A385ARQ9      ------------------------------------------------------------
A0A366L660      ------------------------------------------------------------
A0A3E1Z1H9      ------------------------------------------------------------
W7VSI2          ------------------------------------------------------------
A0A1C4WAW4      ------------------------------------------------------------
A0A1C6S5M8      ------------------------------------------------------------
A0A1S1WCJ8      ------------------------------------------------------------
D9TEP7          ------------------------------------------------------------
A0A1C4V106      ------------------------------------------------------------
A0A386WGZ0      ------------------------------------------------------------
A0A1A8Z813      ------------------------------------------------------------
A0A0M2RDC0      ------------------------------------------------------------
A0A1A8ZEN5      ------------------------------------------------------------
A0A1Q5CDD9      ------------------------------------------------------------
A0A1C4UD01      ------------------------------------------------------------
A0A1C6TZX7      ------------------------------------------------------------
A0A1H3PEL7      ------------------------------------------------------------
A0A2W4J0R4      ------------------------------------------------------------
A0A175S221      ------------------------------------------------------------
A0A2E0MPL1      ------------------------------------------------------------
A0A0Q4M3J4      ------------------------------------------------------------
A0A1E8FPE8      ------------------------------------------------------------
A0A2V3DYM2      ------------------------------------------------------------
A0A024GZV1      ------------------------------------------------------------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ------------------------------------------------------------
A0A0L0BIN0      ------------------------------------------------------------
A0A1Y3M0W1      ------------------------------------------------------------
A0A1G6GEF2      ------------------------------------------------------------
A0A410YJ27      ------------------------------------------------------------
A0A251YRA5      ------------------------------------------------------------
A0A251XRV8      ------------------------------------------------------------
A0A0M4HAE8      ------------------------------------------------------------
A0A251Z704      ------------------------------------------------------------
A0A3D9PKF1      ------------------------------------------------------------
A0A225CJH5      ------------------------------------------------------------
A0A399TDC3      ------------------------------------------------------------
A0A251YED9      ------------------------------------------------------------
A0A0D5CGA3      ------------------------------------------------------------
A0A399N224      ------------------------------------------------------------
A0A399NK31      ------------------------------------------------------------
A0A399QBR8      ------------------------------------------------------------
A0A399TPV7      ------------------------------------------------------------
M5BCU5          ------------------------------------------------------------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ------------------------------------------------------------
A0A2S5V715      ------------------------------------------------------------
A5CNW1          ------------------------------------------------------------
A0A067LK66      ------------------------------------------------------------
A0A399NY19      ------------------------------------------------------------
A0A2M9BCA3      ------------------------------------------------------------
A0A1H3U6P2      ------------------------------------------------------------
A0A3E0VZJ6      ------------------------------------------------------------
A0A3E0VEH4      ------------------------------------------------------------
A0A3E0W244      ------------------------------------------------------------
A0A2S5W320      ------------------------------------------------------------
A0A3E0WEQ4      ------------------------------------------------------------
A0A2T0YF73      ------------------------------------------------------------
A0A010NGT7      ------------------------------------------------------------
A0A0W8IE50      ------------------------------------------------------------
A0A0S9DZU4      ------------------------------------------------------------
A0A2S5VJV3      ------------------------------------------------------------
A0A0Q4FGF8      ------------------------------------------------------------
A0A1Y6E6V4      ------------------------------------------------------------
A0A0S9PK66      ------------------------------------------------------------
A0A2S5W290      ------------------------------------------------------------
A0A3E0WAC7      ------------------------------------------------------------
A0A3G8VFV2      ------------------------------------------------------------
A0A3N2C5B5      ------------------------------------------------------------
A0A0Q5EDZ4      ------------------------------------------------------------
A0A1S7BBR9      ------------------------------------------------------------
A0A1T5L385      ------------------------------------------------------------
A0A1Y6FHM1      ------------------------------------------------------------
A0A0Q4UQV7      ------------------------------------------------------------
A0A1T5KAP0      ------------------------------------------------------------
A0A1V2NCT1      ------------------------------------------------------------
A0A0Q5CM05      ------------------------------------------------------------
A0A3N4VGE6      ------------------------------------------------------------
A0A420ZV92      ------------------------------------------------------------
A0A0Q5L7K3      ------------------------------------------------------------
A0A0N0KVZ2      ------------------------------------------------------------
A0A0Q4MAN1      ------------------------------------------------------------
A0A2W1YE21      ------------------------------------------------------------
A0A1S2H0H4      ------------------------------------------------------------
A0A2W1VLC9      ------------------------------------------------------------
A0A3N4VVK7      ------------------------------------------------------------
A0A1S2HXH4      ------------------------------------------------------------
A0A2W1WZ29      ------------------------------------------------------------
A0A3N1YB74      ------------------------------------------------------------
A0A3N1NCJ6      ------------------------------------------------------------
A0A2W4XST1      ------------------------------------------------------------
A0A3N2GI81      ------------------------------------------------------------
A0A1S2JF47      ------------------------------------------------------------
A0A3N1KAQ1      ------------------------------------------------------------
A0A0N6ZW80      ------------------------------------------------------------
A0A2A5NP89      ------------------------------------------------------------
A0A1S2HTT8      ------------------------------------------------------------
A0A1E5MI11      ------------------------------------------------------------
A0A1C7CBL2      ------------------------------------------------------------
A0A370E8G9      ------------------------------------------------------------
A0A2W1Z3Y0      ------------------------------------------------------------
A0A2W1VSB5      ------------------------------------------------------------
A0A3S0VQS9      ------------------------------------------------------------
A0A3N1JE86      ------------------------------------------------------------
A0A0Q5RU45      ------------------------------------------------------------
A0A1S2J0P7      ------------------------------------------------------------
A0A2W1QTM3      ------------------------------------------------------------
A0A2W0CPC4      ------------------------------------------------------------
A0A2W1ZIW5      ------------------------------------------------------------
A0A2W1TJR2      ------------------------------------------------------------
A0A2W1TRU9      ------------------------------------------------------------
A0A2W0D8S5      ------------------------------------------------------------
A0A2W1QW41      ------------------------------------------------------------
A0A2W1SEK0      ------------------------------------------------------------
A0A2W1U4A1      ------------------------------------------------------------
A0A2W1QMG4      ------------------------------------------------------------
A0A2W1QVP4      ------------------------------------------------------------
A0A2W1PR53      ------------------------------------------------------------
A0A2W1RMT1      ------------------------------------------------------------
A0A2W1SP47      ------------------------------------------------------------
A0A2W1TY42      ------------------------------------------------------------
A0A2W1NK02      ------------------------------------------------------------
A0A2W1TGD3      ------------------------------------------------------------
A0A2W1V3X9      ------------------------------------------------------------
A0A2W1XJM0      ------------------------------------------------------------
A0A022LH22      ------------------------------------------------------------
A0A0Q5KMI7      ------------------------------------------------------------
A0A316AFM9      ------------------------------------------------------------
A0A101Y8M3      ------------------------------------------------------------
A0A3A5M3T5      ------------------------------------------------------------
A0A3A1U0E9      ------------------------------------------------------------
A0A370E5G2      ------------------------------------------------------------
A0A316IAU2      ------------------------------------------------------------
A0A1G7JQ21      ------------------------------------------------------------
A0A0A0B6L4      ------------------------------------------------------------
A0A1I7MGN5      ------------------------------------------------------------
A0A3D9L8Q2      ------------------------------------------------------------
A0A3N4YXR7      ------------------------------------------------------------
A0A239GWK7      ------------------------------------------------------------
A0A2T0TUL3      ------------------------------------------------------------
A0A1H0BHY1      ------------------------------------------------------------
A0A1I5DH92      ------------------------------------------------------------
A0A3N2CYC6      ------------------------------------------------------------
A0A3N1K349      ------------------------------------------------------------
U1MWX0          ------------------------------------------------------------
A0A2V3DWA2      -------------------------------------------------MVSGGLGGGNI
A0A1I2T4Q4      ------------------------------------------------------------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ------------------------------------------------------------
A0A1H6IEM3      ------------------------------------------------------------
A0A1X0H5J5      ------------------------------------------------------------
A0A1X0D907      ------------------------------------------------------------
A0A1J0UA55      ------------------------------------------------------------
A0A2T5WJZ2      ------------------------------------------------------------
A0A1Q4TN14      ------------------------------------------------------------
A0A370CY70      ------------------------------------------------------------
A0A1M9PW13      ------------------------------------------------------------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      ------------------------------------------------------------
A0A1H9TXR1      ------------------------------------------------------------
A0A261G556      ------------------------------------------------------------
A0A1H9RLP3      ------------------------------------------------------------
A0A1G5PJ37      ------------------------------------------------------------
A0A221NN83      ------------------------------------------------------------
A0A2S5W4G9      ------------------------------------------------------------
A0A2T5W3Y2      ------------------------------------------------------------
A0A3A5H3V1      ------------------------------------------------------------
A0A1I6KI27      ------------------------------------------------------------
A0A316B618      ------------------------------------------------------------
A0A3Q9V497      ------------------------------------------------------------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ------------------------------------------------------------
A0A2T4UY28      ------------------------------------------------------------
A0A1H6YS68      ------------------------------------------------------------
A0A1V2NL87      ------------------------------------------------------------
A0A259SEX1      ------------------------------------------------------------
A0A0F0LD75      ------------------------------------------------------------
A0A2S9A622      ------------------------------------------------------------
A0A0P0DHN7      ------------------------------------------------------------
A0A2M9C550      ------------------------------------------------------------
A0A3B0B6M9      ------------------------------------------------------------
A0A2N3GRB2      ------------------------------------------------------------
A0A0F0L851      ------------------------------------------------------------
A0A2T7X0Z6      ------------------------------------------------------------
A0A2S9BKI0      ------------------------------------------------------------
A0A0F2C8N7      ------------------------------------------------------------
A0A2T7X614      ------------------------------------------------------------
A0A1P8UAU0      ------------------------------------------------------------
A0A0S9QI77      ------------------------------------------------------------
A0A3D9U3N3      ------------------------------------------------------------
A0A1H1F4A6      ------------------------------------------------------------
A0A246E2W5      ------------------------------------------------------------
U2XQ67          ------------------------------------------------------------
A0A171DSR6      ------------------------------------------------------------
A0A1Q3L510      ------------------------------------------------------------
A0A2T4UC78      ------------------------------------------------------------
A0A1H8W5Q2      ------------------------------------------------------------
A0A172X5A6      ------------------------------------------------------------
A0A1M3LQG0      ------------------------------------------------------------
A0A0A0CCR1      ------------------------------------------------------------
A0A1I2GS79      ------------------------------------------------------------
A0A0A0C0L9      ------------------------------------------------------------
A0A2A9E2B7      ------------------------------------------------------------
A0A2N3YKR1      ------------------------------------------------------------
A0A2N6R2X5      ------------------------------------------------------------
A0A1G6GCY6      ------------------------------------------------------------
A0A1H0IIE3      ------------------------------------------------------------
A0A1C9WMD3      ------------------------------------------------------------
A0A1H0R6Z9      ------------------------------------------------------------
A0A1H1Z766      ------------------------------------------------------------
A0A0Q9J8J7      ------------------------------------------------------------
A0A3M8AFW0      ------------------------------------------------------------
A0A1H6FXV2      ------------------------------------------------------------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ------------------------------------------------------------
A0A1H4T2N1      ------------------------------------------------------------
A0A2A9CZH9      ------------------------------------------------------------
A0A101LAM5      ------------------------------------------------------------
A1RC29          ------------------------------------------------------------
A0A0F0KYQ2      ------------------------------------------------------------
A0A1I6JEQ9      ------------------------------------------------------------
M7MWW7          ------------------------------------------------------------
A0A373DJ45      ------------------------------------------------------------
A0A077MB29      ------------------------------------------------------------
A0A0V8IVB9      ------------------------------------------------------------
L8TVZ5          ------------------------------------------------------------
A0A0Q9MJT3      ------------------------------------------------------------
A0A0B4D7W4      ------------------------------------------------------------
A0A2J8IA21      ------------------------------------------------------------
A0A371BP35      ------------------------------------------------------------
A0A0Q5HN28      ------------------------------------------------------------
B8HEH1          ------------------------------------------------------------
A0A0Q5MS06      ------------------------------------------------------------
A0A2J8GH16      ------------------------------------------------------------
H0QNF6          ------------------------------------------------------------
A0A0D1C095      ------------------------------------------------------------
A0JZX7          ------------------------------------------------------------
A0A1W1ZPI5      ------------------------------------------------------------
A0A0Q9K847      ------------------------------------------------------------
A0A1L3MI59      ------------------------------------------------------------
A0A0Q8Y2V9      ------------------------------------------------------------
E6SEU3          ------------------------------------------------------------
W9G9N4          ------------------------------------------------------------
H6N1H1          ------------------------------------------------------------
D2Q672          ------------------------------------------------------------
E0Q4N9          ------------------------------------------------------------
W2VB67          ------------------------------------------------------------
A0A1V4PL64      ------------------------------------------------------------
A0A1H1WZJ3      ------------------------------------------------------------
A0A2A9CNJ0      ------------------------------------------------------------
W2EP80          ------------------------------------------------------------
A0A1I3XXQ0      ------------------------------------------------------------
A0A1V4EHL7      ------------------------------------------------------------
D2B1Z9          ------------------------------------------------------------
A0A1H7FB36      ------------------------------------------------------------
A0A239CM55      ------------------------------------------------------------
A0A290XKY6      ------------------------------------------------------------
A0A181Z7W1      ------------------------------------------------------------
A0A161GBQ2      ------------------------------------------------------------
A0A260AZ98      ------------------------------------------------------------
A0A260IVX0      ------------------------------------------------------------
A0A260PX50      ------------------------------------------------------------
A0A260R8K0      ------------------------------------------------------------
A0A251YLS3      ------------------------------------------------------------
A0A1H1F0B0      ------------------------------------------------------------
A0A246E4S9      ------------------------------------------------------------
U2YPH0          ------------------------------------------------------------
A0A1H4ND50      ------------------------------------------------------------
E8NF39          ------------------------------------------------------------
A0A0Q6E734      ------------------------------------------------------------
A0A147F0T8      ------------------------------------------------------------
A0A0Q5PNV8      ------------------------------------------------------------
A0A147F4Z2      ------------------------------------------------------------
A0A2W1UD60      ------------------------------------------------------------
A0A0Q5CBC0      ------------------------------------------------------------
A0A3N4VMC7      ------------------------------------------------------------
A0A3B0B4T8      ------------------------------------------------------------
A0A181Z8L4      ------------------------------------------------------------
A0A3N1JFL7      ------------------------------------------------------------
A0A3N2GHT0      ------------------------------------------------------------
A0A2W0ECB7      ------------------------------------------------------------
A0A2W1Q3Z9      ------------------------------------------------------------
A0A2W1X3D9      ------------------------------------------------------------
A0A2W1U2M0      ------------------------------------------------------------
A0A2W1QM99      ------------------------------------------------------------
A0A2W1PJ22      ------------------------------------------------------------
A0A2W1RBH1      ------------------------------------------------------------
A0A2S3Z6L3      ------------------------------------------------------------
A0A3N2AT99      ------------------------------------------------------------
A0A1I6LA98      ------------------------------------------------------------
A0A3S3M2W8      ------------------------------------------------------------
A0A147DUP0      ------------------------------------------------------------
A0A1C7C3G8      ------------------------------------------------------------
A0A2T0V3B1      ------------------------------------------------------------
A0A0B2AI85      ------------------------------------------------------------
A0A3L7IX11      ------------------------------------------------------------
A0A3S4BC26      ------------------------------------------------------------
A0A444QGJ0      ------------------------------------------------------------
A0A1H0AWP0      ------------------------------------------------------------
A0A1H8A6U6      ------------------------------------------------------------
A0A1I2YEQ7      ------------------------------------------------------------
A0A3A5MNU5      ------------------------------------------------------------
A0A3A5N2D6      ------------------------------------------------------------
A0A086DVZ0      ------------------------------------------------------------
A0A086DVG5      ------------------------------------------------------------
A0A099JUC4      ------------------------------------------------------------
A0A1H0AW68      ------------------------------------------------------------
A0A1H8A5X8      ------------------------------------------------------------
A0A1I2YE61      ------------------------------------------------------------
A0A1T4WXV8      ------------------------------------------------------------
A0A1X7IN36      ------------------------------------------------------------
A0A0S9E1G2      ------------------------------------------------------------
A0A165S8K4      ------------------------------------------------------------
A0A1I6IZH2      ------------------------------------------------------------
A0A0Q4HBI5      ------------------------------------------------------------
A0A3D9PSJ4      ------------------------------------------------------------
A0A3E0VZK6      ------------------------------------------------------------
A0A3E0VEK0      ------------------------------------------------------------
A0A2S5W2I0      ------------------------------------------------------------
A0A3E0W3A0      ------------------------------------------------------------
A0A3N1QGT9      ------------------------------------------------------------
A0A0Q4UN39      ------------------------------------------------------------
A0A3N2IBU5      ------------------------------------------------------------
A0A0Q5N0H1      ------------------------------------------------------------
A0A0Q5SIU7      ------------------------------------------------------------
A0A1S2I9A7      ------------------------------------------------------------
A0A0Q4LKJ5      ------------------------------------------------------------
A0A3N2HI53      ------------------------------------------------------------
A0A0Q4TNQ0      ------------------------------------------------------------
A0A0Q6B7E9      ------------------------------------------------------------
A0A3N2HXF6      ------------------------------------------------------------
                                                                            

A0A316JEM7      ------------------------------------------------------------
A0A0B2BP84      -------------------------MVNTQAKHSYADLSAKTEEEDVVLGQL--------
A0A2W6BNW8      SPRPEHQVSPRSEHQVSPRSEHQSAPQELYLTALPSGSDSITSPPPVDLQTY--------
A0A399VFU7      ----------------------------------------------MELSEF--------
A0A0Q7MSV5      ----------------------------------------------MEPSEY--------
A0A0B2BPU3      -------------------------MNKVLMNRASCPLPETDLGDEPELVRY--------
A0A2T7V028      --------------------MLSSQPRLKAPGAASILPVAASGDRLPILRQY--------
A0A2A9EEP9      ----------------------------------------------MEIRTY--------
A0A372J6J7      GPGDATARDPHRPHSLWGTQPNPRRSMATVVAVGDRSGHRPGGDGIVGVAGY--------
A0A0B2BAQ1      APPQQAAEDGSETD----------------------------------FVAV--------
A0A1Q7LXJ6      ------------------------------------------------------------
A0A2T7VFI1      VPYDGAHFDGARHDPAYGHRRAMVAPVDRPAPQ-------------AGVVDL--------
A0A1S1CQC5      ----------------------------------------------MTILEF--------
A0A1E9T6I0      ----------------------------------------------MTILEF--------
A0A1F1GHA7      ----------------------------------------------MTILEF--------
A0A1Y1RLX5      ----------------------------------------------MTILDV--------
A0A1U4M0Y5      ----------------------------------------------MTILDF--------
A0A3D3LZQ2      ----------------------------------------------MTILDF--------
A0A176UCN8      ----------------------------------------------MGLRDY--------
A0A3D1Z248      --------------------MGINSANSLNGRRGEYGVDKLKESSDVDLAQY--------
A0A0A0UDT2      ----------------------------------------------MTVADL--------
A0A0S2MGZ8      ----------------------------------------------MTVADL--------
A0A151C7E4      ----------------------------------------------MTVADL--------
A0A1X2YST6      ----------------------------------------------MTVADL--------
A0A1X2ZYS4      ----------------------------------------------MTVADL--------
I3BG34          ----------------------------------------------MTVADL--------
A0A229W018      ----------------------------------------------MTVSDL--------
A0A430FEG8      ----------------------------------------------MTVSDL--------
A0A087CXM2      ---------------------MVSANNEQQQNQNAADTAVAQAESGITIMDL--------
A0A1Q6F212      ----------------MSRGNMAAAESNVPATNQVVVESNDTEDDGITLMDL--------
C0BRP2          ----------------MSRGNMAAAESNVPATNQVVVESNDTEDDGITLMDL--------
A0A3C0AT24      ---------------------MAAAESNAPQTSQVVVEPTDTEDNGITLMDL--------
A0A3D0PUZ0      ---------------------MAAAESNAPQTSQVVVEPTDTEDNGITLMDL--------
A0A086ZSZ1      ----------------------MVAEKSEPIQGQAPVEAVEQRDGGVTLMDM--------
A0A087BBC7      ------------------------------------MVGRDNHHNDLTFIDL--------
A0A087BEY8      ----------------------MASMSDEKGTYAATNANNKEQHDGLTLIDL--------
A0A2N3QE62      ---------------------------------MERIEEEEQKRRRIGFLDL--------
A0A2N3QZ25      ----------------------MAEYLNDQQAGGS-VSGSSPDSNRHTVAEY--------
A0A1C7FTC7      ----------------------MAENEVNRYSQSQ-SQTPVPAHEGMTIVDL--------
A0A315S2E9      ----------------------MAENEVNRYSQSQ-SQTPVPAHEGMTIVDL--------
B8DWQ4          --------------MLEWKALYMAENEVNRYSQSQ-SQTPVPAHEGMTIVDL--------
A0A087B589      ----------------------------------------------MTFSDL--------
A0A2N3R436      ----------------------MADEYSEKQST---ATASTAKQSSVTFSDL--------
A0A395XCD7      ----------------------MADEYSEKQST---ATASTAKQSGVTFSDL--------
A0A3A9A6J6      ----------------------MAENIVEQQAAGQVGAGAKQENDGMTLSAL--------
A0A0A7I958      ----------------------MAENMMEQQASGQAGVGAKPESDGMTLSGL--------
A0A248X5N3      ----------------------MAENMMEQQASGQAGGGAKIENDGLTLSGL--------
A0A2A2EI34      ----------------------MVDNTMEQQASGASAAGAQPDNDGMTLSGL--------
A0A430F4X9      ----------------------MAENIIEQQAPG--AVAAKPESDGMTLSGL--------
A0A2A2EMB5      ----------------------MAENIIEQQTAG--AVAAKQESDGMTLSGL--------
A0A2N5IVW1      ----------------------MAENIIEQQAAG--AVAAKQESDGMTLSGL--------
A0A087ADW7      ----------------------------------------------MTLSAL--------
A0A2D3D401      ----------------------MAENTTQQQAYGLANTNAKAGGDGMTLSAL--------
A0A126SX27      -------------------------------------MSDGSRPSGITFADI--------
A0A413KCG4      -----------------MRGSVTSAENTNVQQVA----VEDGSEDGITLMDL--------
A0A1V8PLX8      ---------------------MTSAENTNVQQVV----VEDDSEDGITLMDL--------
A0A2G5PT07      -----------------MRGSVTSAENTNVQQVV----VEDDSEDGITLMDL--------
A0A415BXP4      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A7A7K6          -----------------------------MQQPTAPQGVVEEADDGITLMDL--------
A0A1X2ZA33      NSSRGKILVGKDIVNVRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A0C2V870      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1X2YSY1      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A0B5BIW6      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1X2ZAM7      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1X3A4T4      ---------------MRWGSAVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A087DNN8      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1X2ZG21      ---------------MRWGSSVTSVENANVQQPTALQGVVEEADDGITLMDL--------
A0A415AYL8      ---------------------MTSVENANVQQPTALQGVVEEADDGITLMDL--------
A0A076JNF6      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
R5H175          ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A174A3G1      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A174BGC0      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1X2YTE2      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1X3A989      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A0G9MCI5      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A3D1TNE2      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1E7XZI4      ---------------------MTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A1V8Q806      ---------------MRWGSSVTSVENANVQQPTAPQGVVEEADDGITLMDL--------
A0A261GBL8      ---------------------------------MTQEEMEASEEQGVTLADL--------
A0A087CP34      ---------------------------------MDQNQME--QEEGITLGEL--------
A0A087ASS3      ---------------------------------MDQNQME--QEEGITLGEL--------
A0A087CKX0      ---------------------------------MDQNQME--QEEGITLGEL--------
A0A430FBN0      ----------------------------------------------MTILGL--------
A0A229VWJ7      ------------------------------------MEKNDAEEKDVISIDI--------
A0A261FK83      TGAKGGLSLIDLSLCQKRIAVFGETKNEVSEGRSIRVEKNDGEEKDVISIDI--------
A0A0A6VNM8      -----------------------------------------------MTIDV--------
A0A2N0STP1      -------------------------MNKEERSIAVDEAEQVQDGNGVTILDL--------
E5Y0V8          -------------------------MNKEERSIAVDEAEQVQDGNGVTILDL--------
A0A1D7UM15      -------------------------MNKEERSIAVDEAEQVQDGNGVTILDL--------
A0A2N0TGF7      -------------------------MNKEERSIAVDEAEQVQDGNGVTILDL--------
V6XUQ8          -------------------------MNKEERSIAVDEAEQVQDGNGVTILDL--------
A0A430FFY5      ----------------------------------MEETQQVRD-DGVTIIDL--------
A0A2T3GJ40      ----------------------------------MNETEQVQD---VITIDV--------
A0A261FRA0      ----------------------------------------------MTILDI--------
A0A2U2N5R0      ----------------------------------------------MTILDI--------
T2HZI3          ---------------------------MEERRRTVNEIGQVQN-DGITLLDL--------
A0A087A7B6      ----------------------------------MNEPEEGQQ-DGLTVMDL--------
A0A2T3G840      ----------------------------------MNEPEEGQQ-DGLTVMDL--------
A0A0A1GPZ1      ----------------------------------------MQDGNGVTILDL--------
A0A083X494      ----------------------------------MDEAEQVQDGNGVTILDL--------
B9TTI4          ------------------------------------------------------------
A0A2U0BRJ6      ----------------------------------MDEAEQVQDGNGVTILDL--------
A0A374SXN6      ----------------------------------MDEAEQVQDGNGVTILDL--------
A0A414V4B5      ----------------------------------MDEAEQVQDGNGVTILDL--------
C5E898          ----------------------------------MDEAEQVQDGNGVTILDL--------
A0A2I1IYZ4      ----------------------------------MDEAEQVQDGNGVTILDL--------
I3AR06          ----------------------------------MDEAEQVQDGNGVTILDL--------
A0A2N5J0F3      ------------MASETPEQDVKIVEQTPAVAVIGGRAETDNQDSGLTIVDM--------
A0A3A4WFE0      ----------------------------------------------MELRDY--------
A0A086ZYI3      ----------------------------------------------MTIADI--------
A0A087DKU0      ----------------------------------------------MTVADI--------
A0A2T3C430      PLACDTNVNLKLLSNTLDPRARMFRMPGLCTGAGTLSSPHHQGDMYMELTDY--------
A0A317DND7      ----------------------------------------------MDITQY--------
C4FFN7          ETVRQERSVAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDL--------
A0A087BKW6      --------MAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDL--------
A0A126SYB4      ETVRQERSVAEDKAQQNSILIPENRIDANPQNVVLAERSESDADEGMTLMDL--------
A0A0F0L1W1      ----------------------------------------------MDIRDY--------
A0A1I6JH27      ----------------------------------------------MDIRDY--------
A0A0D8BLB2      ----------------------------------------------MALMFY--------
A0A3Q9CQB2      ----------------MRPPCPCRLRPLVAIRCFQEAPHMTSEPSGWTLSRI--------
A0A1H1SPW6      ----------------------------------------------MTVIDF--------
A0A2R4G4T8      ------------------------------------------MRGNMTISDV--------
B6XVL3          LGLQENTRSPLPILVGGNGKIAYEMAERFLASGVERSLQCENEREHMTISDV--------
A0A430FRP4      --------------------------MEQVREILSSENLDGNQGASMSAMDI--------
A0A2U2RJU3      DERAVQTVPKGSARAPRQVVIGKRARRMTAPAQTVVPHAVRAEERTHGDHHL--------
A0A1P8U1C6      ---------------------------------------MTSEPSGWTLSRI--------
K7S215          ---------------------------------------MTSEPSGWTLSRI--------
A0A344UWM2      ---------------------------------------MTPESSGWTLSRI--------
A0A3M9MHZ0      ----------------------------------------------MTLEDL--------
A0A127A501      ----------------------------------MEQGTGLSAEQGMSLTDY--------
A0A2W6DJY1      ----------------------------------------------MDLSAY--------
A0A2N3QQ61      --MEQQASGQVGGGAKI-------------------------GNDGLTLTGL--------
A0A0L7BSV7      LKRKPRDSSDLSGASMLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDL--------
D3R6R7          LKRKPRDSSDLSGASMLEWKALYMAENEVNRYSQSQSQTPVPAHEGMTIVDL--------
E8NEF0          ----------------------------------------------MDMQRV--------
A0A2R9UAE0      ----------------------------------------------MDMQRV--------
A0A165I7L3      ----------------------------------------------MDMQRV--------
A0A443JMZ6      ----------------------------------------------MDMQRV--------
R6NVA8          ---------------------MAAAESNVPATNQVVVESNDTEDDGITLMDL--------
A0A174B9F5      ---------------------MAAAESNVPATNQVVVESNDTEDDGITLMDL--------
A0A3E5ATI8      ---------------------MAAAESNVPATNQVVVESNDTEDDGITLMDL--------
A0A267WLK2      ---------------------MAAAESNVPATNQVVVESNDTEDDGITLMDL--------
A0A2G5Q517      ---------------------MAAAESNVPATNQVVVESNDTEDDGITLMDL--------
A1A356          ---------------------MAAAESTASQNGQVVVEPTETEDNGITLMDL--------
A0A1X2ZNC3      ---------------------MAAAESTAPQNGQVVVEPTETEDNGITLMDL--------
A0A412K6M4      ---------------------MAAAESTAPQNGQVVVEPTETEDNGITLMDL--------
A0A261FZA3      ---------------------MVSTENNGLQQGQLQAESVDGRDGGVTLMDM--------
A0A087D923      ---------------------MVSAENNEQQNQSVADSAAAQAENGITIMDL--------
A0A2N5IRG9      ---------------------MVSAENNEQQNQSVADSAAAQAENGITIMDL--------
A0A448R4J3      -----------------------MTTPSFETEETMDRTEPAHKPPSFDGTDL--------
A0A3A5HBN2      RRWGRPGRSDGPEGIRTTWGPASVPCAQHRDRRLGPPAIRTAMETYVEISDY--------
A0A3E0W260      TSASTLCCRKWSSERRGRRKGDAGGSPPKGRVSSRSSQATPVQGDTMELTSY--------
A0A371NXN9      -----------------------MRVWGRCRSRKRAFAHRQPGSTAVTVLDF--------
A0A1U7MRN3      ----------------------------------------------MTVRDF--------
A0A285VW57      ----------------------------MALDYVLSVFFPLREEGPVTVRDF--------
A0A448NYH5      ----------------------------------------------MTMRDY--------
A0A1X6X4B5      ----------------------------------------------MTIEDF--------
A0A366ILB0      ------------------------------------MSAEDPAPATMDLREY--------
A0A3N4Z5J3      ----------------------------------------------MQFRDF--------
A0A1I2I8S9      ----------------------------------------------MELSDY--------
A0A1Q8LIL7      ----------------------------------------------MTVQSF--------
A0A430FVU4      ----------------------------------MGLENTGSVDNDVITIDV--------
A0A1G8DY24      ----------------------------------------------MELRNY--------
A0A2W5XV31      ----------------------------------------MPEERRMDLIEY--------
A0A417Z5F8      ----------------------------------------------MSLDDL--------
A0A2C7B062      ----------------------------------------------MTLRDF--------
A0A3Q9UNX8      ----------------------------------------------MTLRDF--------
A0A344UX64      ----------------------------------------------MTLRDF--------
A0A3S9JFD4      ----------------------------------------------MTLREF--------
A0A2S5W2F7      ----------------------------------------------MELSAY--------
A0A3E0VYJ0      ----------------------------------------------MDLSGY--------
A0A399NHL8      ---------------------------------------MRDGGGTMDPHDY--------
A0A3S8SNK3      ----------------------------------------------MSIIDF--------
A0A260DSD5      -----------------MRIAEARGRVPMLRATRRCRRRVTRKAERVDMQRV--------
A0A1B3PZG7      ----------------------------------------------MTIVDV--------
G4CXH7          ----------------------------------------------MTVVDV--------
U7IS15          ----------------------------------------------MTVVDV--------
U7J8K7          ----------------------------------------------MTVVDV--------
U7K617          ----------------------------------------------MTVVDV--------
U7MEN9          ----------------------------------------------MTVVDV--------
S3WQQ9          ----------------------------------------------MTVVDV--------
A0A2W1QU49      RRRTGLGPGPSPTSLRPRVGQRSTSRDRGFPRRSPCRSRSALQENPLTASQV--------
A0A413RMG9      -------------------------------------------MRAVELDEY--------
A0A1I4JX94      -----------------------MPAPARHIPQAPLTAEAGSSTPTAAQHQF--------
A0A1M3AX45      ---------------------------------------MTDVKPQVTPSRL--------
A0A0Q8LJ68      ---------------------------------------MADIRSQVTPGRI--------
A0A1H3U5E8      ----------------------------------------------MELRSY--------
N1V0H1          ----------------------------------MEINRTEEQPQGLELRDY--------
A0A2V5FP96      ------------------------------------------------MRDY--------
A0A0A1D2Z9      --------------------------------MVLEDEQLGNAEKSLDVRDY--------
A0A0S2M268      ----------------------------------MEDEQLVTVEKSLDVRDY--------
A0A2V5ITQ5      --------------------------------MVLEDEQQGTTDKSLDVRDY--------
A0A0B8ZYB5      ----------------------------------------------MIVQHY--------
A0A2A3X2J3      ----------------------------------------------MSVQRY--------
A0A444BN88      ----------------------------------------------MTLLDA--------
C5C9H1          -----------------------------MDQPSTKDQPSANEHSRFTPRDV--------
A0A022KTD5      ----------------------------------------------MTIEDF--------
A0A345YSE8      ----------------------------------------------MTIEDF--------
A0A2N6TZM8      ----------------------------------------------MTIEDF--------
A0A2A3YKI1      ----------------------------------------------MTIEDF--------
A0A0N0RHI0      ----------------------------------------------MTIEDF--------
Z9JT73          ----------------------------------------------MTIEDF--------
A0A3E0VFB7      RGLGGRSGPARRSIRAPRRRAAGTPARQRVCVTISRRSTIAAKGELVDLSGY--------
A0A3L8P6G2      --------------------------MSSPSPASGAGPSTPLVSRVIDIRVV--------
A0A0V8STB2      ----------------------------------------------MTLRDV--------
A0A221R7G9      ----------------------------MGRTVFVEHETDARKGGELTLGDY--------
A0A3N4YN11      ----------------------------------------------MEPSNY--------
A0A2J8IE59      EEKVFRIDPAAPGPSVAPAYPARQPAEGIGVLSNQDSGGSEVSAAGMGLRDY--------
A0A2V1M0F1      ----MPMFVSLAHGREDVASMSMYSPHVQTSRRTMHPLDSDREALALDGRDL--------
A0A1Q9SDR8      ----------------------------------MEHLDAEREAPALDARDL--------
A0A2A2FUY1      ----------------------------------MEHLDAEREAPALDAQDL--------
A0A378GSQ8      ----------------------------------MEHLDAEREAPALDARDL--------
A0A1F1W0J5      ----------------------------------MPEHIDPDEGTPVELQQY--------
A0A0M8KP53      ----------------------------------------------MELQQY--------
A0A3R8QM28      ----------------------------------------------MELQQY--------
D1NRU2          -------------------MVRSDDERREDARTTRAQGTKEGDNAALTLTEL--------
H0E7B2          -----------------MALAGPGVEQLGARRRARATAMNPEPQEQTGLDDL--------
A0A2U1ZYD2      -----------------------MTSTSTPGGPTRPLAAPHPGGAPMVLSDH--------
A0A371NYG9      ----------------------------------------------MEIRDY--------
A0A2U1EFT5      ----------------------------------------------MELAEY--------
A0A2A9EIV3      --------------------------------MGDWRRLLTKRGTSVELNEY--------
A0A1G8B900      ----------------------------------------------MELTDL--------
A0A2W6UWF7      ----------------------------------------------MELSDY--------
A0A3N2BDL8      ----------------------------------------------MELREY--------
A0A401UV75      ----------------------------------------------MELQDY--------
F4GZE0          ----------------------------------------------MELQDY--------
A0A021VVD9      ----------------------------------------------MEFQDY--------
A0A222XDN9      ----------------------------------------------MEIGDY--------
A0A1X7CQL8      ----------------------------------------------MELADY--------
A0A1N6RXV3      ----------------------------------------------MELKDY--------
A0A1Y0HXU8      ----------------------------------------------MELRDY--------
A0A2U1ES11      ------------------------------------------------------------
A0A397LPH3      ------------------------------------------------MTEY--------
A0A2M7T4M9      ------------------------------------------MEEQLDLFQL--------
A0A0Q6VGV2      ----------------------------------------------MDLRQF--------
A0A0Q8W6H9      ----------------------------------------------MDLRQF--------
A0A0Q5E3I1      ----------------------------------------------MTLHEY--------
A0A3N0CRL5      ------------------------------------------------------------
A0A3N0DPX8      ----------------------------------------------MDFKEL--------
A0A0F0KEG5      ---------------------------------------MKADATGWSLASA--------
A0A0U3XWM6      ---------------------------------------MKADATGWSLGSA--------
A0A3N2AWG3      ---------------------------------------MNPAPATWTLTHA--------
A0A2W6UMX9      ---------------------------------------MKPDSSAWTLSTV--------
A0A1X6Y1Z1      -----------------------------------------MSEQRMSVRSL--------
C7MGH5          -----------------------------------------MSEQKTSMRSL--------
A0A1X6XXM6      -----------------------------------------MYEPRVNLRFL--------
A0A220UD04      -----------------------------------------MSDSSAGLPVL--------
A0A1S2MX30      -----------------------------------------MAESRVSLRVI--------
A0A1H1UMF0      -----------------------------------------MAESRVSLRVI--------
A0A1Y2KJJ2      -----------------------------------------MAESRVSLRVI--------
A0A2S9BL32      -----------------------------------------MGESRVSLRVI--------
A0A022L4I4      -----------------------------------------MGESRVSLRVI--------
A0A0Q6PIE9      -----------------------------------------MGESRVSLRVI--------
A0A0Q7RV30      -----------------------------------------MGESRVSLRVI--------
A0A3S9X0U7      -----------------------------------------MGESRVSLRVI--------
T5KGY5          -----------------------------------------MGESRVSLRVI--------
A0A0F0KLV0      -----------------------------------------MGESRVSLRVI--------
A0A366CQZ6      -----------------------------------------MGESRVSLRVI--------
A0A3S9WH06      -----------------------------------------MGESRVSLRVI--------
A0A2S8UC18      -----------------------------------------MGESRVSLRAI--------
A0A3D1YWU2      -------------MSITASRTDRQKGPRRCVACMKHPYHGVYVEEQIEIVQF--------
A0A087CJ39      --------------------MSSLGNEADSDNKARKVDTHESPRSGFTVVEL--------
A0A2J9IL43      ----------------------------------------------MNIVDV--------
A0A1H4BJZ8      ----------------------------------------------MTVVDF--------
A0A1V3ZHZ8      ----------------------------------------------MNVIDF--------
A0A3S5K1S4      ----------------------------------------------MNIIDF--------
A0A031HPL6      ----------------------------------------------MNIIDF--------
A0A2A9K6H4      ----------------------------------------------MNIIDF--------
A0A031GRT8      ----------------------------------------------MNIIDF--------
A0A366DF83      ----------------------------------------------MNIIDF--------
A0A3G2SMN6      ----------------------------------------------MNIIDF--------
A0A031G2F4      ----------------------------------------------MNVIDF--------
A0A2N6RS04      ----------------------------------------------MNVIDF--------
A0A261G2E3      ---------------------MVSERNESESSVADGSTVESNQDSGLTIMDL--------
A0A151C1L8      ----------------------------------------------MDLSAA--------
A0A3G9J2B6      ----------------------------------------------MELDDL--------
A0A1F2UPP7      ------------------------------------------MEEQIEIVQF--------
A0A0Q7PFQ8      ----------------------------------------------MDFKDL--------
A0A0Q8A3C4      ----------------------------------------------MDFKDL--------
A0A0Q9RI09      ----------------------------------------------MDFKDL--------
A0A0Q9SBW5      ------------------------------------------------------------
A0A164BG91      -----------------------------------------MSTTQSAATRL--------
A0A0P7FX18      ----------------------------------------------MDMREQ--------
A0A087BSB6      ---------------------------------------MGRNESIVTLADM--------
A0A3T0DDC5      -------------------------MLLRGHHLASLIFSRMERTKTMGLSHQ--------
A0A1H9SLE3      ----------------------------------------------MDLHDC--------
A0A087D8L2      ------------------------------------------------------------
A0A3S9W679      ----------------------------------------------MTLHEY--------
A0A1G8AQG9      ----------------------------------------------MSLNDY--------
A0A011U0Z3      ----------------------------------------------MTLHDY--------
A0A1E4C6A4      ----------------------------------------------MTLHDY--------
H8E5G6          ----------------------------------------------MTLHDY--------
S3BBS2          ----------------------------------------------MTLHDY--------
A0A2M9HDE4      ----------------------------------------------MSISDL--------
A0A086ZQ72      ----------------------------------------------MTIADL--------
A0A087EH01      ----------------------------------------------MTIADL--------
A0A2N3QN49      ----------------------------------------------MTIADL--------
M4RDM8          ----------------------------------------------MTIADL--------
A0A087DXR0      ----------------------------------------------MTIADL--------
A0A087E3D8      ----------------------------------------------MTIADL--------
A0A316TK00      ----------------------------------------------MDFKQF--------
A0A0Q8V9V9      ------------------------------------------------------------
A0A0Q8X1G0      ------------------------------------------------------------
A0A0Q8E213      ------------------------------------------------------------
A0A0Q8HXQ0      ------------------------------------------------------------
A0A0Q8Q033      -----------------------------------MAHGTDSKGWVLDFKQF--------
A0A2A3XQJ7      -------------------------------------MTSKSITANNRPARM--------
A0A3B7D7I9      ----------------------------------------------MELRQL--------
A0A1I2LBW7      ------------------------------MDEQWTEETGDNESDSVNLRDY--------
A0A0S9D7J0      ------------------------------------------------------------
A0A433JWV9      -----------------------------MHGATGPSTGRLTRGGLMNIHDY--------
A0A243RSJ6      ---------------------------------------MKGGDSPVGLLHY--------
A0A2Z3V1Q8      ---------------------------------------MKGCVEPVDLLYF--------
A0A259VFQ3      ---------------------------------------------------M--------
H0RH30          ---------------------------------------------------M--------
A0A1P8M4B6      ------------------------------------------------------------
A0A087C7D7      ----------------------------------------------MTIADL--------
A0A423UFR1      ----------------------------------------------MTIADL--------
A0A087BEI6      -------------------------MSSEEMTEGQPSSSDNQMRKVYTFADL--------
C4FH22          ------------------------MAEENENQESGQGISDGSRPSGITFADI--------
A0A2M9HPB2      ----------------------------------------------MTIADL--------
C2GUY9          ----------------------------------------------MSIADL--------
D6ZYB6          ----------------------------------------------MTIADL--------
A0A366KE79      ----------------------------------------------MAIADL--------
A0A2M9HJL0      ----------------------------------------------MTIADL--------
A0A2K9BH83      ----------------------------------------------MTIADL--------
A0A2N0TKZ2      ----------------------------------------------MTIADL--------
A0A2K9BJ14      ----------------------------------------------MTIADL--------
A0A0M4N206      ----------------------------------------------MTIADL--------
A0A2U2RVH5      ----------------------------------------------MTIADL--------
B7GUK0          ----------------------------------------------MTIADL--------
A0A1S2VWI2      ----------------------------------------------MTIADL--------
A0A396G475      ----------------------------------------------MTIADL--------
A0A3D8UF99      ----------------------------------------------MTIADL--------
A0A087BLR1      ----------------------------------------------MTIADL--------
A0A083XFV9      ----------------------------------------------MTIADL--------
A0A0L7D1M8      ----------------------------------------------MTIADL--------
A0A3G8WK80      ----------------------------------------------MTIADL--------
A0A0M3T8W0      ----------------------------------------------MTIADL--------
W6F7E0          ----------------------------------------------MSIADL--------
A0A2N6TV90      ----------------------------------------------MSIADL--------
A0A395XYP7      ----------------------------------------------MSIADL--------
A0A1S2VZH5      ----------------------------------------------MTIADL--------
A0A2N0T384      ----------------------------------------------MSIADL--------
E8MRZ7          ----------------------------------------------MSIADL--------
A0A0M4LFJ1      ----------------------------------------------MTIADL--------
A0A083XXD1      ----------------------------------------------MTIADL--------
A0A133LT97      ----------------------------------------------MTIADL--------
A0A2K9BTQ3      ----------------------------------------------MTIADL--------
A0A0M0VLI6      ----------------------------------------------MTIADL--------
A0A1V8RGW6      ----------------------------------------------MTIADL--------
A0A414FCG0      ----------------------------------------------MTIADL--------
F8ASQ4          ----------------------------------------------MTIADL--------
A0A0L0LU29      ----------------------------------------------MTIADL--------
A0A0L7AYJ9      ----------------------------------------------MTIADL--------
A0A0L7BTF3      ----------------------------------------------MTIADL--------
A0A133L2Q6      ----------------------------------------------MTIADL--------
D4BMS0          ----------------------------------------------MTIADL--------
S2ZR30          ----------------------------------------------MTIADL--------
A0A2K9B393      ----------------------------------------------MTIADL--------
A0A3D8UCA0      ----------------------------------------------MTIADL--------
Q8G4Z0          ----------------------------------------------MTIADL--------
A0A3E4S4A8      ----------------------------------------------MTIADL--------
A0A0L7C1M1      ----------------------------------------------MTIADL--------
A0A2K9B7Z0      ----------------------------------------------MTIADL--------
A0A2X1B539      ----------------------------------------------MTIADL--------
F9Y1Z6          ----------------------------------------------MTIADL--------
A0A2K9B8Q4      ----------------------------------------------MTIADL--------
A0A087D5G1      ----------------MEKNSVASVENANAQQAVAPQGVVEETDDGITLMDL--------
A0A0A7I7A4      ----------------------------------------------MTLMDL--------
E0Q4N5          -----------------MENPVISAENTNAQQVVVPQGASEETDNGITLMGL--------
D2Q677          ---------------------MISAENTNAQQVVVPQGASEETDNGITLMGL--------
W2VDM0          ---------------------MISAENTNAQQVVVPQGASEETDNGITLMGL--------
A0A087E8V5      ------------------------------------------------------------
A0A2N5J8X7      ----------------------------------------------MSISDL--------
A0A2A3Y8D9      ----------------------------------------------MELPEY--------
A0A365YAB1      ----------------------------------------------MELPQY--------
A0A367FIB3      -------------------------------MPANPRSASLKGVNQVQGLYY--------
A0A2W1WC71      -----MLPSHTMRIRDMGCSCSVGFECNTTPCDILTAKTRQPGRQHMTLVQF--------
A0A261G0Y1      ----------------------------------------------MNISDL--------
A0A3L7ALP7      ----------------------------------------------MNFTDY--------
A0A1G9HLU0      ----------------------------------------------MDFSEY--------
A0A261F1K2      ----------------------------------------------MTIGDL--------
A0A1R4J952      ---------------------------------------------MMELKQY--------
A0A2J9INQ6      ----------------------------------------------MDLQQY--------
A0A031GSP3      ----------------------------------------------MDLQQY--------
A0A1F1KDB3      ----------------------------------------------MDLQQY--------
A0A1F1U7J4      ----------------------------------------------MDLQQY--------
A0A2I1XYT0      --------------------------------------MSIDRGNVMDLQHY--------
A0A1M7BYB6      ----------------------------------------------MDLQQY--------
A0A2W5EY44      ----------------------------------------------MDLQQY--------
A0A1C0AIE6      ------------------------------------------------------------
A0A1R1I632      ----------------------------------------------MELQQY--------
A0A1G9N5Q8      ----------------------------------------------MELQQY--------
A0A3M0GWZ7      ----------------------------------------------MELQQY--------
A0A255EG83      ----------------------------------------------MELQQY--------
A0A255EM53      ----------------------------------------------MELQQY--------
A0A3S8Z6W5      ----------------------------------------------MELQQY--------
A0A3S9PWP4      ----------------------------------------------MELQQY--------
A0A1E5MK42      ----------------------------------------------MTLVQF--------
A0A2W0DAU9      ----------------------------------------------MSLAQF--------
A0A3S0TBD3      ----------------------------------------------MSLAQF--------
A0A0M3DDN8      ----------------------------------------------MSLRVI--------
A0A147E2K4      ----------------------------------------------MSLRVI--------
A0A420X5L5      ----------------------------------------------MTLAEY--------
A0A2V1K647      ----------------------------------------------MVLRDY--------
A0A417XT21      ----------------------------------------------MDFKQF--------
A0A0A1DU08      ------------------------------------------------------------
A0A2T5ZWX4      ---------------------------------MSVAHGTDSKGWVLDFKQF--------
A0A3D9UM43      ----------------------------------------------MTLREF--------
A0A430FR71      ----------------------------------------------MTVADI--------
A0A1I7MP88      ----------------------------------------------MTVLDL--------
A0A031FRH9      ----------------------------------------MAETAPWSGHWL--------
Q1AYJ4          -------------------MRDENHLRQRRSTNGPEAGPPPDDEIVISLDEL--------
A0A371PBX8      ----------------------------------------------MDLRQF--------
A0A0Q7QIS8      ------------------------------------------MGKYVELRQF--------
A0A0S9R0B0      ----------------------------------------------MELRQF--------
E2SFH2          --------------------------------------------MSVDLQQF--------
A0A2M9HB57      ----------------------------------------------MNIFDL--------
A0A2U2MQ51      ----------------------------------------------MNIFDL--------
A0A2W6VZZ9      ---------------------------------------MTDAKTPVSPGRI--------
A0A0F0LA25      ----------------------------------------------MSLQDY--------
A0A196LJH7      ----------------------------------------------MTLQDY--------
A0A0L6I3R0      ----------------------------------------------MTLQDY--------
A0A2A4EEF2      ----------------------------------------------MTLQDY--------
L7K558          -----------------------------------MSTKNAFVRRSGSFGES--------
A0A261D338      ----------------------------------MRTVQRPQDRSADTLRSA--------
A0A2W6RXY2      ----------------------------------MTQTQHVHEAGRDALRHA--------
A0A151BXD8      ----------------------------------------------MRIDEY--------
A0A2Y8ZUF1      ----------------------------------------------MRIDEY--------
A0A3N4YTR5      ----------------------------------------------MELADY--------
A0A0F0EUD4      ----------------------------------------------MTFREF--------
A0A0Q9U1Y8      ----------------------------------------------MTFREF--------
A0A0Q9U9A8      ----------------------------------------------MTFREF--------
A0A315S789      ---------------------------------MSPTSQDVQELGKDSLRSA--------
V8CT75          ---------------------------------MTETSQDFQDAGKDSLRSA--------
A0A1X1B7C9      ---------------------------------MTHSSQQTSSEGANPLRST--------
A0A2G3PHT3      ---------------------------------MTDEAKKGTSLGADSLRAA--------
A0A318RQJ0      ---------------------------------MTQRQQKIEEVGRDSLRKV--------
U1F9K1          ----------------------------------------------MKFTNF--------
A0A2W5CP38      ----------------------------------------------MKFTNF--------
A0A239WF29      ----------------------------------------------MKFTNF--------
U7JI33          ----------------------------------------------MKFTNF--------
A0A3D4PTL2      -----MHSPFSGRARNTRRGKGLFSLRILGPADHTEDRDSRRPRMQMTMQDY--------
A0A2P7ADF2      -------------------------------------------MAELTVADF--------
A0A2S5WZL9      ----------------------------------------------MELRDY--------
A0A2S5UWU5      ----------------------------------------------MELRDY--------
A0A2S5UM02      ----------------------------------------------MELRDY--------
A0A2S5XAY1      ----------------------------------------------MELRDY--------
L7KXD3          ------------------------------------------------------------
A0A1C4FI90      ------------------------------MTSSNIAPDGAPTARSFSMDHL--------
A0A243Q8C5      ------------------------------------------------MDHL--------
A0A1A0XID5      --------------------------------------MTSRNLALRRVSNS--------
A0A3N1NCT6      ----------------------------------------------MTLAQF--------
A0A3N4VQ98      ----------------------------------------------MTLSQF--------
A0A2W0CXJ5      ----------------------------------------------MTLAQF--------
A0A1S2HW50      ----------------------------------------------MTLAQF--------
A0A2W1WMU4      ----------------------------------------------MTLAQF--------
A0A2W1V7N1      ----------------------------------------MKGRVRMTLAQF--------
A0A1S2JHN3      ----------------------------------------------MTLAQF--------
A0A2W1TGI6      ----------------------------------------------MTLAQF--------
A0A2W1VQ01      ----------------------------------------------MTLAQF--------
A0A022LGD7      ----------------------------------------------MTLAQF--------
A0A0Q5KQN1      ----------------------------------------------MTLAQF--------
A0A2A9CNB3      ----------------------------------------------MELADY--------
A0A316AE69      ----------------------------------------------MELVDY--------
A0A251XS70      ----------------------------------------------MTLHEF--------
B0RH06          ----------------------------------------------MTLHEF--------
A0A3D9PPQ8      ----------------------------------------------MTLHES--------
A0A0D5CJH1      ----------------------------------------------MTLHEF--------
A0A399SS87      ----------------------------------------------MTLHEF--------
A0A225CHC3      ----------------------------------------------MTLHEF--------
A0A251YVY8      ----------------------------------------------MTLHEF--------
A0A0M5JNB0      ----------------------------------------------MTLHES--------
A0A251Z2T9      ----------------------------------------------MTLHES--------
A0A251YT31      ----------------------------------------------MTLHEF--------
A0A251XZK8      ----------------------------------------------MTLHEF--------
A5CP66          ----------------------------------------------MTLHEF--------
A0A067LLP2      ----------------------------------------------MTLHEF--------
A0A399NXI4      ----------------------------------------------MTLHEF--------
A0A251YE20      ----------------------------------------------MTLHEF--------
A0A399QFM2      ----------------------------------------------MTLHEF--------
M5BCW7          ----------------------------------------------MTLHEF--------
A0A2M9CDB4      ----------------------------------------------MTLNEY--------
A0A1G7N987      ----------------------------------------------MTLREY--------
A0A2T5N7W6      ----------------------------------------------MTLREY--------
A0A1N6VAF4      ----------------------------------------------MTLREY--------
A0A1W6DP77      ----------------------------------------------MTLREY--------
A0A0D1J4Z4      ------------------------------------------------------------
A0A433BLH6      ----------------------------------------------MNLQNI--------
A0A1A3GKG5      ----------------------------------------------MKLQDF--------
G4HWY2          ------------------------------------------------------------
A0A1Q4HCJ3      ----------------------------------------------MNLQEY--------
A0A2C9SYC1      ------------------------------------------------------------
A0A378VDM5      ----------------------------------------------MNLQDF--------
A0A375YHM1      ------------------------------------------------------------
A0A0J6WM28      ------------------------------------------------------------
A0A1Y5PAX5      ----------------------------------------------MNLQQF--------
A0A2N8LPQ5      ----------------------------------------------MNLQQF--------
A0A1P8XIF4      ----------------------------------------------MTLQDF--------
A0A1G4WVQ3      ----------------------------------------------MNIQEY--------
A0A255DMT6      ----------------------------------------------MTLRNF--------
V5X881          ----------------------------------------------MNLQDV--------
A0A0Q9AGY3      ----------------------------------------------MTLASS--------
A0A024QWT2      ----------------------------------------------MNIQDF--------
I4BFP2          ----------------------------------------------MNLQDF--------
A0A101AMP3      ----------------------------------------------MTLQDF--------
A0A1W9Z322      ----------------------------------------------MNLQDF--------
A0A1A0TFG1      ----------------------------------------------MTLQDF--------
A0A2S8KZ97      ----------------------------------------------MKLQDF--------
A0A378SHC9      ----------------------------------------------MNLQDF--------
A0A0J6WEP7      ----------------------------------------------MSIQDF--------
A4TF38          ----------------------------------------------MNLQDF--------
E6TBM9          ----------------------------------------------MNFQDF--------
A1UBH0          ----------------------------------------------MNLREF--------
K0VJQ1          ----------------------------------------------MNLQDI--------
A0A2S8KQU3      ----------------------------------------------MQLQDF--------
A0A2A7N7U2      ----------------------------------------------MNLQDF--------
A0A2S7NEL0      ----------------------------------------------MSLLDV--------
A0A1V4PWI5      ----------------------------------------------MDIRGF--------
A0A1X1TB04      ----------------------------------------------MTIQEL--------
L0IR94          ----------------------------------------------MNIHEF--------
A0A2T0RDM1      ----------------------------------------------MDLRDY--------
A0A2I1XJP9      ---------------------------MDQHQTMDATVPVEEDPDGFSLRDV--------
A0A212TD96      -------MVRATHPRRQEQRNSGTNGLECTERLGRGADSPNPPEHVLTLDDI--------
A0A1Q9TIH3      ----------------------------------------------MTLDDI--------
A0A1F1JVB2      ----------------------------------------------MTLDDI--------
A0A2I1PC09      ----------------------------------------------MTLDDI--------
M0QJM7          ---------------------------------MAPETVRVEATPTSSVRAT--------
A0A1G6VTP3      ----------------------------------------------MTFAQF--------
A0A2A9K6M4      ----------------------------------------------MTIVDF--------
A0A151D6I5      ----------------------------------------------MTIVDF--------
A0A031HPS9      ----------------------------------------------MTIVDF--------
A0A3S1BFT1      ----------------------------------------------MTIVDF--------
A0A454U3A0      ----------------------------------------------MTIVDF--------
D3LLI8          ----------------------------------------------MTIVDF--------
A0A031G3E4      ----------------------------------------------MTIVDF--------
A0A229HLR2      ----------------------------------------------MTIVDF--------
A0A270AW52      ----------------------------------------------MTIVDF--------
A0A1M7A465      ----------------------------------------------MTIVDF--------
A0A2I1XXG4      ----------------------------------------------MTIVDF--------
A0A132I1I7      ----------------------------------------------MTIVDF--------
A0A2I1XJV6      ----------------------------------------------MTIVDF--------
A0A3G2SMM6      ----------------------------------------------MTIVDF--------
A0A2N6RS10      ----------------------------------------------MTIVDF--------
A0A1V3ZKT1      ----------------------------------------------MTIVDF--------
A0A1F1KI99      ----------------------------------------------MTIVDF--------
A0A366DF60      ----------------------------------------------MTIVDF--------
A0A433IPI0      ----------------------------------------------MTIVDF--------
A0A1F1UP25      ----------------------------------------------MTIVDF--------
A0A3A1TUK9      ----------MFHPVHLRCDTAASVVTQRRERPPTARRTRAKKGSPVNLRDH--------
A0A1S2N0P2      ----------------------------------------------MTLLDF--------
A0A1N5XHQ5      ----------------------------------------------MTLLDF--------
A0A2X3GKL3      ----------------------------------------------MTLLDF--------
A0A0Q3BEY5      ----------------------------------------------MTLLDF--------
A0A401Y7Z0      ------------------------------------------MVLLMELRDH--------
A0A0Q5I075      ----------------------------------------------MDPRMY--------
A0A0Q7GBJ4      --------------------------------------------------MY--------
A0A0Q8CQ58      --------------------------------------------------MY--------
A0A0Q9K1Q8      ----------------------------------------------MTLQDL--------
A0A1W1Y507      ----------------------------------------------MTLEDL--------
A0A3N0GXT5      ------------------------------------------------------------
A0A3G8JTQ2      ------------------------------------------------------------
A0A373DL26      ---------------------------------------MTENTSAWTLGAV--------
A0A420ZVG0      ----------------------------------------------MNSRQY--------
A0A1H4BPM4      ----------------------------------------------MSSKQY--------
A0A1I4KI63      ----------------------------------------------MSSKQY--------
A0A3E0VGJ6      ----------------------------------------------MDPHDY--------
A0A3E0WC79      ----------------------------------------------MDPHDY--------
A0A3E0VTS3      --------------------------------------------MNMDPHDY--------
A0A3E0VY43      --------------------------------------------MIMDPHDY--------
A0A317ZJF6      ----------------------------------------------MESVEY--------
A0A1I3D4A2      ----------------------------------------------MEPIDY--------
A0A1H0IXS2      ----------------------------------------------MEPIDY--------
A0A1H8BMX3      ----------------------------------------------MEPIDY--------
C7NFS0          ----------------------------------------------MTLDDI--------
A0A2J8IJ34      DVIWDGLGLTVQGRRGYPYRAACFKRSRRVASLRNVIETWQTRLETMDLRDF--------
A0A2W1TJJ1      -----------------------MSHVHLWSVMVGMLASHPTEGGSMTLAQF--------
A0A1S7B6R2      ----------------------------------------------MDLGDY--------
A0A1T5J523      ----------------------------------------------MDLGDY--------
A0A3A5H3U9      ----------------------------------------------MDLRDY--------
A0A3N1K9V0      ----------------------------------------------MTLVQF--------
A0A2T0YQH3      ----------------------------------------------MELHQY--------
A0A2A9GST2      ----------------------------------------------MELRDY--------
A0A1Y6FE39      ----------------------------------------------MTVHDY--------
A0A3N2BZR7      ----------------------------------------------MTVHDY--------
A0A2P8GSE2      ----------------------------------------------MNIHEY--------
A0A3S4AKV9      ----------------------------------------------MTIHDY--------
A0A444Q6M2      ----------------------------------------------MTIHDY--------
A0A2W1W5T8      ----------------------------------------------MTFTDT--------
A0A1I1EJA4      ----------------------------------------------MELQDY--------
A0A2S9AA20      --------------MRTRRVRSATSSHGEATLAGTGGARMKADATGWSLASA--------
A0A0J6DDB5      ----------------------------------------------MTLHDA--------
A0A0C5BB48      ----------------------------------------MKELDTVELRDV--------
A0A3T0T1X6      ----------------------------------------MKELDTVELRDV--------
A0A3N1HM47      ----------------------------------------------MELRDV--------
A0A3N1MQN7      ----------------------------------------------MELRDV--------
A0A3N2FLV7      ----------------------------------------------MELRDV--------
A0A2S5XFS5      ----------------------MSEFGRTRRRRPPRDPYQRRKSDSVELRDV--------
A0A2S5XT69      ----------------------MSEFGRTRLRRPPRDPYQRRKSDSVELRDV--------
A0A2S5YDZ2      ----------------------------------------------MELRDV--------
A0A160KVA5      ----------------------------------------------MELRDV--------
A0A286H2T6      ----------------------------------------------MELRDV--------
A0A2S5XYU9      ----------------------------------------------MELRDV--------
A0A3T0SSY7      ----------------------------------------------MELRDV--------
A0A0Q5ASZ3      ----------------------------------------------MELRDV--------
A0A1X7P790      ----------------------------------------------MELRDV--------
B8HEG4          -------------------------------------MRATRKASILELSDY--------
A0A1H1CWF7      ----------------------------------------------MELGDY--------
A0A3N0BZS5      ----------------------------------------------MDFSEY--------
A0A0Q5E5W5      ----------------------------------------------MDLKDY--------
A0A1Y6EYH1      ----------------------------------------------MDLKDY--------
A0A1T5JTI1      ----------------------------------------------MDLKDY--------
A0A1S7B8B7      ----------------------------------------------MDLKDY--------
A0A3G8VEK9      ----------------------------------------------MDLKDY--------
A0A3N2C1T7      ----------------------------------------------MDLKDY--------
A0A399TA45      ----------------------------------------------MDPHDY--------
A0A154V2D9      ----------------------------------------------MDPHDY--------
A0A2S5VSE7      ----------------------------------------------MDPHDY--------
A0A2A9CSQ3      ----------------------------------------------MELKAY--------
C5C078          ----------------------------------------------MEPVEY--------
A0A1R1LV55      ----------------------------------------------MEPSEF--------
A0A1I1HU33      ----------------------------------------------MDLREY--------
A0A1G9G6G1      ----------------------------------------------MDLRDY--------
A0A1J4MWA9      ----------------------------------------------MDLRDY--------
E9V2I9          ----------------------------------------------MDLRDY--------
A0A1G6RFZ6      ----------------------------------------------MELSDY--------
A0A1C4ZLL7      ----------------------------------------------MDLRTY--------
A0A1C6SCX7      ----------------------------------------------MDLRTY--------
A0A2P8ATT4      ----------------------------------------------MDVLGY--------
A0A3A9XK63      ----------------------------------------------MDLLRQ--------
A0A1C3N102      ----------------------------------------------MDLLRQ--------
A0A318NCD5      ----------------------------------------------MELLRH--------
A0A3N9XL76      ----------------------------------------------MDLLRH--------
A0A1C5I042      ----------------------------------------------MDLLRH--------
A0A2G6XLC8      ----------------------------------------------MDLLRH--------
A0A1C4Y4C1      ----------------------------------------------MDLLRQ--------
A0A3N9W7A4      ----------------------------------------------MDLLRQ--------
A0A1C4VS21      ----------------------------------------------MDLLRQ--------
A0A3N9XFS0      ----------------------------------------------MDLLRQ--------
A0A420F753      ----------------------------------------------MDLLRQ--------
A0A1N7D4C7      ----------------------------------------------MDLLRQ--------
A0A3A9ZIB5      ----------------------------------------------MDLLRQ--------
I0L4P4          ----------------------------------------------MDLLRQ--------
A0A0M8XEP1      ----------------------------------------------MDLLRQ--------
A0A317CT00      ----------------------------------------------MDLLRQ--------
A0A3L7B488      ----------------------------------------------MDLLRQ--------
A0A3L7BEY7      ----------------------------------------------MDLLRQ--------
A0A1C4XRD3      ----------------------------------------------MDLLRQ--------
A0A1N5VMM0      ----------------------------------------------MDLLRQ--------
A0A3N2P6W2      ----------------------------------------------MDLQNY--------
A0A2N3S3T8      ----------------------------------------------MDLHTY--------
A0A2R4FCN3      ----------------------------------------------MDLHTY--------
A0A317JTD7      ----------------------------------------------MTVRKN--------
A0A1C6SUF3      ----------------------------------------------MDVRTY--------
A0A328MVK7      -----------------------------------------MGALLMDLLRQ--------
A0A328NYI0      -----------------------------------------MGALLMDLLRQ--------
A0A109IIZ3      ----------------------------------------------MDVRTC--------
A0A1C5AG23      ----------------------------------------------MDVRTC--------
A0A246RHJ0      ----------------------------------------------MDVRTC--------
A0A1C4Y9N1      ----------------------------------------------MDVRTC--------
A0A1C5H5Y4      ----------------------------------------------MEVRTY--------
A0A1C5HF13      ----------------------------------------------MEVRTY--------
A0A2W2BV95      ----------------------------------------------MDLYRQ--------
A0A1H6YQS5      ----------------------------------------------MDLYRQ--------
A0A3A9YX36      ----------------------------------------------MDLFRQ--------
A0A2W2E7U9      ----------------------------------------------MDLYRQ--------
A0A1I1J043      ----------------------------------------------MDLYRQ--------
A0A2G7D493      ----------------------------------------------MDLYRQ--------
A0A372FUT0      ----------------------------------------------MDLYRQ--------
A0A418N1I2      ----------------------------------------------MDLLRQ--------
A0A2N7T841      ----------------------------------------------MDLLRQ--------
A0A3S0SJN0      ----------------------------------------------MDLLRQ--------
F4F8R2          ----------------------------------------------MDLLRQ--------
A0A1C5HYD2      ----------------------------------------------MDLYRQ--------
A0A317KP48      ----------------------------------------------MDLYRQ--------
A0A1C6TUT1      ----------------------------------------------MDLYRQ--------
A0A1C6VZN9      ----------------------------------------------MDLYRQ--------
A0A1C5G976      ----------------------------------------------MDVYRQ--------
A0A2N3YZF6      ----------------------------------------------MDVYRQ--------
A0A1C5JCL2      ----------------------------------------------MDVRAY--------
A0A317DJW6      ----------------------------------------------MDVRTY--------
A0A1C4YLW4      ----------------------------------------------MDVLSY--------
A0A1C6UFA3      ----------------------------------------------MDVVSY--------
A0A2T3V950      ----------------------------------------------MNVVGY--------
A0A1C5GRE8      ----------------------------------------------MDVLGY--------
A0A1A9BBH4      ----------------------------------------------MDVLGY--------
A0A2D1I5I3      ----------------------------------------------MDVLGY--------
A0A1Q5HLU3      ----------------------------------------------MDVLGY--------
A0A385ARQ9      ----------------------------------------------MDVLGY--------
A0A366L660      ----------------------------------------------MDVLGY--------
A0A3E1Z1H9      ----------------------------------------------MDVLGY--------
W7VSI2          ----------------------------------------------MDVLGY--------
A0A1C4WAW4      ----------------------------------------------MDVLGY--------
A0A1C6S5M8      ----------------------------------------------MDVLGY--------
A0A1S1WCJ8      ----------------------------------------------MDVLGY--------
D9TEP7          ----------------------------------------------MDVLGY--------
A0A1C4V106      ----------------------------------------------MDVLGY--------
A0A386WGZ0      ----------------------------------------------MDVLGY--------
A0A1A8Z813      ----------------------------------------------MDVLGY--------
A0A0M2RDC0      ----------------------------------------------MDVLGY--------
A0A1A8ZEN5      ----------------------------------------------MDVLSY--------
A0A1Q5CDD9      ----------------------------------------------MDVLSY--------
A0A1C4UD01      ----------------------------------------------MDVLGY--------
A0A1C6TZX7      ----------------------------------------------MDVLGY--------
A0A1H3PEL7      ----------------------------------------------MEFRNR--------
A0A2W4J0R4      ----------------------------------------------MNFRNW--------
A0A175S221      ----------------------------------------------MTFPDF--------
A0A2E0MPL1      ----------------------------------------------MFIRRV--------
A0A0Q4M3J4      ----------------------------------------------MDLRDY--------
A0A1E8FPE8      ----------------------------------------------MEIRDY--------
A0A2V3DYM2      ----------------------------------------------MELRDY--------
A0A024GZV1      ----------------------------------------------MELSDY--------
A0A1G8J4X1      ------------------------------------------------------------
A0A0Q9QYG9      ----------------------------------------------MELKDY--------
A0A0L0BIN0      ----------------------------------------------MELSDY--------
A0A1Y3M0W1      ----------------------------------------------MELSDY--------
A0A1G6GEF2      ----------------------------------------------MELRDY--------
A0A410YJ27      ----------------------------------------------MELRDY--------
A0A251YRA5      ----------------------------------------------MALRDF--------
A0A251XRV8      ----------------------------------------------MALRDF--------
A0A0M4HAE8      ----------------------------------------------MALRDF--------
A0A251Z704      ----------------------------------------------MALRDF--------
A0A3D9PKF1      ----------------------------------------------MALRDF--------
A0A225CJH5      ----------------------------------------------MALRDF--------
A0A399TDC3      ----------------------------------------------MALRDF--------
A0A251YED9      ----------------------------------------------MALRDF--------
A0A0D5CGA3      ----------------------------------------------MALRDF--------
A0A399N224      ----------------------------------------------MALRDF--------
A0A399NK31      ----------------------------------------------MALRDF--------
A0A399QBR8      ----------------------------------------------MALRDF--------
A0A399TPV7      ----------------------------------------------MALRDF--------
M5BCU5          ----------------------------------------------MALRDF--------
B0RG57          ------------------------------------------------------------
A0A1Y3F8X2      ----------------------------------------------MALRDF--------
A0A2S5V715      ----------------------------------------------MALRDF--------
A5CNW1          ----------------------------------------------MALRDF--------
A0A067LK66      ----------------------------------------------MALRDF--------
A0A399NY19      ----------------------------------------------MALRDF--------
A0A2M9BCA3      -------------------------------------MHLEGKAAGVELRDY--------
A0A1H3U6P2      ----------------------------------------------MEFRDY--------
A0A3E0VZJ6      ----------------------------------------------MDIHDY--------
A0A3E0VEH4      ----------------------------------------------MELRDY--------
A0A3E0W244      ----------------------------------------------MDLRDY--------
A0A2S5W320      ----------------------------------------------MELRDY--------
A0A3E0WEQ4      ----------------------------------------------MELRDY--------
A0A2T0YF73      ----------------------------------------------MELHEY--------
A0A010NGT7      ----------------------------------------------MELREY--------
A0A0W8IE50      ----------------------------------------------MELREY--------
A0A0S9DZU4      ----------------------------------------------MEFRDY--------
A0A2S5VJV3      ----------------------------------------------MELRDY--------
A0A0Q4FGF8      ----------------------------------------------MELRDY--------
A0A1Y6E6V4      ----------------------------------------------MELRDY--------
A0A0S9PK66      ----------------------------------------------MELRDY--------
A0A2S5W290      ----------------------------------------------MHIRNY--------
A0A3E0WAC7      ----------------------------------------------MHIRNY--------
A0A3G8VFV2      ----------------------------------------------MELRDY--------
A0A3N2C5B5      ----------------------------------------------MELRDY--------
A0A0Q5EDZ4      ----------------------------------------------MELSDY--------
A0A1S7BBR9      ----------------------------------------------MELTDY--------
A0A1T5L385      ----------------------------------------------MELTDY--------
A0A1Y6FHM1      ----------------------------------------------MELTDY--------
A0A0Q4UQV7      ----------------------------------------------MELRDY--------
A0A1T5KAP0      ----------------------------------------------MELRDY--------
A0A1V2NCT1      ----------------------------------------------MELRDY--------
A0A0Q5CM05      ----------------------------------------------MELREY--------
A0A3N4VGE6      ----------------------------------------------MELREY--------
A0A420ZV92      ----------------------------------------------MELRDY--------
A0A0Q5L7K3      ----------------------------------------------MELRDY--------
A0A0N0KVZ2      ----------------------------------------------MELRDY--------
A0A0Q4MAN1      ----------------------------------------------MELRDY--------
A0A2W1YE21      ----------------------------------------------MELRDY--------
A0A1S2H0H4      ----------------------------------------------MELRDY--------
A0A2W1VLC9      ----------------------------------------------MELRDY--------
A0A3N4VVK7      --------------MWQYFHADRWDNPGRPATGKLQDTATFGEGCRVELRDY--------
A0A1S2HXH4      ----------------------------------------------MELRDY--------
A0A2W1WZ29      ----------------------------------------------MELRDY--------
A0A3N1YB74      ----------------------------------------------MELRDY--------
A0A3N1NCJ6      ----------------------------------------------MELRDY--------
A0A2W4XST1      ----------------------------------------------MELRDY--------
A0A3N2GI81      ----------------------------------------------MELRDY--------
A0A1S2JF47      ----------------------------------------------MELRDY--------
A0A3N1KAQ1      ----------------------------------------------MELRDY--------
A0A0N6ZW80      ----------------------------------------------MELRDY--------
A0A2A5NP89      ----------------------------------------------MELRDY--------
A0A1S2HTT8      ----------------------------------------------MELRDY--------
A0A1E5MI11      ----------------------------------------------MELRDY--------
A0A1C7CBL2      ----------------------------------------------MELRDY--------
A0A370E8G9      ----------------------------------------------MELRDY--------
A0A2W1Z3Y0      ----------------------------------------------MELRDY--------
A0A2W1VSB5      ----------------------------------------------MELRDY--------
A0A3S0VQS9      ----------------------------------------------MELRDY--------
A0A3N1JE86      ----------------------------------------------MELRDY--------
A0A0Q5RU45      ----------------------------------------------MELRDY--------
A0A1S2J0P7      ----------------------------------------------MELRDY--------
A0A2W1QTM3      ----------------------------------------------MELRDY--------
A0A2W0CPC4      ----------------------------------------------MELRDY--------
A0A2W1ZIW5      ----------------------------------------------MELRDY--------
A0A2W1TJR2      ----------------------------------------------MELRDY--------
A0A2W1TRU9      ----------------------------------------------MELRDY--------
A0A2W0D8S5      ----------------------------------------------MELRDY--------
A0A2W1QW41      ----------------------------------------------MELRDY--------
A0A2W1SEK0      ----------------------------------------------MELRDY--------
A0A2W1U4A1      ----------------------------------------------MELRDY--------
A0A2W1QMG4      ----------------------------------------------MELRDY--------
A0A2W1QVP4      ----------------------------------------------MELRDY--------
A0A2W1PR53      ----------------------------------------------MELRDY--------
A0A2W1RMT1      ----------------------------------------------MELRDY--------
A0A2W1SP47      ----------------------------------------------MELRDY--------
A0A2W1TY42      ----------------------------------------------MELRDY--------
A0A2W1NK02      ----------------------------------------------MELRDY--------
A0A2W1TGD3      ----------------------------------------------MELRDY--------
A0A2W1V3X9      ----------------------------------------------MELRDY--------
A0A2W1XJM0      ----------------------------------------------MELRDY--------
A0A022LH22      ----------------------------------------------MELRDY--------
A0A0Q5KMI7      ----------------------------------------------MELRDY--------
A0A316AFM9      ----------------------------------------------MELTDY--------
A0A101Y8M3      ----------------------------------------------MTVIDF--------
A0A3A5M3T5      ----------------------------------------------MELNDY--------
A0A3A1U0E9      ----------------------MPSAALRTRAGARRPNARRARRNPLDLHQF--------
A0A370E5G2      ----------------------------------------------MQFPEL--------
A0A316IAU2      ----------------------------------------------MDLSEY--------
A0A1G7JQ21      ----------------------------------------------MGARGP--------
A0A0A0B6L4      ----------------------------------------------MEPSEY--------
A0A1I7MGN5      ----------------------------------------------MDLKDY--------
A0A3D9L8Q2      ----------------------------------------------MDLRDY--------
A0A3N4YXR7      ----------------------------------------------MDLTDY--------
A0A239GWK7      ----------------------------------------------MSLNQF--------
A0A2T0TUL3      ----------------------------------------------MGSAVV--------
A0A1H0BHY1      ----------------------------------------------MNTRGP--------
A0A1I5DH92      ----------------------------------------------MSTRGP--------
A0A3N2CYC6      ----------------------------------------------MELRDY--------
A0A3N1K349      ----------------------------------------------MELKDF--------
U1MWX0          ----------------------------------------------MGFLEY--------
A0A2V3DWA2      SPCSYNSGRRSPRTDHAHPPKHRHHHRPPEGFWRGSTMASIMTAGTARSARI--------
A0A1I2T4Q4      ---------------------------------------------MNEIATL--------
A0A3S4VIP4      ------------------------------------------------------------
A0A1A1YNQ5      ----------------------------------------------MTIQEL--------
A0A1H6IEM3      ---------------------------------MGPRKVAGSEGQALNIQDL--------
A0A1X0H5J5      ---------------------------------------------MLNFQDF--------
A0A1X0D907      ----------------------------------------------MTVQEF--------
A0A1J0UA55      ----------------------------------------------MNIRDF--------
A0A2T5WJZ2      ----------------------------------------------MNLQEF--------
A0A1Q4TN14      ----------------------------------------------MNLQDF--------
A0A370CY70      ----------------------------------------------MTLKDL--------
A0A1M9PW13      ----------------------------------------------MNLRDF--------
W9B9R2          ------------------------------------------------------------
A0A2N6TZR1      -------------------------------------MPSSNEWKTVELQNY--------
A0A1H9TXR1      ----------------------------------------------MTLDTF--------
A0A261G556      --MAAWHVSQTNTEGGGSPSMTIAQQMMTGNVMNQPLKMDDQTEEGLTLLDL--------
A0A1H9RLP3      -------------MPQTNPKGVERPLASILLHFALLGGALRGEFIRVELTDY--------
A0A1G5PJ37      ----------------------------------------------MELTDY--------
A0A221NN83      ----------------------------------------------MELTDY--------
A0A2S5W4G9      -------------------------------------------MTIMDPHDY--------
A0A2T5W3Y2      ----------------------------------------------MDFKEL--------
A0A3A5H3V1      --------------------------------------------MNVDFKEL--------
A0A1I6KI27      ----------------------------------------------MELRDY--------
A0A316B618      ----------------------------------------------MELRDV--------
A0A3Q9V497      ----------------------------------------------MELRDV--------
A0A0Q5BQW6      ------------------------------------------------------------
A0A1V2ZB83      ----------------------------------MRRSESVKEPATLELRDV--------
A0A2T4UY28      ----------------------MQQSQGSPSPTVVRRSESVKEPATLELRDV--------
A0A1H6YS68      ----------------------------------------------MELNDY--------
A0A1V2NL87      ----------------------------------------------MELRTY--------
A0A259SEX1      ----------------------------------------------MDLREY--------
A0A0F0LD75      ----------------------------------------------MDLREY--------
A0A2S9A622      ----------------------------------------------MDLREY--------
A0A0P0DHN7      ----------------------------------------------MDVNQY--------
A0A2M9C550      ----------------------------------------------MDLQGY--------
A0A3B0B6M9      ----------------------------------------------MELRDY--------
A0A2N3GRB2      ----------------------------------------------MELSDY--------
A0A0F0L851      ----------------------------------------------MELSDY--------
A0A2T7X0Z6      ----------------------------------------------MSIGDY--------
A0A2S9BKI0      ----------------------------------------MRGDEELELRDY--------
A0A0F2C8N7      ----------------------------------------------MELRDY--------
A0A2T7X614      ----------------------------------------------MELRDY--------
A0A1P8UAU0      ----------------------------------------------MELRDY--------
A0A0S9QI77      ----------------------------------------------MELRDY--------
A0A3D9U3N3      ----------------------------------------------MELRDY--------
A0A1H1F4A6      ----------------------------------------------MELRDY--------
A0A246E2W5      ----------------------------------------------MELRDY--------
U2XQ67          ----------------------------------------------MELRDY--------
A0A171DSR6      ----------------------------------------------MDLRHY--------
A0A1Q3L510      ----------------------------------------------MELKDY--------
A0A2T4UC78      ---------------------------------------MNDASTSITLPAL--------
A0A1H8W5Q2      ----------------------------------------------MELREL--------
A0A172X5A6      ----------------------------------------------MTRNPY--------
A0A1M3LQG0      ----------------------------------------------MNRNPY--------
A0A0A0CCR1      ----------------------------------------------MELRDY--------
A0A1I2GS79      ----------------------------------------------MELQDY--------
A0A0A0C0L9      ----------------------------------------------MELRDY--------
A0A2A9E2B7      ----------------------------------------------MELQDY--------
A0A2N3YKR1      ----------------------------------------------MTLLEA--------
A0A2N6R2X5      ---------------------------------MAETSAPQDERSNFSPRDL--------
A0A1G6GCY6      ----------------------------------------------MQLRDF--------
A0A1H0IIE3      ----------------------------------------------MELRTY--------
A0A1C9WMD3      ------------------------------MTGFETADNSGQTSAGLALEDY--------
A0A1H0R6Z9      ------------------------------MTGFDTAENNGQTTAGLALEDY--------
A0A1H1Z766      ----------------------------------------------MELRDY--------
A0A0Q9J8J7      ----------------------------------------------MELRDY--------
A0A3M8AFW0      ----------------------------------------------MELRDY--------
A0A1H6FXV2      ---------------------------------MPSEQQPHAPHDARTLGVL--------
A0A1Q9VQM7      ------------------------------------------------------------
A0A101LA70      ----------------------------------------------MELTDY--------
A0A1H4T2N1      ----------------------------------------------MELTDY--------
A0A2A9CZH9      ----------------------------------------------MEFLDY--------
A0A101LAM5      ----------------------------------------------MSGNDL--------
A1RC29          ----------------------------------------------MSGNDL--------
A0A0F0KYQ2      ----------------------------------------------MNLEDY--------
A0A1I6JEQ9      ----------------------------------------------MNLEDY--------
M7MWW7          -----------------------------------MEQLEENVADGPDLRQY--------
A0A373DJ45      --------------------------------MVLLFRPMIEEISSVELTDY--------
A0A077MB29      ----------------------------------------------MELRDY--------
A0A0V8IVB9      --------------------------------MSTAAAP-EQAPTGLDLADY--------
L8TVZ5          --------------------------------MTTPAAA-AEAPPGLDLTDY--------
A0A0Q9MJT3      --------------------------------MSTTAVP-AETSPGLDLADY--------
A0A0B4D7W4      --------------------------------MSTTTTP-TEASPGLDLADY--------
A0A2J8IA21      --------------------------------MSTTATP-AESPAGLDLTDY--------
A0A371BP35      --------------------------------MSATVVP-TEAPTGMELLDY--------
A0A0Q5HN28      --------------------------------MSSTAAP-AEAPAGLDLRDY--------
B8HEH1          --------------------------------MSTPAAP-AEASDGLDLRDN--------
A0A0Q5MS06      --------------------------------MSVNTVPAGETPAGLDLADY--------
A0A2J8GH16      --------------------------------MSVTSTPGEQAPAGLDLSDY--------
H0QNF6          --------------------------MDWGTIMSVNSTPAEQAPAGLDLADY--------
A0A0D1C095      --------------------------------MSVNIAPGAEAPAGLDLADY--------
A0JZX7          --------------------------------MSVNIAAGAEAPAGLDLADY--------
A0A1W1ZPI5      ----------------------------------------------MRFTEF--------
A0A0Q9K847      ----------------------------------------------MQFSEF--------
A0A1L3MI59      ----------------------------------------------MQLSEL--------
A0A0Q8Y2V9      ----------------------------------------------MTFREF--------
E6SEU3          ----------------------------------------------MTIRDL--------
W9G9N4          ----------------------------------------------MTFREF--------
H6N1H1          -----------------------------------------MSAGRLSIRGI--------
D2Q672          ----------------------------------------------MTISDV--------
E0Q4N9          ------------------------------------------MRGNMTISDV--------
W2VB67          ----------------------------------------------MTISDV--------
A0A1V4PL64      ----------------------------------------------MLVRASSPRFDGVV
A0A1H1WZJ3      ----------------------------------------------MELRDY--------
A0A2A9CNJ0      --------------------------------MTYTHCGWTMKGVVLEIQEF--------
W2EP80          ----------------------------------------------MDLLYC--------
A0A1I3XXQ0      ----------------------------------------------MDLLYY--------
A0A1V4EHL7      ----------------------------------------------MDLLYY--------
D2B1Z9          ----------------------------------------------MELLHY--------
A0A1H7FB36      ----------------------------------------------MDLLYY--------
A0A239CM55      ----------------------------------------------MDLLYF--------
A0A290XKY6      -------------------------------------MKPSEVRSGVGESEW--------
A0A181Z7W1      ---------------MWQYFPADCWENPGSLARGTARPASHGEGRRVELRDY--------
A0A161GBQ2      --------------------------------------------MRMTVRRY--------
A0A260AZ98      --------------------------------------------MRMTVRRY--------
A0A260IVX0      --------------------------------------------MRMTVRRY--------
A0A260PX50      ----------------------------------------------MMIREY--------
A0A260R8K0      ----------------------------------------------MLIREY--------
A0A251YLS3      -------------------MIDSRGCGYPTYADTPRLSVFGEGFYIMALRDF--------
A0A1H1F0B0      ----------------------------------------------MELHDY--------
A0A246E4S9      ----------------------------------------------MELHDY--------
U2YPH0          ----------------------------------------------MELHDY--------
A0A1H4ND50      ----------------------------------------------MELRDY--------
E8NF39          ----------------------------------------------MELRDY--------
A0A0Q6E734      ----------------------------------------------MELRDY--------
A0A147F0T8      ----------------------------------------------MELRDY--------
A0A0Q5PNV8      ----------------------------------------------MELRDY--------
A0A147F4Z2      ----------------------------------------------MELRDY--------
A0A2W1UD60      ----------------------------------------------MEAQEY--------
A0A0Q5CBC0      ----------------------------------------------MQLNDY--------
A0A3N4VMC7      ----------------------------------------------MQLNDY--------
A0A3B0B4T8      ----------------------------------------------MELRDY--------
A0A181Z8L4      ----------------------------------------------MNHFVV--------
A0A3N1JFL7      ----------------------------------------------MFVVTV--------
A0A3N2GHT0      ----------------------------------------------MNYLAV--------
A0A2W0ECB7      ----------------------------------------------MNYLVV--------
A0A2W1Q3Z9      ----------------------------------------------MNYLAV--------
A0A2W1X3D9      --------------------------------------MQPDRRLHLNYLAV--------
A0A2W1U2M0      ----------------------------------------------MNYLAV--------
A0A2W1QM99      ----------------------------------------------MNYLAV--------
A0A2W1PJ22      ----------------------------------------------MNYLAV--------
A0A2W1RBH1      ----------------------------------------------MNYLAV--------
A0A2S3Z6L3      ----------------------------------------------MELKDY--------
A0A3N2AT99      ----------------------------------------------MELSDY--------
A0A1I6LA98      ----------------------------------------------MELSDY--------
A0A3S3M2W8      ----------------------------------------------MELSDY--------
A0A147DUP0      ------------------------------------------------MTPL--------
A0A1C7C3G8      ------------------------------------------------MTPL--------
A0A2T0V3B1      ----------------------------------------------MELRDY--------
A0A0B2AI85      ----------------------------------------------MELRDY--------
A0A3L7IX11      ----------------------------------------------MELRDY--------
A0A3S4BC26      ----------------------------------------------MELRDY--------
A0A444QGJ0      ----------------------------------------------MELRDY--------
A0A1H0AWP0      ----------------------------------------------MELRDY--------
A0A1H8A6U6      ----------------------------------------------MELRDY--------
A0A1I2YEQ7      ----------------------------------------------MELRDY--------
A0A3A5MNU5      ----------------------------------------------MELRDY--------
A0A3A5N2D6      ----------------------------------------------MELRDY--------
A0A086DVZ0      ----------------------------------------------MELRDY--------
A0A086DVG5      ----------------------------------------------MELRDY--------
A0A099JUC4      ----------------------------------------------MELRDY--------
A0A1H0AW68      ----------------------------------------------MELRDY--------
A0A1H8A5X8      ----------------------------------------------MELRDY--------
A0A1I2YE61      ----------------------------------------------MELRDY--------
A0A1T4WXV8      -----------------------------------MLDDLEGKAAEVELRDY--------
A0A1X7IN36      -----------------------------------MLYDLEGKADSVELRDY--------
A0A0S9E1G2      ----------------------------------------------MELRDY--------
A0A165S8K4      ----------------------------------------------MELRDY--------
A0A1I6IZH2      ----------------------------------------------MELRDY--------
A0A0Q4HBI5      ----------------------------------------------MELRDY--------
A0A3D9PSJ4      ----------------------------------------------MELRDY--------
A0A3E0VZK6      ----------------------------------------------MTLEAY--------
A0A3E0VEK0      ----------------------------------------------MSLDGY--------
A0A2S5W2I0      ----------------------------------------------MTLEGY--------
A0A3E0W3A0      ----------------------------------------------MTLEGY--------
A0A3N1QGT9      ----------------------------------------------MELTEF--------
A0A0Q4UN39      ----------------------------------------------MDLIDY--------
A0A3N2IBU5      ------------------------------------------------MTSY--------
A0A0Q5N0H1      ----------------------------------------------MTPLDL--------
A0A0Q5SIU7      ------------------------------------------------MTDI--------
A0A1S2I9A7      ----------------------------------------------MRVTDI--------
A0A0Q4LKJ5      ----------------------------------------------MELRAF--------
A0A3N2HI53      ----------------------------------------------MELKTF--------
A0A0Q4TNQ0      ----------------------------------------------MELKTF--------
A0A0Q6B7E9      ----------------------------------------------MELKTF--------
A0A3N2HXF6      ----------------------------------------------MELKTF--------
                                                                            

A0A316JEM7      -----------------------------------------------D---------I--
A0A0B2BP84      ----LQVIMDDIWLLLGIAVTVVALAGLYCYI-AKPVYQA-DVHVRVE---------G--
A0A2W6BNW8      ----LRVLWRRKWLFLAVVILVPVAAYLYSAR-GAKVYQA-SVLMEIQ---------P--
A0A399VFU7      ----LLILRVRWKALLLSILLCAMAAAGWTLS-QTPVYSA--------------------
A0A0Q7MSV5      ----LALLRKHWLMIAALGVLGFVGGYGYSQT-IAPSYRA-TASLFVS------------
A0A0B2BPU3      ----ADLVLTNRWLVAGVAAAVFAVGAAYALL-AKPVYES-NLLIQVE------------
A0A2T7V028      ----LRIALRWRYVIIGAVVSCILLGTVVTLL-MTPKYTA-TATIEIS------------
A0A2A9EEP9      ----LRIVRKSWIAISAITAFVLAAAVAVTLL-MAPTYKA-TTQVFVS------------
A0A372J6J7      ----LQVLRRRMWGVVVCVALAGGAALSASLL-ATPTYTS-TAGLFFS------------
A0A0B2BAQ1      ----LDILMESRWLIAIITCIVLAAGLAYAIL-GKPVFEA-NIMVQVE------------
A0A1Q7LXJ6      -----MLLRRRIGLVAGIAALIVFVVALFVVL-ERPVYRS-TATVRLA------------
A0A2T7VFI1      ----IQAYRRHLTLFLLVAGGIMALVAAYTWL-QTPRYTA-TATLVIA------------
A0A1S1CQC5      ----FRTTRANLWLLIIGIIIGAAVGFGYASL-QPKVYAA-SSSGYVT---------V--
A0A1E9T6I0      ----FRTTRANLWLLIIGIIIGAAVGFGYASL-QPKVYAA-SSSGYVT---------V--
A0A1F1GHA7      ----FRTTRANLWLLIIGIIVGAAAGFGYASL-QPKVYAA-SSSGYVT---------V--
A0A1Y1RLX5      ----VRMLRVNFKFLLAGLIIGALLGYGYSLT-QPKIYAS-SATGYVT---------V--
A0A1U4M0Y5      ----LRMVRANLKLLLIGLLVGALLGFGYSLL-QPRVYAS-SSTGFVT---------V--
A0A3D3LZQ2      ----LRMVRANLKLLLIGLLVGALLGFGYSLL-QPRVYAS-SSTGFVT---------V--
A0A176UCN8      ----ARVARTYWKHIAVVTLIVTLLATAWSTF-RPRIYAAEASAVVLA---------V--
A0A3D1Z248      ----ARTIAKRKKLIFVITLICLAIARIVTFQ-MTPVYEA-TAELLVY---------Q--
A0A0A0UDT2      ----FRAIKRHWILEIILFVVTVGAVAGFTFT-ATPMYSA-QIQLMPK---------A--
A0A0S2MGZ8      ----FRAIKRHWILEIILFVVTVGAVAGFTFT-ATPMYSA-QIQLMPK---------A--
A0A151C7E4      ----FRAIKRHWILEIILFVVTVGAVAGFTFT-ATPMYSA-QIQLMPK---------A--
A0A1X2YST6      ----FRAIKRHWILEIILFVVTVGAVAGFTFT-ATPMYSA-QIQLMPK---------A--
A0A1X2ZYS4      ----FRAIKRHWILEIILFVVTVGAVAGFTFT-ATPMYSA-QIQLMPK---------A--
I3BG34          ----FRAIKRHWILEIILFVVTVGAVAGFTFT-ATPMYSA-QIQLMPK---------A--
A0A229W018      ----LRALKRHWLLEIILFVVVVGGMAGYTFT-VTPMYTT-QAQLMAK---------N--
A0A430FEG8      ----LRALKRHWLLEIILFVVVVGGMAGYTFT-VTPMYTT-QAQLMAK---------N--
A0A087CXM2      ----MRIIRKHVISVIVTFVVVFAAVCAYTLL-TPPKYTS-TAQMFAT---------F--
A0A1Q6F212      ----FRIVHKHLLVGIITFVVVFAAVCAYTFL-APPKYSA-TAQVFAT---------Y--
C0BRP2          ----FRIVHKHLLVGIITFVVVFAAVCAYTFL-APPKYSA-TAQVFAT---------Y--
A0A3C0AT24      ----FRIIRKHLLIGIITFVVVFIATCAYTFL-TPPKYSA-TSQVFAT---------Y--
A0A3D0PUZ0      ----FRIIRKHLLIGIITFVVVFIATCAYTFL-TPPKYSA-TSQVFAT---------Y--
A0A086ZSZ1      ----LRIIRKHLISAIITFVVVFAAVCAYTLL-VPPKYSA-TAQAFAT---------Y--
A0A087BBC7      ----FHIVLKHLITVVIGFIVVFGLSCVYLLV-KTPEYTA-TAQAFTT---------Y--
A0A087BEY8      ----FHVLFKHAITAIIGFVVVFGCACVYLLM-ATPQYSA-TTQTFTT---------Y--
A0A2N3QE62      ----LHILRKNIFLILISFIVVVAASIAHTAL-TTPQYTA-TVKLFAT---------Y--
A0A2N3QZ25      ----LGTIRKHIVTLIVTFVLVVVAACVFTAM-SPVKYST-TTKLFAT---------Y--
A0A1C7FTC7      ----LSILRKHIITIAVTFVVILGVDILYTAM-SPVAYTT-TTQLFAT---------Y--
A0A315S2E9      ----LSILRKHIITIAVTFVVILGVDILYTAM-SPVAYTT-TTQLFAT---------Y--
B8DWQ4          ----LSILRKHIITIAVTFVVILGVDILYTAM-SPVAYTT-TTQLFAT---------Y--
A0A087B589      ----LAIIRKHVITIAITFVVTVTAVCAFTAV-SPVKYTT-TTQLFAT---------Y--
A0A2N3R436      ----FGILRKHWITIVVTFVAVVGGVTLWTAM-SPVTYSS-TAQLFAT---------Y--
A0A395XCD7      ----FGILRKHWITIVVTFVAVVGGVTLWTAM-SPVTYSS-TAQLFAT---------Y--
A0A3A9A6J6      ----FGIMRKHIITIIITFLVVLGAVITLTAM-SPVEYTT-TSQLFAT---------Y--
A0A0A7I958      ----FGILRKHVITIIITFFVVLGAVIALTAI-SPVQYST-TTQLFAT---------Y--
A0A248X5N3      ----LGILRKHIITIIVTFFVVLGAVIALTAV-SPVQYST-TTQLFAT---------Y--
A0A2A2EI34      ----FGIMRKHVITIIITFAVVLGAAIGLTMM-SPVKYST-TAQLFAT---------Y--
A0A430F4X9      ----FGIIRKHVITIIVTFAVVLGAAIGMTMM-SPVKYST-TSQLFAT---------Y--
A0A2A2EMB5      ----FGIMRKHIITIIVTFAVVLGAAIGLTMM-SPVKYST-TSQLFAT---------Y--
A0A2N5IVW1      ----FGIMRKHIITIIVTFAVVLGAAIGLTMM-SPVKYST-TSQLFAT---------Y--
A0A087ADW7      ----FGILRKHIITIIVTFAVVLGAAIGLTAM-SPVKYST-TSQLFAT---------Y--
A0A2D3D401      ----FGILRKHIITIIVTFAVVLGAAIGLTAM-SPVKYST-TSQLFAT---------Y--
A0A126SX27      ----VVIIRKHIATAAICFAVIVGVAGAYAFL-AAPQYSA-TAQVIAT---------Y--
A0A413KCG4      ----MRIIRKHLVTAAIVFVMVFAGVTAYTFL-VPPKYTA-TAQAMAT---------Y--
A0A1V8PLX8      ----MRIIRKHLVTAAIVFVMVFAGVTAYTFL-VPPKYTA-TAQAMAT---------Y--
A0A2G5PT07      ----MRIIRKHLVTAAIVFVMVFAGVTAYTFL-VPPKYTA-TAQAMAT---------Y--
A0A415BXP4      ----LKIIRKHLVTAIIAFVVVVAGVSAYTFL-APPKYTA-TAQAMAT---------Y--
A7A7K6          ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X2ZA33      ----LKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A0C2V870      ----LKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X2YSY1      ----LKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A0B5BIW6      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X2ZAM7      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X3A4T4      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APTKYTA-TAQTMAT---------Y--
A0A087DNN8      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X2ZG21      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A415AYL8      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A076JNF6      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
R5H175          ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTV-TAQTMAT---------Y--
A0A174A3G1      ----FKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A174BGC0      ----LKIIRKHLATAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X2YTE2      ----LKIIRKHLATAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1X3A989      ----LKIIRKHLATAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A0G9MCI5      ----LKIIRKHLATAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A3D1TNE2      ----LKIIRKHLATAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1E7XZI4      ----LKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A1V8Q806      ----LKIIRKHLVTAIIAFVVVVAGVSAYTFL-APAKYTA-TAQTMAT---------Y--
A0A261GBL8      ----LMMIRKHVIMVVVVFVVVLAAVAAYTFT-TPKKYSA-TAELLAM---------S--
A0A087CP34      ----LQMIRKHIVSAIVVCVVVFAAVAAYTFL-APKKYEA-TAELLAM---------S--
A0A087ASS3      ----LQIIQKHIVSAIVVCVVVFAAVAAYTFL-APKKYEA-TAELLAM---------S--
A0A087CKX0      ----LQMIRKHIVSAIVVCVVVFAAVAAYTFL-APKKYEA-TAELLAM---------S--
A0A430FBN0      ----FKAIKRHIIPAVIVFAVVAAGMGVYAFT-RVPMYSA-TATVFAS---------Y--
A0A229VWJ7      ----IGAVRKHLAALIVTFVVVTAAVCGYTFM-QTPQYSA-TAEVFAS---------Y--
A0A261FK83      ----IGAVRKHLAALIATFVVVVVAVCGYTFM-QTPQYSA-TAEVFAS---------Y--
A0A0A6VNM8      ----LGAIKKHVITAIITLVVVAAAVAVYTFT-RTPQYTA-TSELLAT---------Y--
A0A2N0STP1      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
E5Y0V8          ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A1D7UM15      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A2N0TGF7      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
V6XUQ8          ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A430FFY5      ----LNAVRKHVITAVVTLVIVLAAALAYTFL-QTPQYTA-TSELVAT---------Y--
A0A2T3GJ40      ----LGALRKHWITAVVTLVVVFAAAAAYTFT-RTPMYTA-TSELLAT---------Y--
A0A261FRA0      ----VHVLKKHLITAVITLVVVTVAMACYTFT-RTTQYMA-TAELLAT---------Y--
A0A2U2N5R0      ----FNVLKKHLITAVITLVVVVAAMAGYTFT-RTTQYTA-TAELLAT---------Y--
T2HZI3          ----LKAVKKHTITAVITLVAILVAVAAFTFL-STPKYTA-TSELLAT---------Y--
A0A087A7B6      ----LMAVRKHLITAIVTLVIVVAAVAGYTFT-RTPQYTA-TSELLAT---------Y--
A0A2T3G840      ----LMAVRKHLITAIVTLVIVVAAVAGYTFT-RTPQYTA-TSELLAT---------Y--
A0A0A1GPZ1      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A083X494      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
B9TTI4          ----------------------MVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A2U0BRJ6      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A374SXN6      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSEFLAT---------Y--
A0A414V4B5      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSEFLAT---------Y--
C5E898          ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-ISELLAT---------Y--
A0A2I1IYZ4      ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-ISELLAT---------Y--
I3AR06          ----FNAVRKHVITAVVTLVIVMVAICAYTFT-RTPQYTA-TSELLAT---------Y--
A0A2N5J0F3      ----LRMVGKHWLTAVIVFIIVVGAAAGFTFT-RTKQYTA-TAQMFAS---------Y--
A0A3A4WFE0      ----LKVFLARKWLVLAATLVTTTAALVASLL-QPRVYEA-RSSLLVK---------E--
A0A086ZYI3      ----LQTLKKHLAAELVVLLVVLAGGFVYVSR-QTPQYTA-TAQMFAS---------F--
A0A087DKU0      ----LEALKKHLIVELAVLLVVLAGGYAYVSR-QTPQYTA-TTQMFAS---------V--
A0A2T3C430      ----WRILRAHWVSVLGITVLGVLVAFGWSLL-QPKVYSA-DASGIVS---------I--
A0A317DND7      ----LRALRAHWFLVVLVTAVGGAAAGVYSWV-QTPMYQA-DVQLFVS---------I--
C4FFN7          ----IRIVGKHMFTAILVFVLVVVGVTAYTLT-AQKKYTA-TAQLFAS---------Y--
A0A087BKW6      ----IRIVGKHMFTAILVFVLVVVGVTAYTLT-AQKKYTA-TAQLFAS---------Y--
A0A126SYB4      ----IRIVGKHMFTAILVFVLVVVGVTAYTLT-AQKKYMA-TAQLFAS---------Y--
A0A0F0L1W1      ----LRALRRNWIAIILMTAVGLGAAYGWAKI-QTPVYEA-SVSGLVK---------S--
A0A1I6JH27      ----LRALRRNWIAIILMTAVGLGAAYGWAKI-QTPVYEA-SVSGLVK---------S--
A0A0D8BLB2      ----LRAVRAHWLVALGVFAMCSVTTGLYVSV-QSPIYTA-KIQLFVA---------T--
A0A3Q9CQB2      ----WGALRKLWVVIVASMLIGGLVTFGVTSV-MTPDYES-TSTLAFS---------A--
A0A1H1SPW6      ----LRSVRRRWLYVLLGIVVGGGAGAAAIVL-TTPQFEA-SATVYFS---------V--
A0A2R4G4T8      ----LRAIKKHWIVEIVLFCVVAGVVAGLTFT-ATPVYTA-NTEILAQ---------Y--
B6XVL3          ----LRAIKKHWIVEIVLFCVVVGVVAGTTFA-ATPIYTA-STEILTQ---------Y--
A0A430FRP4      ----FRIIGKHIITMIISFIVVFGISCVYLVT-SKPVYSA-TSQTYAT---------Y--
A0A2U2RJU3      ----VRELRTRWRFIALVTLVALLLGVAASLL-LPKQYDA-ETQLLVS---------V--
A0A1P8U1C6      ----WGALRKLWVVIVASMLIGGVVTFGVTSV-MTPDYES-TSTLAFS---------A--
K7S215          ----WGALRKLWVVIVASMLIGGVVTFGVTSV-MTPDYES-TSTLAFS---------A--
A0A344UWM2      ----WGTLRKLWGVIAATVLAGALVTFAATSV-MTPHYES-TSTLAFS---------A--
A0A3M9MHZ0      ----WKLTRRYWLMLVACAAIGLALAAAYTWT-RTKEYTA-TAQALVA---------S--
A0A127A501      ----LRIARRFWKGIVALVLVSTVAAFGWYLI-QPRIYSA-EASGMVI---------S--
A0A2W6DJY1      ----LRAIRKSWWIIDLVLLLGAGAGYLQSAS-TTPIYAA-RITFYVS---------T--
A0A2N3QQ61      ----FRILRKHVITIIITFFVVLGVVITMTAM-SPVQYST-TTQLFAT---------Y--
A0A0L7BSV7      ----LSILRKHIITIAVTFVVILGVDILYTAM-SPVAYTT-TTQLFAT---------Y--
D3R6R7          ----LSILRKHIITIAVTFVVILGVDILYTAM-SPVAYTT-TTQLFAT---------Y--
E8NEF0          ----VRVLRAYWKAIVALTVVGGLAGLGWSAL-QPRVYTA-DASGYVA---------A--
A0A2R9UAE0      ----ARILRAYWKAIVALTLAGGLAGFGWSAL-QPRVYTA-DASGYVA---------S--
A0A165I7L3      ----ARILRAYWKTIVALTIIGGLAGLAWSAL-QPRVYTA-DASGYVA---------S--
A0A443JMZ6      ----ARILRAYWKTILALTLAGGLAGLGWSAL-QPRIYTA-DASGYVA---------S--
R6NVA8          ----FRIVHKHLLVGIITFVVVFAAVCAYTFL-APPKYSA-TAQVFAT---------Y--
A0A174B9F5      ----FRIVHKHLLVGIITFVVVFAAVCAYTFL-APPKYSA-TAQVFAT---------Y--
A0A3E5ATI8      ----FRIVHKHLLVGIITFVVVFAAVCAYTFL-APPKYSA-TAQVFAT---------Y--
A0A267WLK2      ----FRIVHKHLLVGIITFVVVFAAVCAYTFL-APPKYSA-TAQVFAT---------Y--
A0A2G5Q517      ----FRIVHKHLLVGIITFVVVFAAVCAYTFM-VPPKYSA-TAQVFAT---------Y--
A1A356          ----FRIVRKHIVVGIITFVVVFAAVCAYTFL-VPPKYSA-TSQVFAT---------Y--
A0A1X2ZNC3      ----FRIVRKHIVVGIITFVVVFAAVCAYTFL-VPPKYSA-TSQVFAT---------Y--
A0A412K6M4      ----FRIVRKHIVVGIITFVVVFAAVCAYTFL-VPPKYSA-TSQVFAT---------Y--
A0A261FZA3      ----LRIIRKHVIAAIVTFVVVFAAVCAYTLL-VPPKYSA-TAQVFAT---------Y--
A0A087D923      ----LRIIRKHVISVIVTFVVVFAAVCAYTLL-TPPKYTA-TSQVFAT---------F--
A0A2N5IRG9      ----LRIIRKHVISVAVTFVVVFAAVCAYTLL-TPPKYTA-TSQVFAT---------F--
A0A448R4J3      ----LRLLRTYWRGITLITLAAAMVVVGVSLL-QPKVYST-TASGLVV---------A--
A0A3A5HBN2      ----LRALRNHWAGAMALTILVGAAAFGFSLL-QPKVYAA-NANGFVG---------T--
A0A3E0W260      ----LRIVRNHWIGIVLLIAVGAGAGAGWAII-QPRVYTA-DASGIIT---------T--
A0A371NXN9      ----LTLTRRGWKILVLAVVIGALAGAAYGFF-APKVYQA-SSTGFIA---------V--
A0A1U7MRN3      ----LTTLRQRWRLVLATMLVVVAATALATLQ-TRPVYES-STRVYLL---------A--
A0A285VW57      ----LHALRQRWRIVVTTMLLVVAATAWVTLQ-TQPVYQS-SSRVYLL---------A--
A0A448NYH5      ----ARVLRAHWAGVLGIFLLGLAIAAGVTVL-QPKEYTA-TTSGIVT---------A--
A0A1X6X4B5      ----LRLLLRNALLLTISLVLGAGLGYAYSHT-KPEAYQA-SALGFV-------------
A0A366ILB0      ----LRIIRRKRLLVGLVTALGLALGIASTLL-MPPKYEA-STQLYVS---------V--
A0A3N4Z5J3      ----LAILRSRWITIVLATLVVLGAATAATLS-ITPMYTA-SARVFFS---------A--
A0A1I2I8S9      ----VGALRKRWLVIVVLAVLGAGAGFALARS-STPEYRS-TSKVFVS---------L--
A0A1Q8LIL7      ----LRTLREQYVLVAVTVLIGVAAAGAVFAV-QPASYTA-STSLYVS---------A--
A0A430FVU4      ----LGALKKHVVTAVITFVVVVAGVCAYTFT-RTPMYTA-SAQLFAT---------Y--
A0A1G8DY24      ----LRILRAHWVGIVLFVILGVAVAFVWSLV-QPRVYTA-DASGYVA---------A--
A0A2W5XV31      ----LGVLRKRWPVAAALGILGAVVGLGVAER-TPPSYTA-TAKVFVA---------V--
A0A417Z5F8      ----WRIARRYWAILVAMSLAGVAIAWLFLLT-QPERYTA-TTTAYVT---------A--
A0A2C7B062      ----LKLTRRRLGTILICTLLGAVAAAGLLLM-TPTTYSA-QATAYVR---------V--
A0A3Q9UNX8      ----LKLTRRRLGTILVCTLLGAVAAAGLLLV-TPTTYSA-QATAYVR---------V--
A0A344UX64      ----LRLTRRRLGTIIASTLLGAAAAAGLLVL-LPTHYTS-QATAYVR---------V--
A0A3S9JFD4      ----FRLTRRHLGTIAAFTVLGAIVAAGLLMV-LPARYTS-QASAYVR---------V--
A0A2S5W2F7      ----LRILRNHWIGIIVFIALGAGVASGWSIV-QPRVYTA-DASGILT---------T--
A0A3E0VYJ0      ----VRILRGHWIAILICMALGAGSAAGWSLV-QQRVYSA-DASGIIT---------T--
A0A399NHL8      ----WTALRRRWITILLLGIVGGGAAYAYAAT-LSPSYRS-TSSVFVS---------S--
A0A3S8SNK3      ----MRIVRKNIVLLIVMIAAGGLGGVGVYLL-LPDEYTS-QTELFVS---------T--
A0A260DSD5      ----VRILRAYWKAIVALTVIGGLAGFAWSAA-QPRVYTA-DASGYVA---------T--
A0A1B3PZG7      ----VRILRRNLALLIVCTLAGGLLGAVYQLT-RPETFTA-KATGMVV---------A--
G4CXH7          ----VRILRRNLALLIICTVIGGLIGAAYQLT-RPEVFTA-KATGMVV---------A--
U7IS15          ----VRILRRNLALLIICTVIGGLIGAAYQLT-RPEVFTA-KATGMVV---------A--
U7J8K7          ----VRILRRNLALLIICTVIGGLIGAAYQLT-RPEVFTA-KATGMVV---------A--
U7K617          ----VRILRRNLALLIICTVIGGLIGAAYQLT-RPEVFTA-KATGMVV---------A--
U7MEN9          ----VRILRRNLALLIICTVIGGLIGAAYQLT-RPEVFTA-KATGMVV---------A--
S3WQQ9          ----VRILRRNLALLIVCTLMGGLLGAVYQLT-RPEVFTA-KATGMVV---------A--
A0A2W1QU49      ----LRIFRRSWLLIVAAVLLGTAVGTASALV-TDPSYRS-DTRLFVA---------I--
A0A413RMG9      ----LLALRKRWLVIGVLGIIGGLLGYGYAQS-ITPAFKA-TANVFVS---------V--
A0A1I4JX94      ----GAALKRFWYIVAIGAVAGLAGGWGLAQV-ATPVYTA-TSSLYFS---------L--
A0A1M3AX45      ----LGVLLRGWWILLVAAVLGGGVAYGYSSL-QAPIFQS-TASTYFS---------M--
A0A0Q8LJ68      ----LGVLLRAWWVILLAGLLGGLLAFGYSST-LSPIYQS-TASTYFS---------M--
A0A1H3U5E8      ----LPILRAHWLAIILLTLLGGAVAFGWTLI-QPKVYTA-DSSGIVS---------I--
N1V0H1          ----LRVLHTYWRGIVAIALVVTLLAFGWTFL-QKPVYEA-QSTGYVI---------A--
A0A2V5FP96      ----VRVFRQHWLGVVALTLIGILCSAGWLLF-QQPVYSA-TSVGYVS---------V--
A0A0A1D2Z9      ----VRVFRQHGLGVIALALIGILCSAGWLFL-QKPIYAA-NSIGYVS---------I--
A0A0S2M268      ----VRVFRQHWLGVVALTLIGILCSAGWIFL-QKPVYAA-NSIGYVS---------I--
A0A2V5ITQ5      ----VRVFRQHWLGVVALVLIGILCSAGWILL-QKPSYSA-NSIGYVS---------I--
A0A0B8ZYB5      ----LTILRERWVYALSTAFIVIAGVAGFTAL-QTPVYES-SANVFVR---------T--
A0A2A3X2J3      ----LTILRERWVAALSTVILVLAAVGGVTAL-QPPTYEA-SANVFVR---------T--
A0A444BN88      ----VRVARRFWVSIAVCLLVGIGAGAGYAAL-QPRLYTA-SSEAYVQ---------I--
C5C9H1          ----LRAVRDHWVLLASCTLVGILLAALWTLT-QPQTYQS-QASAVVT---------A--
A0A022KTD5      ----LRLLLRNALLLVLLTVLGAAAGYGFSYT-KAPVYQA-SALGFVR---------G--
A0A345YSE8      ----LRLLLRNLLLLLGITALGAAAGYGYSYT-QPEVYSA-SALGYVS---------A--
A0A2N6TZM8      ----LRLLLRNAVLLVLVTVLGAAAGYGYSHT-KPELYSA-SALGYVS---------A--
A0A2A3YKI1      ----LRLLLRNLFLLILGVALGAAAGFGFSFS-KPEVYSA-SALGYVS---------A--
A0A0N0RHI0      ----LRLLLRNLLLLVAGLVLGAAAGYGLSFT-QSTTYSA-SALGYVS---------A--
Z9JT73          ----LRLLLRNALLLILVTVLGAAAGLGISFT-RTPVYSA-SALGYVS---------A--
A0A3E0VFB7      ----LRVLRAHWIAIVVFMLVGGLAGYGWSLI-QPRVYTA-DASGIIT---------T--
A0A3L8P6G2      ----LGLLRSYWPGLVVGVLLGAAAAYVYTAT-QPKIYAA-DASGIVT---------T--
A0A0V8STB2      ----LRSARKHWWWVVLPVVALTLGMGVVSVR-STPVYRS-TATLYVA---------L--
A0A221R7G9      ----VAVMRRHWRGILLITTLATAMAFGWYLV-QPRQYAA-EASGVVI---------T--
A0A3N4YN11      ----IALLRKRWPWFVAFVVAGVMVFAVITFF-TTPIYQA-RSQVFVS---------L--
A0A2J8IE59      ----ARVAMTYWKYITVVTLIITVIAAAWSAV-RPRIYAA-EASAVVL---------A--
A0A2V1M0F1      ----LRSLRTHWRAITLITLLCTLLALGWTLI-QPKIYSA-TASGLVV---------A--
A0A1Q9SDR8      ----LRLVRTHWRAITLITLLCTLLALGWTLI-QPKIYSA-TASGLVV---------A--
A0A2A2FUY1      ----LRLVRTHWRAITLITLLCTLLALGWTLI-QPKIYSA-TASGLVV---------A--
A0A378GSQ8      ----LRLVRTHWRAITLITLLCTLLALGWTLI-QPKIYSA-TASGLVV---------A--
A0A1F1W0J5      ----LTILKERWSTAAIAAVLVLAVVSTLTLT-RTPTYTA-TNRVFVQ---------T--
A0A0M8KP53      ----LTILKERWSTVAIAAVIVLAVVSTLTLT-RTPTYTA-TNRVFVQ---------T--
A0A3R8QM28      ----LTILKERWSTAAIAAVIVLAVVSTLTLT-RTPTYTA-TNRVFVQ---------T--
D1NRU2          ----LRTLAKHWITAVVTAAIVLAGVITYLAV-APAKYSA-TSRLFAT---------Y--
H0E7B2          ----WSLVADNRWLIILTTMIAVGASLFVSLR-AVPQYEG-TAKLAFS---------D--
A0A2U1ZYD2      ----LRIVRRRWMLIASMVLLGTLGAGVATSL-VEPEYSS-TAQVYVS---------V--
A0A371NYG9      ----VRALKRHWIGIVLLTVLGVAVGFGWAAM-QAPVYQADASGVVTV---------I--
A0A2U1EFT5      ----ANVLRRRWAVIVCTALVGALAAFGYAWS-TPPSYTA-TAKVYVS---------L--
A0A2A9EIV3      ----ISILRKRWISVAIIALATLAATAAVTLL-MTPKYSA-SNRMFFA---------V--
A0A1G8B900      ----VRILRRRWIPIVAASVVGVGAAAGVSAL-QAPSYAS-TTQVFVS---------T--
A0A2W6UWF7      ----IRILRKNWLVIVALTLLGIGAAAAYSLT-REPVYEA-SSQVFVS---------S--
A0A3N2BDL8      ----LAILRKRWIAIALCVVLGLLTAATVSLL-LPPQYEA-SARVYVA---------A--
A0A401UV75      ----LRVLRKRWVSIVAITALCALGAVGASLA-MTPVYQA-TTQLYVS---------V--
F4GZE0          ----LRVLRKRWVSIVAITALATLGAVAASLA-TTPMYQA-TTQLYVS---------V--
A0A021VVD9      ----VAILRKRWVSILVVALAVVAAALAATLA-ATPSYQA-RSQVYVS---------V--
A0A222XDN9      ----LTALRKRWWAVALLAVLGAGLGYVQASG-ATPLYRS-TAKVWVS---------L--
A0A1X7CQL8      ----VLLLRKRWVSVVVVAALGLVLAGAYSLL-ATPSYAA-RSQVYVS---------V--
A0A1N6RXV3      ----LLLLRRRWVTVAVAAALGLVLAGAYSLL-STPTYSA-RSQVYVS---------V--
A0A1Y0HXU8      ----LVLLRKRWVTVVVAGALGLALAGAYSLL-TTPTYSA-RSQVYVS---------V--
A0A2U1ES11      --------------MTAVTLAGIMLAGLFALT-RTPAYTT-SSQVFVS---------F--
A0A397LPH3      ----LRIIRKHWVPVTALALAGIVLAGMFAFT-RTPAYTT-SSQVFVS---------F--
A0A2M7T4M9      ----ARILIKRKIAVIVGILIGLIIAVSINIY-IKPQYEA-STQMLFS------------
A0A0Q6VGV2      ----LGILRGRWKFIISTLVIGTIASVGLVLN-LSPVYSS-SARVFVS---------T--
A0A0Q8W6H9      ----LGILRGRWKFIISTLVIGTIATVGLVLN-LSPVYSS-SARVFVS---------T--
A0A0Q5E3I1      ----VQTLRKYWVLIAVLVVVGCATGYVVAKT-QVPMFRS-TSSVLLS---------A--
A0A3N0CRL5      ------MAQRRWLTIVVFFLLGLLGGGALTYF-QTPQYES-KARVFIA---------A--
A0A3N0DPX8      ----LRIVQRRWLTIVVFFLLGLLGGGALTYF-QTPQYES-TSKVFIA---------A--
A0A0F0KEG5      ----WGAVRKFWFVILGMALIGGAVGYGVSAA-TPPQYQS-TATLYFA---------M--
A0A0U3XWM6      ----WAAIRKFWYVIIGMAVIGGAVAYGISST-TTPQFQS-TATLYFA---------M--
A0A3N2AWG3      ----WEAVRKYWILIVGFAVLGGGIGYAVSAS-TPPRYQS-AASLYFA---------L--
A0A2W6UMX9      ----REAIRKFWLLIVGLTILGGALGYGLSST-VTPIYQS-TATLYFA---------L--
A0A1X6Y1Z1      ----ISAVRKFWWLVVVLAIGGGAASFAYAAS-QTPMYQA-TSSLHFA---------L--
C7MGH5          ----LAAIRKFWWLVAVLALAGGAASFAYAAA-QTPLYQA-TSSLHFA---------L--
A0A1X6XXM6      ----IAAARKFWWLVVLTAVIGAVGMFGYSST-QTPMYKA-TTSLHFA---------L--
A0A220UD04      ----LAALRKLWWVVVIGGVLGAAGSLGYSSL-QTPLYTA-TSSLHFS---------I--
A0A1S2MX30      ----AGSLRKFWWLIVLCGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A1H1UMF0      ----AGSLRKFWWLIVLCGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A1Y2KJJ2      ----AGSLRKFWWLIVLCGVVGAAGSFGYASL-QTPLFQA-TTSLYFA---------L--
A0A2S9BL32      ----ASSLRKFWWLIVLSAVLGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A022L4I4      ----ASSLRKFWWMVVLFGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A0Q6PIE9      ----ASSLRKFWWMVVLFGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A0Q7RV30      ----ASSLRKFWWMVVLFGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A3S9X0U7      ----ASSLRKFWWMVVLFGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
T5KGY5          ----ASSLRKFWWMVVLFGVVGAAGSYGYASL-QTPLFQA-TTSLYFA---------L--
A0A0F0KLV0      ----ASSLRKFWWMIVLCGVIGAAGSFGYASL-QTPLFQA-TTSLYFA---------L--
A0A366CQZ6      ----ASSLRKFWWAIVLCAVVGAAGSFGYASL-QTPLFQA-TTSLYFA---------L--
A0A3S9WH06      ----ASSLRKFWWAIVLCAVVGAAGSFGYASL-QTPLFQA-TTSLYFA---------L--
A0A2S8UC18      ----ASSLRKFWWVIVLCGVVGAAGSFVNASL-QTPLYQA-TTSLYFA---------L--
A0A3D1YWU2      ----LKIIAKRKGIVIIGTVLCVLLAMIATMY-MTPQYNA-TAKILVA------------
A0A087CJ39      ----VSVIRKHLSIVAAGFASIIFVVAVYSLT-ATPRYIA-ASELFVS---------Y--
A0A2J9IL43      ----LRVLRNNRWVILACVALGTLLGVAYSLL-QPVLYTA-TSTGLVV---------VQ-
A0A1H4BJZ8      ----FRMLKANIVILLLGVLLGAAAGYGYSML-QPKVYTS-KSTGFVV---------VND
A0A1V3ZHZ8      ----LRVLRANRLVILGCAALGLALGLLYSLL-QPTLYTA-TSTAFVT---------VE-
A0A3S5K1S4      ----LRVLRANRLVILGCAALGLAAGLVYSLL-QPTLYTA-TSTAFVT---------VE-
A0A031HPL6      ----LRVLRANRLVILGCAALGLAMGLVYSLL-QPTLYTA-TSSAFVT---------VE-
A0A2A9K6H4      ----LRVLRANRLVILGCAALGLALGLLYSLL-QPTLYTA-TSTAFVT---------VE-
A0A031GRT8      ----LRVLRANRLVILGCAALGLAMGLVYSLL-QPTLYTA-TSSAFVT---------VE-
A0A366DF83      ----LRVLRANRLVILGCAALGLAMGLVYSLL-QPTLYTA-TSSAFVT---------VE-
A0A3G2SMN6      ----LRVLRANRLVILGCAALGLALGLLYSLL-QPTLYTA-TSTAFVT---------VE-
A0A031G2F4      ----LRVLRANRLVILGCAALGLAMGLVYSLL-QPTLYTA-TSTAFVT---------VE-
A0A2N6RS04      ----LRVLRANRLVILGCAALGLAMGLLYSLL-QPTLYTA-TSTAFVT---------VE-
A0A261G2E3      ----LAAIRKHWAIAVSAFAVVLILVGAYTIL-ATPQYTA-SSELYAT---------YDN
A0A151C1L8      ----VRTLRKRWQLLSLLALLGVALAAAITTQ-IPAVYAS-KVTFYVA---------T--
A0A3G9J2B6      ----IGIARARWRIIVAVFLSALALASAYVFL-TPAQYKS-TATVFLS---------I--
A0A1F2UPP7      ----LKIIAKRKGIVIIGTVLCVLLAMIATMY-MTPQYNA-TAKILVA------------
A0A0Q7PFQ8      ----MRTARRRWKTIVALFLVALVAAGAYSFL-VTPQYQS-TARVFIS---------T--
A0A0Q8A3C4      ----MRTARRRWKTIVALFLVALVAAGAYSFL-VTPQYQS-TARVFIS---------T--
A0A0Q9RI09      ----MRTARRRWKTIVALFLVALVAAGAYSFL-VTPQYQS-TARVFIS---------T--
A0A0Q9SBW5      ----MRTARRRWKTIVALLLIALVAAGAYSFL-VTPKYES-HARVFIS---------T--
A0A164BG91      ----PSVFLQLWWVIVVAGVVGGLAAFGYSST-LTPVFHS-TASIYFS---------MRT
A0A0P7FX18      ----ILILRRNWMLIVSFALSGLIAAAVVSVA-MPKAYTA-SSSLFVS---------T--
A0A087BSB6      ----WIILKKRRVTALVTAFVVFGLVVIVTFL-MPPKYTA-TAEIFAS---------Y--
A0A3T0DDC5      ----AARIARFWRSALLIFLLSLGVSAGLTSL-QTPVYTA-ASTMYIT---------V--
A0A1H9SLE3      ----IEVLRKRWRWAVLGLVVAVGVSVLATVL-MPRKYTS-QTQLFFA---------T--
A0A087D8L2      ---------------------------------------------------------M--
A0A3S9W679      ----IASLRRSWWIILLLAAIGAGAGFGYATV-QPKVYRA-QADVVII------------
A0A1G8AQG9      ----FLALRKQWLAILVLAFLGAAIGYGYAQT-QTDVYRA-QSSVLVL------------
A0A011U0Z3      ----FSALRKRWALLLVLTILGAALGYGYGTL-QTDTYRA-QSSVVIV------------
A0A1E4C6A4      ----FSALRKRWALLLVLTILGAALGYGYGTL-QTDTYRA-QSSVVIV------------
H8E5G6          ----FSALRKRWALLLVLTILGAALGYGYGTL-QTDTYRA-QSSVVIV------------
S3BBS2          ----FSALRKRWALLLVLTILGAALGYGYGTL-QTDTYRA-QSSVVIV------------
A0A2M9HDE4      ----LQMLRRRIVTAIVAFAVVFVAGAAYTFL-APAKYTA-TSEVLAS---------YNV
A0A086ZQ72      ----LQAVRKHLVAAIATFVVVVGLVAAYTFL-TPPKYTA-TAQLFAT---------Y--
A0A087EH01      ----LQAVRKHLVAAIAAFIVVVGLVAAYTFL-TPPKYTA-TAQLFAT---------Y--
A0A2N3QN49      ----LQAVRKHLGAAVATFVVVATAVAAYTFL-TPPKYTA-TAQLFAT---------Y--
M4RDM8          ----LQAVRKHLGAAVATFVVVATAVAAYTFL-TPPKYTA-TAQLFAT---------Y--
A0A087DXR0      ----LQAVRKHMVAAIATFVVIVAAVAGYTFL-VPPQYTA-TAELFAT---------Y--
A0A087E3D8      ----LQAVRKHMVAAIATFVVIVAAVAGYTFL-VPPQYTA-TAELFAT---------Y--
A0A316TK00      ----LMVLRRRWRTIIAMLLLGLGVAAAISYFLMTPKYES-TSKVVVS---------V--
A0A0Q8V9V9      ------MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYES-DSTVFLS---------V--
A0A0Q8X1G0      ------MLRRRWLTVVSLVGVSLAVASLLNFVLLTPKYES-DSTVFLS---------V--
A0A0Q8E213      -----MVLRRRWMSVVALVLVAVAASAAITFT-RTPVYES-KSQVFLT---------V--
A0A0Q8HXQ0      -----MVLRRRWMSVVALVLVAVAASAAITFT-RTPVYES-KSQVFLT---------V--
A0A0Q8Q033      ----LVVLRRRWVSVLLLIALALGVAAGITFT-RTPMYES-KSQVFLS---------I--
A0A2A3XQJ7      ----LIALKKRWYVVVATALLAGVMTFAYSAT-IPPVYQA-SASLFFS---------L--
A0A3B7D7I9      ----LRTLRRRWKFAVASFLLGIIGAAVLTSA-ITPTYQS-QARIYVT---------A--
A0A1I2LBW7      ----LKVLRRRWRWLIPGVLVAVVAAAVVTFL-TTPQYAS-TIRLFVS---------T--
A0A0S9D7J0      ------------MTIVALCLLGALAAFAYASL-SAPQYRA-VSSVFVS---------S--
A0A433JWV9      ----IGAIRKNWIVITALTLLGAGAGYGYAQT-MPDMYRS-TAQAYAS---------T--
A0A243RSJ6      ----VRLARRNWPLILLALIISVAAALVVTMN-TPPKYVA-STSMLVS------------
A0A2Z3V1Q8      ----ARLARRNWLLILFSLVLAVSTSLIVTAR-MPTKYVA-TISMLVS------------
A0A259VFQ3      ----LDAVRRGWWIVLACGIVVALCGFGYSML-QSPVYRA-TAAVYVT------------
H0RH30          ----LDAVRRGWWIVLACGIVVALCGFGYSML-QSPVYRA-TAAVYVT------------
A0A1P8M4B6      -------MRRSWLLITCLALLGLLGGGASALL-VKPTYES-ETQLFVA---------I--
A0A087C7D7      ----LHVLRKHVVTVVTAFVVVFLAVAAFTFL-SPPKYTA-TAELFAT---------Y--
A0A423UFR1      ----LHVLRKHVVTVVTAFVVVFLAVAAFTFL-SPPKYTA-TAELFAT---------Y--
A0A087BEI6      ----LATIRKHLIAALVACAVVIACVGAYVFL-APPEYTS-TAQVIAT---------F--
C4FH22          ----VVIIRKHIATAAICFAVIVGVAGAYAFL-AAPQYSA-TAQVIAT---------Y--
A0A2M9HPB2      ----LQILRKHFVSAIISFVVVFAAIAAVTFI-MPPKYTA-TAEVLAT---------Y--
C2GUY9          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
D6ZYB6          ----LQIIRKHLASAIISFVVVFAAVAAVAFI-MPPKYTA-TAEAFAT---------Y--
A0A366KE79      ----LRILRKHLTTAFITFAVVIAAVATVAFM-MPPKYTA-TAELLAT---------Y--
A0A2M9HJL0      ----LQILRKHIVAAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2K9BH83      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2N0TKZ2      ----LQIVRKHLASAIISFVVVFAAVTAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2K9BJ14      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0M4N206      ----LQIIRKHLASAIISFVVVFAAVAAVAFI-MPPKYTA-TAEAFAT---------Y--
A0A2U2RVH5      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
B7GUK0          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A1S2VWI2      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A396G475      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A3D8UF99      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A087BLR1      ----LQIIRKHLASAIISFVVVFAAVAAVAFI-MPPKYTA-TAEAFAT---------Y--
A0A083XFV9      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0L7D1M8      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A3G8WK80      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0M3T8W0      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
W6F7E0          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2N6TV90      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-MAEVFAT---------Y--
A0A395XYP7      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A1S2VZH5      ----LQIVRKHLASAIISFVVVFAAVAAATFI-MPPKYTA-TAEVFAT---------Y--
A0A2N0T384      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
E8MRZ7          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0M4LFJ1      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A083XXD1      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A133LT97      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2K9BTQ3      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0M0VLI6      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A1V8RGW6      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A414FCG0      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
F8ASQ4          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0L0LU29      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0L7AYJ9      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A0L7BTF3      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A133L2Q6      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
D4BMS0          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
S2ZR30          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2K9B393      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A3D8UCA0      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
Q8G4Z0          ----LQIIRKHLASAIISFVVVFAAVAAVAFI-MPPKYTA-TAEVFAT---------Y--
A0A3E4S4A8      ----LQIIRKHLASAIISFVVVFAAVAAVAFI-MPPKYTA-TAEVFAT---------Y--
A0A0L7C1M1      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2K9B7Z0      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2X1B539      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
F9Y1Z6          ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A2K9B8Q4      ----LQIVRKHLASAIISFVVVFAAVAAVTFI-MPPKYTA-TAEVFAT---------Y--
A0A087D5G1      ----LKIIRKHLVATIVAFVVVVAGVSAYTFL-APPKYTA-TAQTMAT---------Y--
A0A0A7I7A4      ----MRIIRKHLVTAAIVFVMVFAGVTAYTFL-VPPKYTA-TAQAMAT---------Y--
E0Q4N5          ----LTIIRKHIVTAIIAFVVVVAGVSTYTFL-APPKYTA-TAQTMAT---------Y--
D2Q677          ----LTIIRKHIVTAIIAFVVVVAGVSIYTFL-APPKYTA-TAQTMAT---------Y--
W2VDM0          ----LTIIRKHIVTAIIAFVVVVAGVSTYTFL-APPKYTA-TAQTMAT---------Y--
A0A087E8V5      ----MQIIRKRIVTVIVTFCIVFAAVAAFTFL-SPTKYTA-TAELFAT---------Y--
A0A2N5J8X7      ----LQMIRRRIITAIIAFAVVCGAVVAYTFL-APAKYTA-TSEVYAS---------Y--
A0A2A3Y8D9      ----LMALKRHWLLIVIVAVLGGGIGFGVGKM-TPPTYSA-TSSVFVS---------A--
A0A365YAB1      ----LLALRRHWILILVLAVLWGALGYGYGKI-SPPTYTA-GSSVFVS---------A--
A0A367FIB3      ----LRLMRAHWAVVVLTLIASAAAAMVISAK-TPPKYQA-QITMLVT---------G--
A0A2W1WC71      ----LDVVRRRWLTITIAVVVGVATAFGVTHF-QTPEYRS-TAGVFVS---------V--
A0A261G0Y1      ----LKILRKFWIVELVIVAVVTGATAWMVKS-ETPIYSS-STQVLVR---------A--
A0A3L7ALP7      ----IAAVRRHWIAVVIAIVIACGIAGVATAV-ATPQYQS-KTQLFVS---------V--
A0A1G9HLU0      ----LGALKRCWVLLFVLTLLGGAAGFGYARS-TPPMYKA-SSSIFVS---------T--
A0A261F1K2      ----LKILRRRWIPALITFVVIVAAAIGYLAT-ATRMYTA-TSQVFAS--------YT--
A0A1R4J952      ----SQIFRQYWISAMATLLACIGLAAAFTFL-QTPKYTA-SASVFIT---------V--
A0A2J9INQ6      ----LQTFRKYWRSTLAVLLLCTGAAVAFTYV-QTPKYSS-TSSALIA---------V--
A0A031GSP3      ----LQTFRKYWRSILTVLSVCVGAALAFTFL-QTPKYSS-TSSALIA---------V--
A0A1F1KDB3      ----LQIFRKYWRSILTVLSVCVGAALVFTFL-QTPKYSS-TSSALIA---------V--
A0A1F1U7J4      ----LQIFRKYWRSILTVLSVCVGAALVFTFL-QTPKYSS-TSSALIA---------V--
A0A2I1XYT0      ----LQTFRKYWRSILTVLSVCVGAALVFTFL-QTPKYSS-TSSALIA---------V--
A0A1M7BYB6      ----LQTFRKYWRSILTVLSVCVGAALVFTFL-QTPKYSS-TSSALIA---------V--
A0A2W5EY44      ----LQTFRKYWRSILTVLSLCVGAALVFTFL-QTPKYSS-TSSALIA---------V--
A0A1C0AIE6      ----MQIVRRYWRSTLATVFLCIALAAGFTVL-QSPTYTA-TSSVFIS---------V--
A0A1R1I632      ----LQIVRRYWRSTLATVFLCIALAAGFTLL-QSPTYSA-TSSVFIT---------V--
A0A1G9N5Q8      ----LQIVRRYWRSTLATVLACIVLAALFTLL-QKPTYTS-TSSVFLT---------V--
A0A3M0GWZ7      ----LLIVRRYWRSAIATLLLCVVIAAAVTLT-QKPTYTA-SAALFLA---------V--
A0A255EG83      ----ARILRRYWRSSVASVLVCIAMAAAITLM-QSPTYSA-SSQVFLS---------V--
A0A255EM53      ----ARIFRRYWRSAVASVLVCIAIAAGMTLL-QSPTYSA-AAQVFLT---------V--
A0A3S8Z6W5      ----LKIIRDYWRSILATLFVVVAAVAGYTIM-QDPTYRA-DATVFIT---------V--
A0A3S9PWP4      ----LKVFRDYWRSILATLFVVVMAAAGYTLM-QAPTYTA-TATVFVT---------V--
A0A1E5MK42      ----AAVLRRRWSSLVVLTLVGIGVGATLTLV-MTPMFRA-QAQVFVS---------V--
A0A2W0DAU9      ----LAVIRRRHWLLTMLTLLGVTGGVTLSLL-ATPLYRA-EAQMFVS---------V--
A0A3S0TBD3      ----LVVVRRRHWFLTLFVLLGVLAGTAVALT-STPLYRA-EAQMFVS---------V--
A0A0M3DDN8      ----ASSLRKFWWAIVLCAVVGAAGSFGYASL-QTPLFQA-TTSLYFA---------L--
A0A147E2K4      ----AGSLRKFWWAIVLCAVVGAAGSFGYASL-QTPLFQA-TTSLYFA---------L--
A0A420X5L5      ----LLALRRHWIVIAALTVICGIGAFGYAQT-LPEQYRS-VASVMVI---------P--
A0A2V1K647      ----FNVLRKNWLIIIVSTLLLLGGAAAWTFT-RTPQYEA-TTQLFVS---------V--
A0A417XT21      ----LQVLRRHWLGVVLMFLLSVGAASGISLA-QTPTYES-TAKVFLS------------
A0A0A1DU08      ------------MSIVAIILIALGVSAAITFT-RTPMYES-KTQIFLT------------
A0A2T5ZWX4      ----LVVLRRRWLTVVLLIVIALGVAAGITFT-RTPMYES-KAQVLLT------------
A0A3D9UM43      ----LTVVRRRWRIIALCTLVVVAVAALVTMQ-QPRSYTA-RSSFYLQ---------T--
A0A430FR71      ----LEALKKHLIVELVVLLAALAGGFLYVNQ-QTPQYTA-TAQMFASFNRNPTEAGT--
A0A1I7MP88      ----VKLLRANLVLLAVSTLVGILAGWGLSLA-QKPLYTS-ESTGFVV---------V--
A0A031FRH9      ----LSALRKFWWGVAVCAVVGATAAFGLSAL-ETPQYQS-TSSLYFA---------L--
Q1AYJ4          ----LRVLWRRAWIIALVAGLLTAAAAGFSLL-RTPIYEA-SIQIVIG---------Q--
A0A371PBX8      ----LGILRTRWVFSVSTIVAGTVATILLVLS-MSPVYGS-SAKLFIT---------S--
A0A0Q7QIS8      ----FGTLQARWKFALVAFLLGTIATVALVFT-MAPQYGS-TVKIFMS---------T--
A0A0S9R0B0      ----LGALRARWVFSTVTFLAGAVLTVAAVFL-MTPQYGS-SVKLFVS---------T--
E2SFH2          ----VSGLRARWKFSAVTFILGLAATAAILAV-WTPQYGS-SVKLFIS---------T--
A0A2M9HB57      ----LNVLKKYLLLELAILVVVTGGVTWAVKS-ETPVYTA-STQVFVR---------M--
A0A2U2MQ51      ----LNVLRKYLLLELAILVAVTGGITWAVKS-ETPVYTA-STQVFVR---------L--
A0A2W6VZZ9      ----FGVLLRAWWILALAGVAGGALAFAYSST-IAPVYQS-TASTWFS---------M--
A0A0F0LA25      ----LDALRRQWIVIIALTIIGAGAAFGYSRT-LPPEYSS-TAAVMVI---------P--
A0A196LJH7      ----IDALRRQWIVIVALTVLGVGAAFGYART-LPPEYSS-TAAVMVI---------A--
A0A0L6I3R0      ----IDALRRQWIVIVALTVIGAGAAFGYSRT-LPPEYSS-TAAVMVI---------P--
A0A2A4EEF2      ----IDALRRQWIVIVALTIIGAGAAFGYART-LPAEYSS-TAAVMVI---------P--
L7K558          ----VAVLKRDWWFAVVSALVLALLALGFSLM-QSPVYQS-SATLYVT---------S--
A0A261D338      ----LDTLKRGWILVLSITLFCGAIGLLVNLL-QEPTYRS-TATLYVT---------S--
A0A2W6RXY2      ----VGVIKRGWLVVLLITVICGAAGLIYSLL-QDPVYRS-TATLYVT---------S--
A0A151BXD8      ----YRILRRHWKVIIAATLAAIAVMFVWDLF-QPRVYQA-SSSGYVT---------A--
A0A2Y8ZUF1      ----YRILRRHWKIIVAATLAAIAVMFVWDLF-QPKVYQA-SSSGFVT---------A--
A0A3N4YTR5      ----VAALRKRWVVLVVAILAGGLAGLGYAQT-VAPQYRA-TTSVFVG---------L--
A0A0F0EUD4      ----LSVLGTRWRIIALSLLAVVAAAAVQTML-TPAVYSS-TAKIFLS---------A--
A0A0Q9U1Y8      ----LGVLGARWRIIAVSLLAVIAAAAVQTMV-TPAVYTA-SAKIFLS---------A--
A0A0Q9U9A8      ----LGVLGARWRIIAVSLLAVVAAAAVQTML-TPAVYTS-TAKIFLS---------A--
A0A315S789      ----VGTVKRGWILILVSTLVVGIGGLIYSLL-QSPVYRS-TATLYVT---------S--
V8CT75          ----VRAIKRGWITILAVTLIFGAVSVMYSIL-QKPVYQS-TATLYVT---------S--
A0A1X1B7C9      ----VAVVRRGWLVVLLITAICGGAAFTFSVL-QEPIYRS-TASLYVT---------S--
A0A2G3PHT3      ----VEVAKKGWLVILACTLIFGLAGFSYSAL-QDPTYRS-TAVLYVT---------S--
A0A318RQJ0      ----LDVVKSGWLVIVLAALACGAIGFLYSAL-QSPTYRS-TATLYVT---------S--
U1F9K1          ----VKLTRRRLVTILLCTLLGVAAGVGLLLT-TPATYTA-SATAYVR---------V--
A0A2W5CP38      ----VKLTRRRLVTILLCTLLGVAAGVGLLLT-TPATYTA-SATAYVR---------V--
A0A239WF29      ----VKLTRRRLVTILLCTLLGVAAGVGLLLT-TPATYTA-SATAYVR---------V--
U7JI33          ----VKLTRRRLVTILLCTLLGVAAGVGLLLT-TPATYTA-SATAYVR---------V--
A0A3D4PTL2      ----VRVLRRNLVLILSLLIIGLSAGIVVALN-TETKYTT-STELFVS---------A--
A0A2P7ADF2      ----VLLLRRHWKFLLTIVLLGGIAGVGYSAL-QTPVYTA-TSSGFIE---------T--
A0A2S5WZL9      ----LRILHKNWIAMLICTLAGVAAGAGVSLV-MTPTYSA-TAELYVS---------V--
A0A2S5UWU5      ----LRILHKNWIIILICTLAGVAGGAGVSLL-MTPKYEA-TAELYVS---------V--
A0A2S5UM02      ----LRILHKNWIIILICTLAGVAGGAGVSLL-QTPKYSS-TAELYVS---------V--
A0A2S5XAY1      ----LRILHKNWIIILICTLAGIAAGAGASLL-MTPKYES-VSEVYVS---------V--
L7KXD3          --------------------MLGCLGLGYCLV-QTPMYVS-SATLYVT---------S--
A0A1C4FI90      ----RFLVRRNWWIVALSGAVIGCLGLGYCLL-QTPLYVS-SAKLYVT---------S--
A0A243Q8C5      ----RFLVRRNWWIVALSGAVIGCLGLGYCLL-QTPLYVS-SAKLYVT---------S--
A0A1A0XID5      ----LSLVVRAWWIVAMCALVAGTSAFLYSLN-ETPVYRS-TATLYVT---------A--
A0A3N1NCT6      ----LDVLRRRWPSVLVVTVLATATAIGLSFV-QTPQYRA-SSEVFVS---------V--
A0A3N4VQ98      ----LEVIRRRWISALALVLLATSAAVGVTLV-QAPEYRA-SSEVFVS---------V--
A0A2W0CXJ5      ----FAVVRRRRWWIVLTVGIGIGSGVVVSAL-QVPQFRA-ESSVFVS---------V--
A0A1S2HW50      ----VDLLRLRWLSVVAVVVLAAGLAAAVSAV-QSPQYRA-SSAVFVS---------V--
A0A2W1WMU4      ----VDLLRLRWLSVVAVVVLAAGLAAAVSAV-QSPQYRA-SSAVFVS---------V--
A0A2W1V7N1      ----IDVLRHRWLSIAAVLVLATGIAAAVSAV-QPPQYRA-TSEVFVS---------V--
A0A1S2JHN3      ----IDVLRHRWISIAAVLLLATGLAAAFSAV-QAPQYRA-TSEVFVS---------V--
A0A2W1TGI6      ----IDVLRHRWISIAAVLLLATGLAAAFSAV-QAPQYRA-TSEVFVS---------V--
A0A2W1VQ01      ----IDVLRHRWISIAAVLLLATGLAAAFSAV-QAPQYRA-TSEVFVS---------V--
A0A022LGD7      ----IDVLRHRWISIAAVLLLATGLAAAFSAV-QAPQYRA-TSEVFVS---------V--
A0A0Q5KQN1      ----IDVLRHRWISIAAVLLLATGLAAAFSAV-QAPQYRA-TSEVFVS---------V--
A0A2A9CNB3      ----LTVLRKYWISILAVTLIGVLAAAGVSLL-TTPTYTA-STSVFLT---------V--
A0A316AE69      ----VVLLRRRWLVLVLGGMLGGVLGVVSTVG-QPDSFRA-EATVFLS---------L--
A0A251XS70      ----TALLRRLWYVVVAATLVGGGVAFGLSQL-ATPVFTA-QSRLYFS---------L--
B0RH06          ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A3D9PPQ8      ----TALLRRYWYVVVAAMLAGGVVAFGLSQL-ATPVFTA-QSRLYFS---------L--
A0A0D5CJH1      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A399SS87      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A225CHC3      ----TALLRRLWYVVVAATLVGGGIAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A251YVY8      ----TALLRRLWYVVVAATLVGGGIAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A0M5JNB0      ----TALLRRLWYVVVAATLVGGGVAYGLSQL-ATPVYTA-QSRLYFS---------L--
A0A251Z2T9      ----TALLRRLWYVVVAATLVGGGVAYGLSQL-ATPVYTA-QSRLYFS---------L--
A0A251YT31      ----TALLRRLWYVVVAATLAGGAAAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A251XZK8      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A5CP66          ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A067LLP2      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A399NXI4      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A251YE20      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A399QFM2      ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
M5BCW7          ----TALLRRLWYVVVAATLAGGAVAFGLSQL-ATPVYTA-QSRLYFS---------L--
A0A2M9CDB4      ----AATLVKHWLVIALCMLAGGALGYAYAKS-QVPMYQS-SASVMVV---------P--
A0A1G7N987      ----GTAVLRHWIVVAVCAVLGAVAGFGYARS-EPKVYQS-SASVMVV---------P--
A0A2T5N7W6      ----VTAVLRHWIVVAVCAVLGAVAGFGYARS-EPKVYQS-SASVMVV---------P--
A0A1N6VAF4      ----VTAVLRHWVVVAVCAVLGAVAGFGYARS-EPKVYQS-SASVMVV---------P--
A0A1W6DP77      ----VTAVLRHWVVVAVCAVLGAVAGFGYARS-EPKVYQS-SASVMVV---------P--
A0A0D1J4Z4      ------------MTISAVIVLALLASIAITVT-TTPLYKS-STRLFVS---------T--
A0A433BLH6      ----LRILRTRWIPVVAAVVVALLGTVIITAT-TTPLYKS-STRLFVS---------T--
A0A1A3GKG5      ----LKLMRARWITVCAAIVVAIVGAIAVTWT-TTPLYRA-STQLFVA---------A--
G4HWY2          ------MLRTRWITVCVTTLVVVLGAVAYTLL-TTPLYQA-STRLFVS---------T--
A0A1Q4HCJ3      ----VKLLRSRWITVAVTILVALAAAATYTFL-TTPLYQA-STRLFVS---------T--
A0A2C9SYC1      ------MLRTRWITIVVTALAAVLIAIGYSLL-TTPLYEA-STRLYVS---------T--
A0A378VDM5      ----TKLLRTRWITIVVTMLVSVLAAVAYSLL-TTPLYQA-STRLYVS---------T--
A0A375YHM1      ------------------MLVAVLGAVSVTLL-TTPLYQA-TTRLFVS---------T--
A0A0J6WM28      ----------------------------MTLV-TTPMYQA-TTRLFVS---------T--
A0A1Y5PAX5      ----AKLLRTRWVTIVVTILVAVLGAVAFNLL-TTPLYQA-STRLFVS---------T--
A0A2N8LPQ5      ----AKLLRTRWMTIAVSIMVAVLCAVAFNLL-TTPLYQA-STRLFVS---------T--
A0A1P8XIF4      ----VKMLRARWLTVCATTVLAVFGAVVISLL-TTPMYQA-STRLFVS---------T--
A0A1G4WVQ3      ----AKLLRTRWVTVAVTILVGLLGAVAVTLL-TTPLYKA-STRLFVS---------T--
A0A255DMT6      ----LKLLRSRWITVCVTTVATVLLAVIVTLL-TTPLYQA-STRLFVS---------T--
V5X881          ----IKLLRTRWLTVCVATGIGLMGAVVYTLL-TTPLYQA-STRLFVS---------T--
A0A0Q9AGY3      ----LKLLRKQWIIVCGVIVLAVAVAAVITAL-TPSKYQA-ATRLFVS---------T--
A0A024QWT2      ----LKLLRTRWISICVVALTTVAAATAVTLL-TTPQYQA-NTRLFVS---------T--
I4BFP2          ----LKTLRSRWLTVCLTIVVGVLAGVAITIL-TTPMYQA-STRLFVS---------T--
A0A101AMP3      ----VKTMRARWMTICVTVIAAGLCAVAFSLA-TTPLYQA-TTRLFVS---------T--
A0A1W9Z322      ----VKLLRTRWITIAATAIVTLMAAVIITLI-TTPLYET-STRLFVS---------A--
A0A1A0TFG1      ----ISVLRARWITVCVTIVVAVLGGVALTLL-TTPLYQA-STRLFVS---------T--
A0A2S8KZ97      ----AKLLRSRWLIVCATLAASIVLAIIVTAM-TTPLYKA-STRLFVS---------T--
A0A378SHC9      ----VKLLRSRWLTVAVTTVAAVLLAVVISLL-TTPLYQA-STRLFVS---------T--
A0A0J6WEP7      ----FKLLRARWMIVCAATVVAVLGAVVLSLM-TTPLYQA-STRLFVS---------T--
A4TF38          ----VKLLRSRWMTVCVTMVFAVMGAIAYTLL-ITPQYQA-STRLFVS---------T--
E6TBM9          ----VKLLRSRWVTVGVTLAATVLGAVAVSLL-TTPQYQA-STRLFVS---------T--
A1UBH0          ----VRLLRARWMAVCVTTLITFLGAVAVTML-TTPLYQS-STRLFVS---------T--
K0VJQ1          ----VRLIRARWLTVCVTVVVALLGAVAITLF-TTPLYQA-STRLYVS---------T--
A0A2S8KQU3      ----VKLLRGSWLIVTVATALGVLGAVVLTLL-TTPLYQA-STRLFVS---------T--
A0A2A7N7U2      ----VKLLRSRWLTVCVTLVAAVLGAVTISVL-TTPLYQA-STRLFVS---------T--
A0A2S7NEL0      ----VKLLRLRWMTVCLTAVAAVLVAVAMSLL-TTPLYQA-TTRLFVS---------T--
A0A1V4PWI5      ----VRLLRSRWLIVCVTVLVAVLGAVTVTLL-TTPLYQA-STRLFVS---------T--
A0A1X1TB04      ----LKVLRARWILIAATIVVAVLAAVAVNLL-TTPLYEA-STRLFVA---------T--
L0IR94          ----LRLLRSRWLIICATTAVAVGGAVALNAL-TTPLYEG-STRLFVS---------T--
A0A2T0RDM1      ----LRAVRKRWWLVAGAIAVSVGVAIAVTLL-TPPRYAA-SVTFFVS---------T--
A0A2I1XJP9      ----LQLLRRRWKAITAFTLLGLAVAAVLTAL-QPLTYTA-SATAVVN---------P--
A0A212TD96      ----LRLSRRHIITLLLSTLLGIALAAGWVAM-QTPVYTA-KATGVVQ---------A--
A0A1Q9TIH3      ----LRLSRRHIITLVLSTLLGIALAAGWVAL-QKPVYTA-TATGVVQ---------A--
A0A1F1JVB2      ----LRLTRRHIITLVLSTLAGIALAAGWVAM-QTPVYTA-TATGVVQ---------A--
A0A2I1PC09      ----LRLTRRHIITLVLSTLAGIALAAGWVAM-QTPVYTA-TATGVVQ---------A--
M0QJM7          ----IAVIARNWWVILLCAVIGAVLGMAASLA-QQPVYRS-TATLYVT---------S--
A0A1G6VTP3      ----VAVVRKRWFLILIPFLLACGSVGTWSML-TTPLYTA-TASSYFS---------M--
A0A2A9K6M4      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGLLA---------A--
A0A151D6I5      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGLLA---------A--
A0A031HPS9      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A3S1BFT1      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGLLA---------A--
A0A454U3A0      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGLLA---------A--
D3LLI8          ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGLLA---------A--
A0A031G3E4      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A229HLR2      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A270AW52      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A1M7A465      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A2I1XXG4      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A132I1I7      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPQIYAS-ESQGFLA---------A--
A0A2I1XJV6      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A3G2SMM6      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A2N6RS10      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A1V3ZKT1      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A1F1KI99      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A366DF60      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A433IPI0      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A1F1UP25      ----FRLLRANLLLLLAAALVGGLLGWGYSAL-QPRIYAS-ESQGFLA---------A--
A0A3A1TUK9      ----LHVLRRGLPLVIALPVLTTVAAGVVSAA-QAPVYQA-TTSLTVS---------A--
A0A1S2N0P2      ----LRLTRANLKYLIIFTVAGALLGLGVAAL-QPKVYSA-TSSGYVT---------A--
A0A1N5XHQ5      ----LRLTRANLKYLIIFTVAGALLGLGVAAL-QPKVYSA-TSSGYVT---------A--
A0A2X3GKL3      ----LRLTRANLKYLIIFTVAGALLGLGVAAL-QPKVYSA-TSSGYVT---------A--
A0A0Q3BEY5      ----LRLTRANLKYLIIFTVAGALLGLGVAAL-QPKVYSA-TSSGYVT---------A--
A0A401Y7Z0      ----LRMLVLHWMGVLVITALVVGGASAYTFT-RTKVYAA-DANGFVS---------T--
A0A0Q5I075      ----LSALRRRWPLIIVLGLLGAAIAFFYDST-LPTLYKS-TASVFVS---------T--
A0A0Q7GBJ4      ----LSALRRRWPLIIILGILGAAVAFFYDST-LPTLYKS-TASVFVS---------T--
A0A0Q8CQ58      ----LSALRRRWPLIIILGILGAAVAFFYDST-LPTLYKS-TASVFVS---------T--
A0A0Q9K1Q8      ----WKITRRQFVAIATCALLGVLLAFGWMLM-QPKVYTA-SAGGYVT---------A--
A0A1W1Y507      ----WKLTRRQFVVIVVAALVGLLLAFVWMSL-QPKVYTA-TAAGYVT---------A--
A0A3N0GXT5      ------MAQRRWLTIVVFFLLGLAGAGALTYT-QTPQYES-NARIFIS---------V--
A0A3G8JTQ2      ------MIRDGWLVIGLTTLLFGLVGLVYCIL-VTPIYQA-SATMYIS---------S--
A0A373DL26      ----WAALKKRWYLIAAATVIGGAGGLAMSLL-ATPVFQS-TATLFVS---------I--
A0A420ZVG0      ----GQAFRRFWYVVVIATVAGALLGFGLSQL-ATKSYTA-TSGLYFS---------L--
A0A1H4BPM4      ----AQAFRRFWYVVVIATIAGALLGFGLSQL-AVKSYTA-TSGLYFS---------L--
A0A1I4KI63      ----AQAFRRFWYVVVIATIAGALLGFGLSQL-AVKSYTA-TSGLYFS---------L--
A0A3E0VGJ6      ----WKALRKRWAVIVTLGILGGGGAYLYAQS-LPDSFQS-TSAVFVS---------S--
A0A3E0WC79      ----LKALRKRWIVIAILGVLGGGVAYTYAES-LPDSFQA-TSEIFVS---------S--
A0A3E0VTS3      ----WKALRKRWIVIAILGVVGGGVAYAYAES-LPDSFTA-TSEIFVS---------P--
A0A3E0VY43      ----WKALRKRWIVIAILGVVGGGVAYAYAES-LPDSFTA-TSEIFVS---------P--
A0A317ZJF6      ----LRSIARRWLTILVLGVLGAGVGFAYASA-QPALYRA-TSSVFVS---------S--
A0A1I3D4A2      ----LRTITRRWLIILIVGLLGGAAAWGYAAS-LPPQFQA-TNSVFVT---------S--
A0A1H0IXS2      ----LRTITRRWLLIVIVGILGGAAGWGYAAT-LPAQYQA-TNSVFVT---------S--
A0A1H8BMX3      ----LRTITRRWLLIIIVGLLGGAVAWGYAAT-LPAQYQA-TNSVFVT---------S--
C7NFS0          ----LRLSRRHIITLVLSTLLGIALAAGWVAL-QKPVYTA-TATGVVQ---------A--
A0A2J8IJ34      ----IRVVRLRWLAIVAIIVIGLALASAYTFL-QTPLYKA-ESQLFVS---------V--
A0A2W1TJJ1      ----IDVVRRYVWWVVLLVVLGAACGVAAAVL-QPPQYRA-QAKVFVS---------V--
A0A1S7B6R2      ----IATLRKQWIVIVVLALVGATGAYVFAQT-MAPQYRS-TTSVFVT---------T--
A0A1T5J523      ----IATLRKQWIVIVVLALVGATGAYVFAQT-MAPQYRS-TTSVFVT---------T--
A0A3A5H3U9      ----LRILRRHWLLIALCFAAALVVSGLVTSR-MIPQYSS-SSRIFIS---------T--
A0A3N1K9V0      ----LDVVRRRWLTIAIAVVVGVATAYGATQL-QTPEYQS-EAGVFVS---------V--
A0A2T0YQH3      ----VRVLKRGWLTLVLSVLVALAAAAALVAL-LPVTYEA-ETRIYVS---------V--
A0A2A9GST2      ----LGLARRRSLMIAAIALCGVSLAALATLL-MQPQYQA-RTSILFA---------V--
A0A1Y6FE39      ----LGAIRKQWAVILILALLGAAGGYVYAQS-MPSMYRS-TSSAYAS---------A--
A0A3N2BZR7      ----LGAIRKQWAVILILALLGAAGGYVYAQS-MPSMYRS-TSSAYAS---------A--
A0A2P8GSE2      ----IGSIRKNWLVVAVLALLGAGAGYGYAQT-MPDMYRS-TASAYAS---------T--
A0A3S4AKV9      ----IAAIRKQWIVIALLTVLGAGAGFAYAQT-MPDMYRS-TASAYAS---------T--
A0A444Q6M2      ----ITAIRKQWIVMVMLTVLGAGAGYGVAQT-MPDMYRS-TASTYAS---------T--
A0A2W1W5T8      ----ARMMRRSWLLIICAVLIGIGLGALSVRL-QDPVYRA-DTELFVA---------I--
A0A1I1EJA4      ----WRAVRNHWIGVLLLIVGTCAAGALFTAL-QTPVYAA-NAAGFVG---------T--
A0A2S9AA20      ----WSAIRKFWYVIIGMAIIGGAVGYGISAT-TTPQYQS-TATLYFA---------M--
A0A0J6DDB5      ----VLAVRKHWLWVLAPILVLTLGIGYLSER-AEPVYRA-RTALFVA---------L--
A0A0C5BB48      ----LRLLRDHWLAIVAAILLGTLFAFAWSQL-QTPRYEA-NSQGIVS---------V--
A0A3T0T1X6      ----LRLLRDHWIAIVAAVLLGTLVAYGWSLT-QKPRYAA-EAQGLVS---------A--
A0A3N1HM47      ----LRLLRDHWIALVAAVLLGTLVAYGWSLT-QKPRYAA-EAQGLVS---------A--
A0A3N1MQN7      ----LRLLRDHWIAIVAAVLLGTLVAYGWSLT-QKPRYAA-EAQGLVS---------A--
A0A3N2FLV7      ----LRLLRDHWIALVAAVLLGTLVAYGWSLT-QKPRYAA-EAQGLVS---------A--
A0A2S5XFS5      ----LRLLRDHWIPIVAAILLGTLVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A2S5XT69      ----LRLLRDHWIPIVAAILLGTLVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A2S5YDZ2      ----LRLLRDHWIPIVAAILLGTLVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A160KVA5      ----LRLLRDHWIPIVAAILLGTLVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A286H2T6      ----LRLLRDHWIPIVAAILLGTVVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A2S5XYU9      ----LRLLRDHWIPIVAAILLGTVVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A3T0SSY7      ----LRLLRDHWIPIVAAILLGTVVAFGWSLT-QKPRYVA-DSQGLVS---------V--
A0A0Q5ASZ3      ----LRLLRDHWLAIVAAILLGTLLAFGWSLT-QKPRYVA-DSQGIVS---------V--
A0A1X7P790      ----LRLLRDHWLAIVAAILLGTLVAFGWSLT-QKPRYVA-DSQGIVS---------V--
B8HEG4          ----LRILRRNWMILVACTILGLLVAAAASLA-IKPTYTA-QTRLFVA---------I--
A0A1H1CWF7      ----MRILRKRWLSVLVITVLGVAAAAAATLL-ATPQYRA-TTQLFVS---------A--
A0A3N0BZS5      ----LRALKRSWAVLLVATLLGGIVGFGYARS-SPPLYKA-SSSVFVS---------A--
A0A0Q5E5W5      ----LRIFRHRWLLIVAITAGIAALAHGYTLV-TKPVYQS-TAQLFVA---------V--
A0A1Y6EYH1      ----LRILRHRWLLIIAITAGAAALAHGYTLI-TQPVYQS-TGQLFVA---------V--
A0A1T5JTI1      ----LRILRHRWLLIIAITAGAAALAHGYTLI-TQPVYQS-TGQLFVA---------V--
A0A1S7B8B7      ----LRILRHRWLLIVAITAGAAALAHGYTLI-TQPVYQS-TGQLFVA---------V--
A0A3G8VEK9      ----LRILRHRWLLIVAITMGAAALAHGYTLI-TQPVYQS-TGQLFVA---------V--
A0A3N2C1T7      ----LRILRHRWLLIVAITAGTAALAHGYTLI-TQPVYQS-TGQLFVA---------V--
A0A399TA45      ----WTALRRRWITILLLGLVGGAAAYGYAAT-LSPSYRS-SSSVFVS---------S--
A0A154V2D9      ----WTALRRRWISILALTLVGGGAGYGYATT-LAPSYRS-TSSVFVS---------S--
A0A2S5VSE7      ----WTALRRRWITIVALGLVGGGAAYGYAST-LSPSYRS-TSSVFVS---------S--
A0A2A9CSQ3      ----LDLFRHYWKSIVIAVILGAGAGAGASYL-VTPVYGA-TAAIFLT---------V--
C5C078          ----LDALRKRWYVIALLAALFGAFGFYQATT-SVPLYRS-SSSVYVT---------L--
A0A1R1LV55      ----VRVVKRYWVLVVVAGLLGAVVAGALAMT-TRESYRA-TSSVYVS---------S--
A0A1I1HU33      ----IAALRKRWYLVAALTLVGTFFGVYQAES-AEPQYRA-TSKAFVS---------L--
A0A1G9G6G1      ----VAALRKRWYIVAVLAIIGAGAAFAQAHA-SPPQYRA-QSTVFVS---------I--
A0A1J4MWA9      ----VAALRKRWYIVAVLAIIGAGVAFAQAHA-SPPQYRA-QSTVFVS---------I--
E9V2I9          ----VAALRKRWYIVAVLAIIGAGVAFAQAHA-SPPQYRA-QSTVFVS---------I--
A0A1G6RFZ6      ----LAVARKRWPSILACALAGVVLAALASLL-TTPLYTA-RTSVFFA---------V--
A0A1C4ZLL7      ----LQFVRRQWWIVLVTVLLALGAAGWLTVR-AEPRYVA-SVTFFVT---------T--
A0A1C6SCX7      ----LQLVRRQWWIVLVTVLVALGAAGWLTVR-AEPRYVA-SVTFFVT---------T--
A0A2P8ATT4      ----LRLVRRHWWIVLVTVMVALGAAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A3A9XK63      ----LRHVRRHWWVALVTVMVALGASAFLTVR-AQPRYEA-SVTFFVT---------T--
A0A1C3N102      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A318NCD5      ----LRHVRRHWWVVLVTVMVLLGVSAFLTVR-AQPRYVA-TVTFFVT---------T--
A0A3N9XL76      ----LRHVRRHWWVALVTVMVALGVSAFVTVR-AQPRYVA-SVTFFVT---------T--
A0A1C5I042      ----LRHVRRHWWVPLVTIMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A2G6XLC8      ----LRHVRRHWWVPLVTIMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A1C4Y4C1      ----LRHVRRHWWVALVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A3N9W7A4      ----LRHVRRHWWVALVTVMVALGISAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A1C4VS21      ----LRHVRRHWWVALVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A3N9XFS0      ----LRHVRRHWWVALVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A420F753      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A1N7D4C7      ----LRHVRRHWWVALVTVMVALGVSAFLTVR-AQPRYEA-SVTFFVT---------T--
A0A3A9ZIB5      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
I0L4P4          ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A0M8XEP1      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A317CT00      ----LRHVRRHWWVVLVTFMVALGVSAFVTVR-AQPRYVA-SVTFFVT---------T--
A0A3L7B488      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A3L7BEY7      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A1C4XRD3      ----LRHVRRHWWVVLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A1N5VMM0      ----LRHVRRHWWIPLVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A3N2P6W2      ----LRALRQRWWVVLATVMVALGVAGFVTVR-ATPQYGA-SVTFFVT---------S--
A0A2N3S3T8      ----LRALRQRWWVVLATVMVALGLAGFVTVR-ATPQYAS-SVTFFVT---------S--
A0A2R4FCN3      ----LRALRQRWWVVLATVMVALGLAGFVTVR-ATPQYAS-SVTFFVT---------S--
A0A317JTD7      ----LRLIRRHWWIVLLTLVAGVGIAMAVTVR-TPPRYQA-SVTFFVT---------T--
A0A1C6SUF3      ----LRLIRRRWWIVLITLVVALATAALITVR-TTPRYVA-SVTFFVA---------S--
A0A328MVK7      ----LRHVRRHWWVALVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A328NYI0      ----LRHVRRHWWVALVTVMVALGVSAFLTVR-AQPRYVA-SVTFFVT---------T--
A0A109IIZ3      ----LRLVRRHWWIVLVTLMLTVGAAALVTVR-TPPRYMA-SVTFFVT---------A--
A0A1C5AG23      ----LRLVRRHWWIVLVTLMLTVGSAALVTVR-TAPRYVA-SVTFFVT---------A--
A0A246RHJ0      ----LRLVRRHWWIVLVTLMLTVGSAALVTVR-TAPRYVA-SVTFFVT---------A--
A0A1C4Y9N1      ----LRLIRRHWWIVLVTLMVAVGSAALITVR-TPPRYVA-SVTFFVT---------M--
A0A1C5H5Y4      ----LRLIRRHWWIVLVTLMVAIGSAALITVR-TPPRYVA-SVTFFVT---------T--
A0A1C5HF13      ----LRLIRRHWWIVLVTLMVAIGSAALITVR-TPPRYVA-SVTFFVT---------T--
A0A2W2BV95      ----LHHVRRHWWLVLLTLMVVLGVTAFITVR-AQPRYVA-SVTFFVT---------T--
A0A1H6YQS5      ----LRVVRRHWWIVLVTLIVALGVTALVTVR-AQPRYVA-SVTFFVT---------M--
A0A3A9YX36      ----LRLVRRHWWIVLLTVMVALGVTTLVTVR-AQPRYVA-SVTFFVT---------T--
A0A2W2E7U9      ----LRLVRRHWWIVLVTLMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A1I1J043      ----LRLVRRHWWIVLVTLMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A2G7D493      ----LRLVRRHWWIVLVTLMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A372FUT0      ----LRLVRQRWWIVLVTLVVALGLTALITVR-AQPRYVA-SVTFFVT---------T--
A0A418N1I2      ----LRLVRQHWWIVLVTLMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A2N7T841      ----LRLVRQHWWIVLVTVMVALGVTALITVR-AQPRYVA-SVTFFVT---------T--
A0A3S0SJN0      ----LRLVRQHWWIVLVTVMVALGVTALITVR-AQPRYVA-SVTFFVT---------T--
F4F8R2          ----LRLVRQHWWIVLVTVMVALGVTALITVR-AQPRYVA-SVTFFVT---------T--
A0A1C5HYD2      ----LRLVRQHWWIVLLTIMVALGVTAFVTVR-AEPRYVA-SVTFFVT---------T--
A0A317KP48      ----LRLVRQHWWIVLLTIMVALGVTAFVTVR-AEPRYVA-SVTFFIT---------T--
A0A1C6TUT1      ----LRLVRQHWWIVLLTVMVALGITALVTVR-AQPRYVA-SVTFFVT---------T--
A0A1C6VZN9      ----LRLVRRHWWIVLLTVMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A1C5G976      ----LRLVRRHWWIVLLTVMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A2N3YZF6      ----LRLVRRHWWIVLLTVMVALGVTALVTVR-AQPRYVA-SVTFFVT---------T--
A0A1C5JCL2      ----LRLIRRHWWIVLVTLMVALGTAALVTVR-TPPRYVA-SVTFFVT---------T--
A0A317DJW6      ----LRLIRRHWWIVLVTLMAALGTAALVTVQ-SPPRYVA-SVTFFVT---------T--
A0A1C4YLW4      ----LGLIRRHWWIVLVTLMLALGTAALVTVR-APARYQA-SVTFFVT---------T--
A0A1C6UFA3      ----LRMVRRHWWIVLITVMLALGTAALITVR-APVRYQA-SVTFFVT---------T--
A0A2T3V950      ----LRLVRRHWWIVLVTVMLAVAAAAVLTVR-AAPRYQA-SVTFFVT---------T--
A0A1C5GRE8      ----LRLVRRHWWIVLITVMLAVGTAALVTVR-TPPRYQA-TVTFFVT---------T--
A0A1A9BBH4      ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A2D1I5I3      ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A1Q5HLU3      ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A385ARQ9      ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A366L660      ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A3E1Z1H9      ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
W7VSI2          ----LRLVRRHWWIVLVTVMLALGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A1C4WAW4      ----LRLVRRHWWIVLVTVMLGLGAAALMTVR-TTPRYEA-SVTFFVT---------T--
A0A1C6S5M8      ----LRLVRRHWWIVLVTVMLGLGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A1S1WCJ8      ----LRLVRRHWWIVLVTVMLGLGTAALVTVR-TAPRYEA-SVTFFVT---------T--
D9TEP7          ----LRLVRRHWWIVLVTVMLGLGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A1C4V106      ----LRLVRRHWWIVLVTVMLGLGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A386WGZ0      ----LRLVRRHWWIVLVTVMLGLGTAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A1A8Z813      ----LQLVRRHWWIVLVTLMAALGVAAAVTVR-TAPQYRA-SVTFFVT---------T--
A0A0M2RDC0      ----LRLVRRHWWIVLVTLMAALGTAAVITVR-TAPRYEA-SVTFFVT---------T--
A0A1A8ZEN5      ----LRLIRRHWWIVLITVMLALATAALITVR-TPPRYQA-SVTFFVT---------T--
A0A1Q5CDD9      ----LRLVRRHWWIVLVTVMVAVGAAALITVR-TPPSYQG-SVTFFVT---------T--
A0A1C4UD01      ----LRLVRRHWWIVLVTVMIAVGAAALVTIR-TAPRYEA-SVTFFVT---------T--
A0A1C6TZX7      ----LRLVRRHWWIVLVTVMIALGAAALVTVR-TAPRYEA-SVTFFVT---------T--
A0A1H3PEL7      ----LLAVRQRWWLVLMTVVLALGIAGFATIR-ADPKYAT-TVTFFVT---------T--
A0A2W4J0R4      ----LLLVRQRWWIVLTTMVLAVLATGVVIYR-TPPRYAT-TVTFFVT---------T--
A0A175S221      ----VRVIRRSWLLVVALSTLGLAGGAALTLS-ATPLYSS-TTKVFVA---------V--
A0A2E0MPL1      ----ARALRRNTILILVCLAVALGGAYVLTEQ-QTPRHES-TVRVVVS---------A--
A0A0Q4M3J4      ----ARLARRSWWIVLIASAVGAGIALAISSV-VTPRYVS-TAQLYVV---------V--
A0A1E8FPE8      ----IRILGHNWILLTCLTLLGVLGAVGASIF-TKASYTA-ETQLFVA---------I--
A0A2V3DYM2      ----IRMLRRNWISVIALGLVGLLAGGTFSVL-SKPVYTA-ETQLFVA---------T--
A0A024GZV1      ----LRVLRRNWITIVACTLLGLIVAGAVSLA-LKPTYTA-QTKLFVA---------I--
A0A1G8J4X1      --------------------MGLLLAAAVSLL-RTPAYTS-QTTLFAA---------T--
A0A0Q9QYG9      ----LRVLRRNWILITACTVFGVLTAGVLSLS-VAPTYTA-QTRLFAA---------L--
A0A0L0BIN0      ----LRILRRNWLLITVCTVVGLLIGALASFM-VRPTYTA-ETKLFMA---------L--
A0A1Y3M0W1      ----LRILRRNWLLITVCAVVGLLLGAVASFA-VRPTYTA-QTKLFVA---------T--
A0A1G6GEF2      ----IAVLRKYWRSLTALVLLGVIAAATFNLL-STPIYTA-KSALFFS---------V--
A0A410YJ27      ----IRILRKSWLLIVVLMLVGVASSATFSIL-QTPKYSA-SSKVFVS---------T--
A0A251YRA5      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A251XRV8      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMFVA---------Q--
A0A0M4HAE8      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMFVA---------P--
A0A251Z704      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMFVA---------P--
A0A3D9PKF1      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMFVA---------P--
A0A225CJH5      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A399TDC3      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A251YED9      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A0D5CGA3      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A399N224      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A399NK31      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A399QBR8      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A399TPV7      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
M5BCU5          ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
B0RG57          ------MLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A1Y3F8X2      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A2S5V715      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A5CNW1          ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A067LK66      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A399NY19      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------Q--
A0A2M9BCA3      ----IRILRKSWVLIVVLVLVGIGAAAAYSIT-QTPVYSS-SAKVFVS---------T--
A0A1H3U6P2      ----VRAIRKGWVIIVVFTLLGIALAALLSII-RTPEYQS-TAKVFVS---------V--
A0A3E0VZJ6      ----LRILRKSWVLILALILLGIAAGSLVSIL-TTPSFQA-TTKVFIS---------V--
A0A3E0VEH4      ----LRVVRKGWVIIVAITLAGVAAASLISIA-EVPKYLA-SSKVFVS---------A--
A0A3E0W244      ----LRVLRKGWIIILALVLMGVALGSVFSLL-STPMYLA-SSKVFVS---------V--
A0A2S5W320      ----LRVLRKGWIIILALVLSGVAIGSVVSLL-TTPMYVA-SSKVFVS---------V--
A0A3E0WEQ4      ----LRVLRKGWIIILALTLLGVALGSLYSLA-TAPLYLA-SSKVFVS---------V--
A0A2T0YF73      ----LRIARRGWLIIVLATLAGIGAAATFSML-QSPQYEA-GTRVYVS---------T--
A0A010NGT7      ----LRIVHRGWLIIVLATLAGIGAAATFSLL-QSPQYEA-ETRVYVS---------T--
A0A0W8IE50      ----LRILHRGWLIIVLATLAGIGAAATYSLL-QSPQYEA-GTRVYVS---------T--
A0A0S9DZU4      ----VHILRRSWILIAVLLLAGIGAAAGYTFL-QDPTYSS-SAKVFVS---------T--
A0A2S5VJV3      ----IRILQKSWVLIAVLLFIGIGAAAGYSIV-QTPKYSS-SAKVFVS---------T--
A0A0Q4FGF8      ----VRVLQKSWILIAVLLFVGIGAAAGFSIL-QTPKYSS-SAKVFVS---------T--
A0A1Y6E6V4      ----ARILQKSWVLIAVLLFVGIGAAAGFSIL-QTPKYSS-SAKVFVS---------T--
A0A0S9PK66      ----LRILQKSWILIAILLLLGIAAAAAFSIL-QTPKYSS-SAKVFVS---------T--
A0A2S5W290      ----LRVLQRSWILIAGIILVSVAASATYAIV-QTPLYQA-STKVYVS---------T--
A0A3E0WAC7      ----LRVLQRSWILIAGIVLVSVAASATYAIL-QTPLYQA-STKVYVS---------T--
A0A3G8VFV2      ----LRVLRKYWVLIVALALLGVAIAATYSLV-KTPEYSS-SAKVFVS---------T--
A0A3N2C5B5      ----LRVLRKYWVLIVALALVGIGVAATYSIV-KTPEYSS-SAKVFVS---------T--
A0A0Q5EDZ4      ----LRILRKYWVLILALALTGLAASALYSLS-RTPEYSS-SAKVFVS---------T--
A0A1S7BBR9      ----LRVLRKYWVLIVALVLVGVAAAAAYSLA-KTPEYSS-SAKVFVS---------T--
A0A1T5L385      ----LRVLRKYWVLIVALVLVGVATAAAYSLA-KTPEYSS-SAKVFVS---------T--
A0A1Y6FHM1      ----LRVLRKYWVLIVALVLVGVAAAAAYSLA-KTPEYSS-SAKVFVS---------T--
A0A0Q4UQV7      ----ITVLRKGWVLILVLALVGVAAAAGYSIV-KQPEYAA-SAQVFVS---------T--
A0A1T5KAP0      ----IRILRKSWLLIVLLTLVGVAAAATFSLL-QKPMYTA-STKVFVS---------T--
A0A1V2NCT1      ----IRILRKSWLLIVLLTLVGVAAAATFSLL-QKPMYTA-STKVFVS---------T--
A0A0Q5CM05      ----ITVLRKGWILILVLALVGVALAATYSLV-KKPVFSA-TAQVFVS---------T--
A0A3N4VGE6      ----ITVLRKGWILILVLALVGVALAATYSLV-KKPVFSA-TAQVFVS---------T--
A0A420ZV92      ----ITVMRKGWVLIVILALAGVAVAAAFSVL-KKPDYSA-SAQVFVS---------T--
A0A0Q5L7K3      ----ITVLRKGWVFIVAMMLVGVGLASAYSVV-KTPDYSA-SAQVFVS---------T--
A0A0N0KVZ2      ----ITVLRKGWAFIVVMVLVGVGAAAAYSLV-KTPDYSA-SAQVFVS---------T--
A0A0Q4MAN1      ----ITVLRKGWAFIVVMVLVGVGLGAAYALI-KAPDYQA-SAQVFVS---------T--
A0A2W1YE21      ----ITVLRKGWMMILILALVGVAAAAGFSIA-KTPQYAA-SAQVFVS---------T--
A0A1S2H0H4      ----ISVLRKGWALILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A2W1VLC9      ----ISVLRKGWALILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A3N4VVK7      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A1S2HXH4      ----IAVLRKGWVFMLVLALIGVAAAAGYSLL-KQPVYSA-SAQVFVS---------T--
A0A2W1WZ29      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A3N1YB74      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A3N1NCJ6      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A2W4XST1      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A3N2GI81      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A1S2JF47      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A3N1KAQ1      ----IAVLRKGWVFILVLALVGVAAAAGFSLL-KQPVYSA-SAQVFVS---------T--
A0A0N6ZW80      ----ITVLRKSWALILVLALVGVAAAAGFSLL-KKPVYSA-EAQVFVS---------T--
A0A2A5NP89      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A1S2HTT8      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A1E5MI11      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A1C7CBL2      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A370E8G9      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1Z3Y0      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1VSB5      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A3S0VQS9      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A3N1JE86      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A0Q5RU45      ----ITVLRKGWVLILVLALVGVAAAAGFSLV-KKPVYSA-SAQVFVS---------T--
A0A1S2J0P7      ----ITVLRKGWVLILVLALVGVAAAAGFSLV-KKPVYSA-SAQVFVS---------T--
A0A2W1QTM3      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W0CPC4      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1ZIW5      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1TJR2      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1TRU9      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W0D8S5      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1QW41      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1SEK0      ----ITVLRKGWVLILVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1U4A1      ----IAVLRKGWVFILVLALVGVAAAAGFSLV-KKPVYAA-SAQVFVS---------T--
A0A2W1QMG4      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1QVP4      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1PR53      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1RMT1      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1SP47      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1TY42      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1NK02      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1TGD3      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1V3X9      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A2W1XJM0      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A022LH22      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A0Q5KMI7      ----ITVLRKGWVLIVVLALVGVAAAAGFSLL-KKPVYSA-SAQVFVS---------T--
A0A316AFM9      ----LRVLRKRWLSIVVLTALALAGAAAATLA-ATPEYQA-ETRLFVR---------A--
A0A101Y8M3      ----LRLTRANLVLLLAATLAGLLLAFGVALA-QPKIYTS-SSTGFVT---------T--
A0A3A5M3T5      ----VRLIRRSWGLISLATVLGLALAVAISML-LPRSYSA-ETRLFVA---------A--
A0A3A1U0E9      ----LRTVRRSWPVIVMVLAVFIIVGAAYTIV-QRPSYSA-SATAYVS---------V--
A0A370E5G2      ----LRLVRRGWVTLLATTLVGVAVGAVAFLT-TTPVYEA-KAQLFVA---------V--
A0A316IAU2      ----FHALRARWRWVVAGLLLGLGVAATAVLA-TIPVYQT-STQLFVS---------T--
A0A1G7JQ21      ----LTAVRRRWRWVVAASMLGLLAALVWSNG-QTPTYRS-TATVFFS---------P--
A0A0A0B6L4      ----LSILRRNWLLLVLAAVLGFVGGYGYAQT-VPPSYRA-KASVFIA---------V--
A0A1I7MGN5      ----LRILRENWLPILLITLLGLGVAAGATAL-TKPKYTA-TTQVFVA---------V--
A0A3D9L8Q2      ----IRILRNNWLSILLVTLLGVAVAAGATAL-TKPTYTA-RTQIFVA---------V--
A0A3N4YXR7      ----LGVLRKRWSTIVLIALLTLGAAVALTLA-AVPQYTA-TTRMFFA---------A--
A0A239GWK7      ----LTVLRRRIRWVLSVFVLCLVAAVVLSAF-LPRRYEA-TAELYVS---------V--
A0A2T0TUL3      ----VGAVRRRWRWVVAAVCVCLLGAVLHTQV-AAKSYRA-TAEVFFT---------L--
A0A1H0BHY1      ----LQVLRRRWIAILGVTVVGLLGGLVYAWT-APVTYQS-TAGSFFS---------L--
A0A1I5DH92      ----LHVLRRRWVQISGVTLVGLLGGLTYAWT-APVTYES-TAGAFFS---------L--
A0A3N2CYC6      ----LRIARRRWVLILLSTLTALGLAAVFTAQ-ATPQYES-TARVFIS---------T--
A0A3N1K349      ----IATIRSSWLLVVAVTAVALMTAAAVTLM-TPKTFTS-STQLFVS---------V--
U1MWX0          ----ARLLRKHWFLVIFAAVLGAAAGLLISFV-QTPSYRA-STEVFIS---------T--
A0A2V3DWA2      ----MPTLAKRWYVVLVAVAVAALAAFALSFT-VTPVYTS-STTLFFS---------LR-
A0A1I2T4Q4      ----VTVVTRRWITVLVCALLGLACAIGYAGI-RPQEYQS-SVTLTVS---------TT-
A0A3S4VIP4      ---------------MVATFVAVLGAVAVTLL-TTPLYQA-STRLFVS---------TT-
A0A1A1YNQ5      ----LRAMRARWLIIVATAAVAVAATVFYNIL-TTPLYES-STRLFVS---------TS-
A0A1H6IEM3      ----IKLLRNRWMLICATTAIAVLIAVAISLL-TTPLYQA-TTRLFVS---------TT-
A0A1X0H5J5      ----VKSLRARWIVVSVATVIGVLAAVAVTML-TTPLYQA-STRLFVS---------TT-
A0A1X0D907      ----AKLLRTRWLIICVTVAIAVLGAVVVNLL-TTPLYEA-STRLFVS---------TT-
A0A1J0UA55      ----AKLLRTRWITVCVTTLAVVLGAVLYTLL-TTPLYQA-STRLFVS---------AS-
A0A2T5WJZ2      ----AKLLRTRWITVCVTTLVAVLGAVAYTFA-TTPQYQA-STRLFVS---------TS-
A0A1Q4TN14      ----VKLLRNRWITVCVTVVLAVSTALAVSLL-TTPLYQA-STRLFVS---------TN-
A0A370CY70      ----VKLLRARWVTVCVTMVAAVLAAVTVTLL-TTPLYQA-STRLFVS---------AG-
A0A1M9PW13      ----GKVLRSRWLIVVTTMLVALLAAIASTLY-TTPLYQA-STRLFVS---------TS-
W9B9R2          ------MLRTRWVTICLTTVAIVAAAVALTLL-TTPLYQA-STRLFVS---------TT-
A0A2N6TZR1      ----LAILRDRWISALVTFLLVLGAVVGFTLM-QTPTYQA-TNRLFVQ---------TQ-
A0A1H9TXR1      ----LKIVRRYWLILVTGLILGVLVALGLSLV-QPKVYSA-NSSGFVT---------TAS
A0A261G556      ----ARMLRKHIATAIVVFVIVVVGVCAYTFL-APKQYTA-EAQMFAT---------YS-
A0A1H9RLP3      ----LRVARAYWRGIVAFVLLGVAVAAGVSLV-TPKVYQA-DASGFVS---------AG-
A0A1G5PJ37      ----WKVLRAHWISVIAITVLGGIVAFGWTLT-QTKVFSA-DASGIIS---------VG-
A0A221NN83      ----WKVLRAHWISVIAITVLGGIVAFGWTLT-QTKVFSA-DASGIIS---------VG-
A0A2S5W4G9      ----WKALRKRWIVIAILGVIGGGVAYTYAES-LPDSFTA-TSEIFVS---------ST-
A0A2T5W3Y2      ----LRTLRRRWKTIVAITLIAMAGSLFLSLR-TDPLYQS-TAKVYVS------------
A0A3A5H3V1      ----FRTLRRRWKTIVALALIATFGSLALSLT-TTPTYES-KTKIYVT------------
A0A1I6KI27      ----LRGIRRHFLAILIMTAVGVGVAYAWTLV-QNPVYEA-SADGIIQ---------AQ-
A0A316B618      ----FRLLRDHWIPIIAAILLGTLVAFGWASL-QSKQFVA-DSQGLVS---------VAT
A0A3Q9V497      ----FRLLRDHWIPIIAAILLGTLVAFGWASL-QSKQFVA-DSQGLVS---------VAT
A0A0Q5BQW6      ------------MPIVAAILLGTLVAFGWSLT-QKPRYEA-DSKGLVT---------VAV
A0A1V2ZB83      ----LRLLRDHWLPIVAAILLGTLVAFGWSLT-QKPRYEA-DSKGLVT---------VTV
A0A2T4UY28      ----LRLLRDHWLPIVAAILLGTLVAFGWSLT-QKPRYVA-DSKGLVT---------VAV
A0A1H6YS68      ----LHVFRTRWIAIVVITVLTGILAGAWTLT-QDKVFTA-TGSAIIT------------
A0A1V2NL87      ----WRIARTGWWMILLGILLGVLAAAGWVSL-QKPVYTA-DAGGFVS----------A-
A0A259SEX1      ----LRVFRAHWLGMVLITLLGVAVAFGWTLL-QPKVYTA-DASAIVQ----------AN
A0A0F0LD75      ----LRVFRAHWLGMVLITLLGVAVAFGWTLL-QPKVYTA-DASAIVQ----------AN
A0A2S9A622      ----LRVFRAHWLGMVLITLLGVAVAFGWTLL-QPKVYTA-DASAIVQ----------AN
A0A0P0DHN7      ----LRIFRAHWLGIILLTLAGVVLAYGWTMF-QPRVYTA-DSTAIIQ----------AR
A0A2M9C550      ----LRIFRAHWLGIVLLTVLGVATAAGWTLL-QPKVYTA-DASGYVS----------SA
A0A3B0B6M9      ----ARILRAHWVVVVVATVVGALAAFGWSSL-QPRVYSA-DTTGIVT----------S-
A0A2N3GRB2      ----IRILRAHWIVILIATVVGAGAAFGWSAL-QPKVYSA-DTTGIVT----------S-
A0A0F0L851      ----FRILRAHWIVILVATVLGAGAAFGWSAL-QPRVYAA-DTTGIVT----------A-
A0A2T7X0Z6      ----VRILRAHWIVIVVVTALCGGVAFGWSAM-QPRVYSA-DTTGIVT----------A-
A0A2S9BKI0      ----ARILRAHWIVIVAATLVGAALAFGWSSL-QPRVYSA-DTTGIVT----------A-
A0A0F2C8N7      ----ARILRAHWIVIIVATIVGAAAAFGWSAL-QPRVYSA-DTTGIVT----------S-
A0A2T7X614      ----VRILRAHWIVIIVATIIGAAAAFGWSAI-QPRVYSA-DTTGIVT----------A-
A0A1P8UAU0      ----LRILRAHWLGIVLLTLLGAAVAFGYSAL-QPRVYTA-SASGIVQ----------A-
A0A0S9QI77      ----LRILRAHWLAIVILTLLGVAVAWGWTAL-QPKVYTA-NASGIVT----------A-
A0A3D9U3N3      ----LRILRAHWLAVVALTLLGVAVAWGWTAL-QPKVYTA-HASGIVT----------A-
A0A1H1F4A6      ----LRILRAHWIALSLCVVLGVVVAFAWTLV-QPKVYTA-DASGYVT----------PV
A0A246E2W5      ----LRILRAHWIALSLCLILGVVVAFAWTLI-QPKVYTA-DASGYVT----------PV
U2XQ67          ----LRILRAHWIALSLCLILGVVVAFAWTLI-QPKVYTA-DASGYVT----------PV
A0A171DSR6      ----LRVFRAHWLGMLLLVVAAVAIAFGWTLL-QPRVYTA-DATAIVQ----------A-
A0A1Q3L510      ----LRIFRAHWLGMLAVIVGAVVLAFGWTLT-QPKVYTA-DSTAIVQ----------A-
A0A2T4UC78      ----YAVVRRNAAIILFTIGLAVGTSVALSAA-TDPVYEA-RSAVAFN---------DN-
A0A1H8W5Q2      ----GLVLRRGWWLILAGIVLGVGGGGAICFL-MTPTYES-TTQFFVA---------TP-
A0A172X5A6      ----LALFRHFWYVVVAGALIGALAGWGVSQL-ATRMYTS-TTSMYFS---------LS-
A0A1M3LQG0      ----LALFRHFWYVVVIGALVGAVAGWGLSQL-STREYTS-TTSMYFS---------LS-
A0A0A0CCR1      ----LAIVRKRWISIALITVLLTGAAVAVTLA-TTPVYTA-RAQVYVS---------VR-
A0A1I2GS79      ----VAILRKRWVSILLITLACVGAAVGATML-MTPTYEA-RAQVYVS---------VR-
A0A0A0C0L9      ----ITVVRKRWIWIALGLVLGAAAALGASVV-ATPIYTA-QSQVFVS---------VR-
A0A2A9E2B7      ----LAVLRKRWITIALVTALGIAVGAAATLL-ATPTYKA-RSQVFVS---------VM-
A0A2N3YKR1      ----VRIARRFWSTIAICVAAALAVAGAYAAT-QPRLYSA-SSEAYVQ---------IG-
A0A2N6R2X5      ----LRVLRDHWLIVVGCVALGVLLASLWTLT-QPRTYQS-HASAVVT---------AG-
A0A1G6GCY6      ----LAIIRARWITIVLTLLLVLAATVVTTLR-IPPTYQA-SARVFLA---------AS-
A0A1H0IIE3      ----VAALRKLWWAIVLVTVVGAGTGAYLAYR-QTPMYAT-TVTFFAT---------TQ-
A0A1C9WMD3      ----LRIARARWKGILAFTLALTVLAFCWTLL-QPKIYAA-QSSGIVV---------AG-
A0A1H0R6Z9      ----LRIARARWKGILAFTLIFTVLAFCWTLL-QPKIYAA-QSSGIVV---------AG-
A0A1H1Z766      ----LRGLRRHWLAITLMTLLGVGTAYGWSLL-QTPVYEA-TASGVVQ---------AK-
A0A0Q9J8J7      ----LRGLRRHWIAILLMTLLGIGAGYGWTLL-QTPVYTA-GASGYVV---------SK-
A0A3M8AFW0      ----LRGLRRHWIAILLMTMLGAAAGYGWTML-QTPVYVA-SASGLVQ---------ST-
A0A1H6FXV2      ----SRALRAHAFLIAVITLLVLAAALGWRLL-RPPTYEA-HAQLLVT---------PV-
A0A1Q9VQM7      ----MTLLRKRWLSVAVLTALGVLGGVVASLA-TTPTYEA-RSQVFVS---------VQ-
A0A101LA70      ----WKVLRAHWVSVIAITLVGGIAAFGWTLT-QTKVYSA-DASGIIS---------VG-
A0A1H4T2N1      ----WKILRAHWVSVLGITVLGVLVAFGWSLL-QPKVYSA-DASGIIS---------VG-
A0A2A9CZH9      ----VRVLRRHWLALVICSLAGVAISMAYTLV-QTPVYSA-NASGYVS---------AG-
A0A101LAM5      ----LSVVRSHWLGILFITVLMVGGSLGWYAL-QPKVYSA-ESSGIVV---------AA-
A1RC29          ----LSVVRSHWLGILLITVLMVGGSLGWYVL-QPKVYAA-ESSGIVV---------TA-
A0A0F0KYQ2      ----GRLVRRHWGAIALSIGLGLAVAFGVSAL-MPKVYTA-DASGFVV---------SQ-
A0A1I6JEQ9      ----GRLVRRHWGAIALSIGLGLAVAFGVSVL-IPKVYTA-DASGFVV---------SQ-
M7MWW7          ----LRTFRTFWRSITSIVLVAVICAFGWTLT-QQPLYSA-SASGLVI---------AT-
A0A373DJ45      ----WKILRAHWLGIISITLVGALLGLGWALL-QPKVYTA-NASGIVS---------AG-
A0A077MB29      ----LRIARLHYKAILTFIALGLLTAWLVTLF-TPRVYAA-TASGMVR---------SG-
A0A0V8IVB9      ----LGIFRTYWKAIVSLTLLATLAAMGWTVL-QPKIYSS-DSSGIVT---------TP-
L8TVZ5          ----LRVIRAYWKGIVALTLLATLSALGWTVL-QPKIYSS-DSSGIVV---------TP-
A0A0Q9MJT3      ----LNVLRVYWKAIVAFTLLTTLGAAGWTAL-QPKIYSS-DSSGIVV---------TP-
A0A0B4D7W4      ----LAILRVYWKAIVAFTLLATLAAAGWTVL-QPKVYSS-DSSGIVV---------TP-
A0A2J8IA21      ----LRMLRIYWKAIVAFALLATLTAGGWTIL-QPKIYSS-DSSGIVV---------TP-
A0A371BP35      ----VRVLRVYWRAIVASTLLTTLAAVGWTVL-QPKIYSS-DSSGIVV---------TP-
A0A0Q5HN28      ----LLVVRTYWKGIVSLTLLATMAAMGWTVL-QPKVYAS-DSSGIVV---------TP-
B8HEH1          ----LQVLRTYWKGIVSLTLLATMAAMGWTIL-QPKVYAS-HSIGIVV---------TP-
A0A0Q5MS06      ----LRVVRTYWKAIVAFTLLATLTAFGWTVL-QPKIYSS-DSSGIVV---------TP-
A0A2J8GH16      ----LRLLRVYWKAIVAFTLLATLAAFGWTVL-QPKIYAS-ESSGIVV---------TP-
H0QNF6          ----LRLLRVYWKAIVAFTLLATLLAFGWTVL-QPKIYAS-ESSGIVV---------TP-
A0A0D1C095      ----LRVVRVYWKAIVAFTLLATLTAFGWTVL-QPKIYSS-DSSGIVV---------TP-
A0JZX7          ----LRVVRVYWKAIVAFTLLATLTAFGWTVL-QPKIYSS-DSSGIVV---------TP-
A0A1W1ZPI5      ----VSVVTSRWRIIVACVVVAMAVAGVTTYL-TTPVYTA-QATVYLS---------VE-
A0A0Q9K847      ----LNVLRARWKLIAACVVLAVLAATALTLL-TTPVYEA-RARIYLS---------AE-
A0A1L3MI59      ----LAVIRQRWRLIAACVVLAVAAAVAVTLT-TTPVYEA-RARIYMS---------AE-
A0A0Q8Y2V9      ----LGVLGARWRIIAVSLLAVVAATAVQTML-TPAVYTS-SSKIYLR---------AT-
E6SEU3          ----VGVIRTRWRLIALCVLVVIGATAASTLM-TTPVYEA-TARVYLS---------TV-
W9G9N4          ----LSVLRARWRLVAASLLVVLAGTALSTMA-TTPVYEA-VAKVYLS---------TQ-
H6N1H1          ----GSVFRRGWWLVALISAVSCVGALLFSLA-SERIYES-SVSLYVT---------AA-
D2Q672          ----LRAIKKHWIVEIVLFCAVVGVVAGKTFT-TTPVYTA-STEILAQ---------YS-
E0Q4N9          ----LRAIKKHWIVEIVLFCAVVGVVAGKTFT-TTPVYTA-STEILAQ---------YS-
W2VB67          ----LRAIKKHWIVEIVLFCAVVGVVAGKTFT-TTPVYTA-STEILAQ---------YS-
A0A1V4PL64      GSFGLRAIIGGWWIVVCGGLFGAVVGLAVCIL-QSPVYEA-SSTLYVT---------SG-
A0A1H1WZJ3      ----LRIARRRWLLILGTLLATTAIAAVITVN-TTKQYSS-TSRVFIS---------TS-
A0A2A9CNJ0      ----LRILLRRWPWLIIPPLMFAVAVGAYSIS-QPKVYAA-KASSYFS---------FQ-
W2EP80          ----IRLVRRNWKLVPFMLALAVGAASVVTAR-TPPTYAA-TVAMLVS---------AH-
A0A1I3XXQ0      ----IRLARRNWLLIVFSLFLAAATATVVTAG-TPPKYVA-TITMLVS---------GH-
A0A1V4EHL7      ----VRLIRRNWLLLLLSLITGVTAALVITAN-TPPKYVS-TISMLVS---------GD-
D2B1Z9          ----VRLVRRNWLFILLALIISVATALVVTEN-TPPKYVA-STSMLIS---------GQ-
A0A1H7FB36      ----AQFIRRNWSVLLISLVIGAGAAALVTAN-TPPKYVA-TISMLVS---------GQ-
A0A239CM55      ----ARLARRNWLLILFSLVLAVSTSLIVTAR-MPTKYVA-TISMLVS---------GY-
A0A290XKY6      ----FRALWRGWYVVVICTLVGMILGLIGSLL-ATPVYQA-TSTLYVS---------SS-
A0A181Z7W1      ----ITVLRKGWVLILVLALVGVAAAAGFSVL-KQPVYSA-SAQVFVS---------TQ-
A0A161GBQ2      ----AAALRARWLVIVATTIVGTLIAVVFSLV-STPMYQS-TTQFFVT---------TT-
A0A260AZ98      ----AAALRARWLVIVATTIVGTLIAVVFSLV-STPMYQS-TTQFFVT---------TT-
A0A260IVX0      ----AAALRARWLVIAATTIVGTLIAVVISLV-STPMYQS-TTQFFVT---------TT-
A0A260PX50      ----AAALRARWLTIVATTIVGTTAAVLFSLL-STPAYQA-TTRFFVS---------TT-
A0A260R8K0      ----AAALKARWLIIVATTIVGTTAAVLFSLL-STPAYQA-TTRFFVS---------TT-
A0A251YLS3      ----IRMLRRGAVLIILTLLVGVGAAAAFSLL-QTPEYEA-STKMYVA---------QS-
A0A1H1F0B0      ----IRILRRNIVLIIATTLIGLAAGAASALV-TPPRYDA-STQLFVA---------TQ-
A0A246E4S9      ----IRILRRNIVLIIATTLIGIAAGAASALL-TPPRYDA-TTQLFVA---------TQ-
U2YPH0          ----IRILRRNIVLIIATTLIGIAAGAASALL-TPPRYDA-TTQLFVA---------TQ-
A0A1H4ND50      ----IRILHKNWMLIVACVLVGVAVAAAYSMM-TSSKYQT-TTQLYVS---------VQ-
E8NF39          ----LRILHRNWILVLSLTILGGAGAFGWSLL-QTPTYET-STELYVS---------VR-
A0A0Q6E734      ----LRILHRNWILILAMTILGGAGAFGYSLL-QTPTYEA-SSQLYVS---------VR-
A0A147F0T8      ----LRILHRNWILILAMTILGGAGAFGYSLL-QTPTYEA-SSQLYVS---------VR-
A0A0Q5PNV8      ----LRILHRNWILILALTILGGAGAFGYSLL-QTPSYEA-NTQLYVS---------VR-
A0A147F4Z2      ----LRILHRNWILILALTVLGGAGAFGYSLL-QTPTYEA-NTQLYVS---------VR-
A0A2W1UD60      ----VRILRKSWLLITATALLGILSGGALAAA-ATPAYTA-ATRLYVS---------VR-
A0A0Q5CBC0      ----IRIVRRRWATIVVVTLVAVSCAAAYTIT-ATKTYVA-STQLFVS---------VQ-
A0A3N4VMC7      ----IRIVRRRWATIVVVTLVAVSCAAAYTIT-ATKTYVA-STQLFVS---------VQ-
A0A3B0B4T8      ----VRILHRNWILILILLILGLAGGAGYAAM-QEPKYVA-STQMYVS---------VR-
A0A181Z8L4      ----ARALLSGWWIVLAVSIAGGGVALVVTST-TPPTFRA-STSYYVS---------VA-
A0A3N1JFL7      ----ARAVLAGWWIVMATTALGAGAALLVTNA-TTPVYRA-STSFYVS---------VT-
A0A3N2GHT0      ----IRALLSGWWIIAGATLIGAGASLVVTTI-TPPTYQS-STSYYVS---------VA-
A0A2W0ECB7      ----IRALVSGWWIIAGATLLGAGLSLVVTSI-TPPTYQA-STSYYVS---------VA-
A0A2W1Q3Z9      ----IRALLSGWWIIAGATLLGAGASLVVTSI-TPPTYEA-STSYYVS---------VA-
A0A2W1X3D9      ----IRALISGWWIIAGATLLGAGASLVVTNV-TPPTYEA-STSYYVS---------VA-
A0A2W1U2M0      ----IRALLSGWWIIAGATLLGAGASLVVTNV-TPPTYEA-STSYYVS---------VA-
A0A2W1QM99      ----IRALLSGWWIIAGATLLGAGASLVVTSV-TPPTYEA-STSYYVS---------VA-
A0A2W1PJ22      ----IRALLSGWWIIAGATLLGAGASLVVTSV-TPPTYEA-STSYYVS---------VA-
A0A2W1RBH1      ----IRALLSGWWIIAGATLLGAGASLVVTSV-TPPTYEA-STSYYVS---------VA-
A0A2S3Z6L3      ----LRIFHKSWILILALTLVGVAAAAGAAIA-TTPTYVA-STQLYVS---------VK-
A0A3N2AT99      ----LRVVRKNVILLLALMLAGVGVGALIATV-QQPSYSA-QTQVFVS---------TQ-
A0A1I6LA98      ----IRIIRKYWVLLVAATLVGVGVGAVASLV-QTPTYSA-STQVFVS---------VQ-
A0A3S3M2W8      ----IRIIRKYWVLLVAATLVGLGAGAIVSLM-QTPIYSS-STQVFVS---------VQ-
A0A147DUP0      ----FRALLSRWYIVVAGILLGCVAAMALSAT-VTPQYRA-TTKLWVS---------VG-
A0A1C7C3G8      ----LKALLSRWYIVVAGILLGCAAAMALSAT-VTPQYRA-TTKLWVS---------VG-
A0A2T0V3B1      ----VRILRKRWLAIVAAVLLGVAVAAAATLV-STPRYEA-NTLVYVQ---------VQ-
A0A0B2AI85      ----IRILRTGWVLVVVMALIGVAAASVFSIL-SKPQFKA-SAQVFVS---------TQ-
A0A3L7IX11      ----VRILRRSWAVLLLATLLGVSAGAGYSLL-DPPRYSA-SSKVFVS---------TS-
A0A3S4BC26      ----IRILRKSWILITVLTLLGIAAAAAYSLL-QTPQYSA-TSKVFVS---------TQ-
A0A444QGJ0      ----IRILRKSWILITVMTLLGIAAAAAYSLL-QTPQYSA-TSKVFVS---------TQ-
A0A1H0AWP0      ----IRMLRKSWVLIVLCTLVAVGAASALSIL-QTPQYSA-TSKVFVS---------IQ-
A0A1H8A6U6      ----IRILRKSWVLIVLCTLVAVGAASAYSIL-QTPQYSA-TSKVFVS---------TQ-
A0A1I2YEQ7      ----IRILRKSWVLIVLCTLVAVGAASTYSIL-QTPQYSA-TSKVVTL---------TQ-
A0A3A5MNU5      ----IRILRKSWVLIVLLALVGVGASAGYSLY-QTPMYSA-TSKVFVS---------TQ-
A0A3A5N2D6      ----IRILRKSWVLIVVLTLGFVGAASVYSLL-QTPTYSA-TSKVFVS---------TQ-
A0A086DVZ0      ----IRILRKSWVLILLLTLVAVAGASVFSIV-QTPKYSA-TSKVFVS---------TQ-
A0A086DVG5      ----IRILRKSWVLIVLLTLVAVGAASTYSIL-QTPTFSA-TAKVFVS---------TQ-
A0A099JUC4      ----IRILRKSWVLIVLLTLVAVGAASTFSIL-QTPQYSA-TSKVFVS---------TQ-
A0A1H0AW68      ----IRILRKSWLLIVALTLVAVAAASVFSIT-TTPKFSA-ISKVFVS---------TQ-
A0A1H8A5X8      ----IRILQKSWMLIVALTLVAVAAASVFSIL-QTPTFSA-TSKVFVS---------TQ-
A0A1I2YE61      ----IRILQKSWMLIVALTLVAVAAASVFSIL-QTPTFSA-TSRVFVS---------TQ-
A0A1T4WXV8      ----IRILRKSWVLIAVLLFVGIGAAAGYSIL-QTPTYSS-SAKVFVS---------TS-
A0A1X7IN36      ----IRIFQKSWVLIAVFLFLGIGAAAGYSII-QTPKYSS-SAKVFVS---------TS-
A0A0S9E1G2      ----IRILQKSWILIAIVLLLGVGAAAAYSIL-QTPKYSS-SAKVFVS---------TS-
A0A165S8K4      ----LRILRGSWVLISVLALLGIGAGAAYSIV-TTPKFSS-SAKVFVS---------TS-
A0A1I6IZH2      ----IRILRQSWVLIALLTLLGVAAGAVFSIM-QTPLYSS-SAKVFVS---------TS-
A0A0Q4HBI5      ----IRILRQSWVLIVLLTLFGVAAGAVFSIL-QTPMYSS-SAKVFVS---------TS-
A0A3D9PSJ4      ----IRILRQSWVLIVLLTLFGVAAGAVFSIM-QTPLYSS-SAKVFVS---------TS-
A0A3E0VZK6      ----IRIIRKGWILVVVCALIGIGAGAAAAIL-TTPQYQA-TTTMYVS---------VQ-
A0A3E0VEK0      ----IRVIRKGWVLIVVFALLGLAAGAALAIL-ATPQYRS-TATMYVS---------VA-
A0A2S5W2I0      ----FRVIRKGWVFIVVFALLGIGAGAALAIA-ATPQYRT-TTTMYVS---------VA-
A0A3E0W3A0      ----FRVIRKGWVFIVIFALLGIGAGAALAII-ATPQYRT-TTTMYVS---------VA-
A0A3N1QGT9      ----IRLLRRSWMLILTATLLGLLSGSLLSLL-ATKTYES-TTTLYVS---------VQ-
A0A0Q4UN39      ----AHVLRKNLLLLIATTLVGMGAAGGIAAA-QTPTFTA-TTELYVS---------VR-
A0A3N2IBU5      ----LTAVRRHVVLVLVGVLLGTTFGAVASAA-SVPLYSS-TTTLFVS---------VG-
A0A0Q5N0H1      ----LGALRRSALLVVAITLVGIALGAAAVAM-TAPLYTS-STLLFVS---------VR-
A0A0Q5SIU7      ----FRALLAGWYLLLIGLVVGGGAGVAISAS-ATPTYVS-STKLFVA---------VR-
A0A1S2I9A7      ----LRALLASWLLVVVGLLAGGGVGYAVSAV-ATPTYVS-SAKIFVA---------VR-
A0A0Q4LKJ5      ----VAVVRSSWQLIVVLAIGAVLVGAVASLL-TTKTYSS-RTQLFVS---------VS-
A0A3N2HI53      ----ITVVRARWRLIVVVTLSTVLLGSIASLT-TTRSYSS-STQLFVS---------VS-
A0A0Q4TNQ0      ----ITVVRTRWVLIVVVTLSAVLLGATASLA-TAKSYSS-STQLFVS---------VS-
A0A0Q6B7E9      ----ITVVRTRWVLIVVVTLSAVLLGATASLA-TAKSYSS-STQLFVS---------VS-
A0A3N2HXF6      ----ITVVRTRWVLIVVVTLSAVLLGATASLA-TAKSYAS-STQLFVS---------VS-
                                                                            

A0A316JEM7      -----SLDT--------------PEAANTRNLSGI-------QESVVLD------EG--Q
A0A0B2BP84      -----N-DN--------------TSQALTQTQTGA-------MINSGPQ------QA--P
A0A2W6BNW8      -----PSDA--------------SVLTQSGVVATD-------QSGGLLN------NQ--S
A0A399VFU7      -------DA--------------TGFIKTGGDLNP-------NSGDVYA------KS--R
A0A0Q7MSV5      -------EQ--------------AGSTVGESLQGS-------TYA----------QN--R
A0A0B2BPU3      -------DN--------------TGSPDSL--LGS-------VSSLFDA------KI--Q
A0A2T7V028      -------RE--------------ADKVTNIPGVDR-------EASVAD-------QE--F
A0A2A9EEP9      -------VQ--------------GSTSTSELLQGS-------NFA----------QN--R
A0A372J6J7      -------LQ--------------NGNTASDLAQGA-------TFT----------RA--Q
A0A0B2BAQ1      -------DS--------------PDTSAAKSLLGD-------VSALFDV------KS--S
A0A1Q7LXJ6      -------YP--------------RRALTVG--VED-------LPAKDQR------SD--P
A0A2T7VFI1      -------PH--------------PAEIGSE--RTS-------ALSDPAA------DS--S
A0A1S1CQC5      -------GE---------------SGTVDVLS-GS-------T----AA------KE--R
A0A1E9T6I0      -------GE---------------SGTVDVLS-GS-------T----AA------KE--R
A0A1F1GHA7      -------GE---------------SGTVDVLS-GS-------T----AA------KE--R
A0A1Y1RLX5      -------GE--------------GAGIGDVIS-GS-------A----AA------KE--K
A0A1U4M0Y5      -------GE--------------DSGITDVIS-GS-------V----AA------KE--K
A0A3D3LZQ2      -------GE--------------GSGINDVIS-GS-------V----AA------KE--K
A0A176UCN8      G----------------------TDNVSSLLA-GD-------T----LA------KA--R
A0A3D1Z248      SEPAAADRP-----------------LAESYQ-AV-------L----IS------ER--L
A0A0A0UDT2      TASADASTA----------------QSSSAAA-SS-------A------------AA--Q
A0A0S2MGZ8      TASADASTA----------------QSSSAAA-SS-------A------------AA--Q
A0A151C7E4      TASADASTA----------------QSSSAAA-SS-------A------------AA--Q
A0A1X2YST6      TASADASTA----------------QSSSAAA-SS-------A------------AA--Q
A0A1X2ZYS4      TASADASTA----------------QSSSAAA-SS-------A------------AA--Q
I3BG34          TASADASTA----------------QSSSAAA-SS-------A------------AA--Q
A0A229W018      SDGA----------------------MTTGAA-SG-------T------------AS--P
A0A430FEG8      SDGA----------------------MTTGAA-SG-------T------------AS--P
A0A087CXM2      NTS--TADA------------TQDNNYGSINS-AG-------T----YI------AN--Q
A0A1Q6F212      SDS--SV---------------QDNNISNINS-AS-------T----YI------TN--Q
C0BRP2          SDS--SV---------------QDNNISNINS-AS-------T----YI------TN--Q
A0A3C0AT24      SEA--SV----------------DNNISNINS-AS-------T----YI------TN--Q
A0A3D0PUZ0      SEA--SV----------------DNNISNINS-AS-------T----YI------TN--Q
A0A086ZSZ1      NQT--VA---------------NSEDISSVNN-AS-------S----YI------SN--Q
A0A087BBC7      SDT--SN---------------VNENYSSLGS-AA-------S----YI------ST--Q
A0A087BEY8      SDT--ST---------------ADDNYSSLGS-AA-------S----YI------ST--Q
A0A2N3QE62      SDD--SG----------------DANYTNINN-VG-------S----YI------NN--Q
A0A2N3QZ25      DSS--SS----------------SLNSAEQNS-AN-------S----YI------MS--Q
A0A1C7FTC7      NSS--ND----------------SANSSEQYS-GS-------S----YI------MS--Q
A0A315S2E9      NSS--ND----------------SANSSEQYS-GS-------S----YI------MS--Q
B8DWQ4          NSS--ND----------------SANSSEQYS-GS-------S----YI------MS--Q
A0A087B589      NDA--SG---------------SQANMSEQNN-GS-------S----YI------MS--Q
A0A2N3R436      NDE--SD----------------TTNSAEQNS-GS-------S----YI------MS--Q
A0A395XCD7      NDE--SD----------------TTNSAEQNS-GS-------S----YI------MS--Q
A0A3A9A6J6      NDS--SD---------------GTANSSEQNS-GS-------S----YI------MS--Q
A0A0A7I958      NDS--SE---------------GAANSSEQNS-GS-------S----YI------MG--Q
A0A248X5N3      NDS--SD---------------GTANSSEQNN-GS-------S----YI------MG--Q
A0A2A2EI34      NDS--SE---------------GSANSSEQNN-GS-------S----YI------MS--Q
A0A430F4X9      NDA--SD---------------GTANSSEQNN-GS-------S----YI------MS--Q
A0A2A2EMB5      NDA--SD---------------GAANSSEQNS-GS-------S----YI------MS--Q
A0A2N5IVW1      SDS--SD---------------GAANSSEQNS-GS-------S----YI------MS--Q
A0A087ADW7      NDS--SD---------------GTANSSEQNS-GS-------S----YI------MS--Q
A0A2D3D401      NDS--SD---------------GTANSSEQNS-GS-------S----YI------MS--Q
A0A126SX27      NAA--QDGG------------N-SDDITQQNT-GG-------T----YV------SN--Q
A0A413KCG4      N-----ASQ------------GDDAGISQQYT-GG-------T----YI------AG--Q
A0A1V8PLX8      N-----ASQ------------GDDAGISQQYT-GG-------T----YI------AG--Q
A0A2G5PT07      N-----ASQ------------GDDAGISQQYT-GG-------T----YI------AG--Q
A0A415BXP4      N-----ASQ------------D-GESISQQST-GG-------T----YI------SN--Q
A7A7K6          N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A1X2ZA33      N-----ASD------------G-GESIAQQST-GG-------S----YI------SN--Q
A0A0C2V870      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A1X2YSY1      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--R
A0A0B5BIW6      N-----ASD------------G-GESIAQQST-GG-------S----YI------SN--Q
A0A1X2ZAM7      N-----ASQ------------N-GVDINQQST-GG-------S----YI------SN--Q
A0A1X3A4T4      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A087DNN8      N-----ASD------------G-GESIAQQST-GG-------S----YI------SN--Q
A0A1X2ZG21      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A415AYL8      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A076JNF6      N-----ASD------------G-GESIAQQST-GG-------S----YI------SN--Q
R5H175          N-----ASD------------G-GESIAQQST-GG-------S----YI------SN--Q
A0A174A3G1      N-----ASD------------G-GESIAQQST-GG-------S----YI------SN--Q
A0A174BGC0      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A1X2YTE2      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A1X3A989      N-----ASQ------------N-GVDINQQSA-GG-------S----YI------SN--Q
A0A0G9MCI5      N-----ASQ-------