BYKdb

Dataset for cluster cd of phylum all

[Download (right click)] [Edit] [Sequences] [Repertoires]

517 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      ------------------------------------------------------------
B7BDT8      ------------------------------------------------------------
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
E7T801      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      --------ELIKSRALLGKVVDDLKLNTLQTPDFFPVIGPYLYRTFKPVRDGELAKPLFG
A3K8W7      MNMMDSRKFRRKRKPLTTETPSPQEDASKDMAPVPPL----------ETREERLARRARE
G7EJX6      ------------------MLLSPEEQAAQQMLSLVAVFNAKL--SIEPVRSTQLVKISFE
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      ------------------------------------------------------------
B7BDT8      ------------------------------------------------------------
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
E7T801      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      LTQ--------YAWGGEKIEVFQLEVPEHLLGEKLTLIAGKPGQFSLYDNEHNLLLGGTI
A3K8W7      EGEGQTRPDPDAARQARAREAARIAAAAARQKAEAESKAQADAQRRAEEQAHDEAEAEAQ
G7EJX6      SSD------------------PKLAALVANTVGEVYIESQMRAKMGITQQASNWLNTRLS
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      --------------------------------MTILDFVRTTRANLVLLILGIIIGALLG
B7BDT8      ------------------------------------------------NQIAVSTSAFIS
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
E7T801      -------------------------------------MQETFTVSERSKESGMLELTMTG
F4SM97      -------------------------------------MQESFSVTDQGKDTGILTLTLRG
G5Q4J0      -------------------------MSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTG
G5LQM6      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
G5SDT8      ---------------------------------MINNLQNNLTVTETGKDTGVLSLTFTG
F3CAY9      NRIVEGNGVKIQVAALRARPGTDFSVSRQRTLSTALVYQNRLKIAEAGRDSGIIYLSIED
A3K8W7      RQAEEQARAKAEAEAQRQAEEQAHAEAEAEAQRRAEEQARAEAEAEAQRQA---------
G7EJX6      QLRIQLDTSEQKLQAYREAQKLVDIEGIAGLVTQELEQMSQQLVVARNEKN---------
B7B947      ------------------------------------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      --------------------------------MSFFKKQSSVGKYGLSVETMAKG-----
I0UTA5      VGYSLTQPKVYAASASGYVTIGSGGTIDVLSGSSAAKDRARSYSAIVSSEAVAKIIQEKN
B7BDT8      DRLGVIEQELGNVDENISSYKSEHLLPDVQAAASMYMEQSSATNAQILALNTQLSMARYI
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------------------------------
Q04DV8      ------------------------------------------------------------
E7T801      DDPQLITRILNSIANNYLQQNIARQAAQDSQSLEFLQRQLPEVRSELDQAEEKLNVYRQQ
F4SM97      EDPKHLEQVLDSISDNYLAQNIARQAAQDAKSLEFLNAQLPKIRSDLDLAEDKLNQYRRQ
G5Q4J0      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5LQM6      EDRDKIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
G5SDT8      EDRDQIREILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAENKLNAFRQD
F3CAY9      QDAQRANRILDEVSHLYVRQNVERSSAEAAQRLQFLRSQLPAVRKQLEDAETALNTFQTS
A3K8W7      -EEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAEAQRQAEEQARAKAEAE
G7EJX6      -NLQSINRVISEYGNNNLELLGSMPEITSHKVVQDVKREVILVERKVSELSEVYGPKHPK
B7B947      --------------------SSSKN-----------------------------------
D3LB10      -------------------MFSKKN-----------------------------------
S9QRP1      --------------MAERRKFQRRKRRLSEDVAPETPIAEPRPEDRIDPAEPRRPEQDLR
G8AU96      ------------------MNLRRGV--------------------G--------------
D0D9W0      --------------MTERRRFRRRN--------------------R--------------
Q0FMP0      ------------MTMVERRKFRRRNRNPIDDGPEEPPIEPLESRDR--------------
A3W0H7      ------------------MKLKRHE----------EYMRRRAARRA--------------
I1AYC5      --------------MTDDRKFRRRN----------PLSAEIAAGEQ--------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      PNMGMTVSGIRGSVTASTDENSSLIKVSAHASTPEQA-----------------------
B7BDT8      RNYLTNSTSKNQLLPANSGIESPGIEQQIANYNTAQLRRNDLVANSSERNPLVIDMDQSL
G9WIQ9      ------------------------------------------------------------
A0NKF6      ------------------------------------M-----------------------
Q04DV8      ------------------------------------M-----------------------
E7T801      RDSVDLNLEAKAVLEQIVNVDNQLNELTFREAEISQL-----------------------
F4SM97      KDSVDLSLEAKSVLDQIVNVDNQLNELTFRESEISQL-----------------------
G5Q4J0      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKL-----------------------
G5LQM6      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKL-----------------------
G5SDT8      KDSVDLPLEAKAVLDSMVNIDAQLNELTFKEAEISKL-----------------------
F3CAY9      ARSVDLSIETKGVLDQVVSLDSMLSELKLRRVELERL-----------------------
A3K8W7      ------------AQRQAEEQARAKAEAEAQRQAEEQA-----------------------
G7EJX6      ------------IISAKAELATVKTNLNKQIKG---L-----------------------
B7B947      ------------PVVQDLNNSLIAMKQTI-------------------------------
D3LB10      ------------------------------------------------------------
S9QRP1      ADVEPAHRERAQATMRRIADARRASEARL-------------------------------
G8AU96      ------------ELKLRIRDEVGKIQKGL-------------------------------
D0D9W0      ------------PLDDLPDEDIAPVEP---------------------------------
Q0FMP0      ------------RLERRRAEDKAALAEET-------------------------------
A3W0H7      ------------EMEAEAEEDAAVLHPNL-------------------------------
I1AYC5      ------------AAKLARAEDARRMAAA--------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      -------QVLANSALHATAEYIKNIEGNNGGSGNAANSNGGNNATPNTENGNTAGASASA
B7BDT8      ENMRHAIITSIDNHITTLNTQIRSLQQSERQTTARIAANPTQGKYLLSVERQQKVKEALY
G9WIQ9      -----------MPSKRKA------------------------------------------
A0NKF6      -------FSKKNP-----------------------------------------------
Q04DV8      -------FSKKNP-----------------------------------------------
E7T801      -------YKKDHPTYRALLEKRQTLEQERKRLNKRVSAMPSTQQEVLRLSRDVEAGRAVY
F4SM97      -------YTKEHPTYKALMEKRKTLQDEKSKLNQRVTAMPKTQQEILRLSRDVNSGQAVY
G5Q4J0      -------FTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVY
G5LQM6      -------FTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVY
G5SDT8      -------FTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVY
F3CAY9      -------YTREHPTYRSLMSQMNQLEQQKQGLLKKIDALPMTQQELLRLTRDMQVISQTY
A3K8W7      -------RAKAEAEAQRQAEEQARAEAE-AEAQRQAEEQARTDAETEGRRRKLAEARQAA
G7EJX6      -------ITGIEKELNRITRTVSALEADLAKIRAEYQNITRKETQYNQLKREVETNRSIF
B7B947      -------IRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLSVERRQKIKEELY
D3LB10      ------------------------------------------------------------
S9QRP1      -------KAQQAHEAEKARAAEAAKAAEEDAARAAEAAREAEAERKADAARTAAAEQAAE
G8AU96      -----------DADLEVARIREATLLKSIADLQEQQKGIEATGIQLRDLERAADAHRTLY
D0D9W0      -----------------------------LGTRAEGLARRETKTSAAQATRRAEAERVAE
Q0FMP0      -------AHAAEEAARRSAEEQ--------------ARQRAAEEARLQEQREAEAREEAR
A3W0H7      -------DWPDDEDSVLATVPE------LLNLPEPEPEPEPEPEPEPEPEPEPEPEPEPE
I1AYC5      -----------EEQSRIAAAQEAERQHKLTAERQAEAGRRAAAERQGEVERQGEVERLAE
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ---------------------------------MAVVAALLLGVLAAGAYLMLRQRFVGT
F2I4B7      ------------------------------------------------------------
Q74BQ8      --------------------------MSRIEQALEKAAMLRG----------TTDRGQAV
F0JCB8      --------------------------MSRIEDALKKASEKRDENRRREPETVPSVEPVAA
Q314L3      --------------------------MSRIEQALARARKDKEHNAEDTPPR-PAGGGGAP
B5EA81      --------------------------MSRIEEAMEKAARMRN-GMEPPPPE-SVREPAGA
C6DZX5      --------------------------MSRIEEAMEKAARMRQ-GMEPPPPG-AAPQSAGN
A1ARV8      --------------------------MSRIEKAMERAAQVRN--------------SAGV
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      ------------------------------------------------------------
F7K8E9      ------------------------------------------------------------
F7KL96      ------------------------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      -------------------------------------------------------MSSVA
B1R3V1      ------------------------------------------------------------
I5B296      -----------------------------------MGKIFKALEKAGNKVTAEKESELRD
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      -----------------------------------MGKIFKALEKSKEIDMGDSAVVEND
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      -----------------------------------MSRIESILEKAAKMRQDKTPG----
B9M2X6      -----------------------------------MSRIEEALEKAAKMRGTDGKAAL--
A5G424      -----------------------------------MSRIEEALEKAARLRSS--------
E8WSZ5      -----------------------------------MSRIEMAMEKAARLRENGGQTPAQD
C7LPS3      ---------------------------------------MSRIEEALAKAA---------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      -----------------------------------MSRIEEALGKAAERQA---------
I2Q341      -----------------------------------MSRIEEALGKAAERQA---------
H8YYB9      -----------------------------------MERIKQALERARAERA---------
I5AV01      ------------------------------------------------------------
B0GAL3      ----------------------------------------------MMQEN---------
G1WUK2      ------------------------------------MDQERRSQREMMQEN---------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      ------------------------------------------------------------
C2KHF1      ------------------------------------------------------------
I0UTA5      NTAVSGNAANNI-------RVIPLDNASIN-PPLVSPNYTRNTLIGAVAGLVLVYVVIFL
B7BDT8      LFLLQKREENELSQAFTAYNTRVITPPSGS-MIPTAPVKKNIALVAFALGLLIPVVIIFI
G9WIQ9      -----KKASAVDLRSSRYG-----------------------------------------
A0NKF6      -----QKLSAKVLRSSRYG-----------------------------------------
Q04DV8      -----QKLSANDLRSSRYG-----------------------------------------
E7T801      LQLLNRQQELSISKSSAIGNVRIIDPAVTQ-PQPVKPKKALNVVLGFILGLFISVGAVLA
F4SM97      MQLLNRQQELNIAKSSAIGNVRIIDNAVSQ-PKPVKPKKILVLAVGFVLGLIVSLSLVFS
G5Q4J0      MQLLNKQQELKITEASTVGDVRIVDPAITQ-PGVLKPKKALIILGSIILGLMLSIVGVLL
G5LQM6      MQLLNKQQELKITEASTVGDVRIVDPAITQ-PGVLKPKKALIILGSIILGLMLSIVGVLL
G5SDT8      MQLLNKQQELKITEASTVGDVRIVDPAITQ-PGVLKPKKALIILGSIILGLMLSIVGVLL
F3CAY9      TLMLNKSQEQDILRAGSIGNVRVIDNADTNVEKPVKPMKTLIVLIATLIGALVAMTIVFV
A3K8W7      K--LRRAEEARRAAEADADDADDEDEDGTA-EQADTPVARPAPAMPTLALTPEQRSPAAD
G7EJX6      NTFLSRSKETEVTSDFTSAAARFTDRAYAP-NKPSKPNKKLIVVLAFVASFGFAIVMSFV
B7B947      LYLLNKREENELTQRMTESNARIIDPAAGS-NAPVAPKAMMILLASVVLGCAIPAGILWL
D3LB10      ------------------------------------------------------------
S9QRP1      VARQKNAAREAEAAQEAARAAEQADQEAAV-AHDPEPDADGAAPAAPT------------
G8AU96      RSLAERYEQTMALKNTGALDAHLSA--------PALPPIRPAFPQLRM------------
D0D9W0      PARPEARRGQTAPR--------------------------------PA------------
Q0FMP0      RQTTAKREEIRKRLRVH--DGDKVT--------APATASAP-----VE------------
A3W0H7      PEPEPEPEPEPEPEPEP--EPEPEP--------EPEPEPEPEPEPEPE------------
I1AYC5      VERRAKAEQQAEAKRRA--EAEQLA--------EATRRAEAEHQAQAE------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      -----------------------------------------------------------M
C2CI44      -----------------------------------------------------------M
C7RGH6      -----------------------------------------------------------M
C0CK73      --------------------MQAK-----------------------------------I
Q1WTC8      -------------------MQKFE-----------------------------------L
E8JWI5      -------------------MPILE-----------------------------------L
F3AHH0      -------------------MINVE-----------------------------------I
F7K0U1      -------------------MREIV-----------------------------------L
C4Z672      -------------------MQEFS-----------------------------------V
P0C0T9      -------------------MTRLE-----------------------------------I
Q04663      -------------------MTRLE-----------------------------------I
Q67AY4      -------------------MTRLE-----------------------------------I
Q3K0T0      -------------------MTRLE-----------------------------------I
C5NWJ8      -------------------MAQIN-----------------------------------L
F3A499      -------------------MAQIN-----------------------------------L
Q4JZ55      -------------------MGKLE-----------------------------------L
G5JTD5      -------------------MGYLE-----------------------------------L
G3G7C1      -------------------MATLE-----------------------------------I
G3G7J9      -------------------MATLE-----------------------------------I
G3G7G6      -------------------MATLE-----------------------------------I
G8DUB0      -------------------MATLE-----------------------------------I
G3G7I8      -------------------MATLE-----------------------------------I
G3G7J4      -------------------MATLE-----------------------------------I
G7SG34      -------------------MATLE-----------------------------------I
G8DTZ0      -------------------MATLE-----------------------------------I
G8DU07      -------------------MATLE-----------------------------------I
A4VTU3      -------------------MAMLE-----------------------------------I
G7SNU6      -------------------MAMLE-----------------------------------I
G8DU31      -------------------MAMLE-----------------------------------I
D5AGQ5      -------------------MAMLE-----------------------------------I
Q9X4U7      -------------------MAMLE-----------------------------------I
A3CQY2      -------------------MATLE-----------------------------------L
E8KLY9      -------------------MATLE-----------------------------------L
F0FHA8      -------------------MATLE-----------------------------------L
F0I4H5      -------------------MATLE-----------------------------------L
F0IAY3      -------------------MATLE-----------------------------------L
F0IJI2      -------------------MATLE-----------------------------------L
F0IS53      -------------------MATLE-----------------------------------L
F2C9N0      -------------------MATLE-----------------------------------L
F2CH53      -------------------MATLE-----------------------------------L
F3SM32      -------------------MATLE-----------------------------------L
F3UDW7      -------------------MATLE-----------------------------------L
F3UNJ4      -------------------MATLE-----------------------------------L
F0FQQ5      -------------------MATLE-----------------------------------L
D6R2T8      -------------------MAVLE-----------------------------------L
F3UUQ2      -------------------MAVLE-----------------------------------L
E6IZC2      -------------------MPSLE-----------------------------------L
G6A745      -------------------MPRLE-----------------------------------L
A8AZR3      -------------------MPILE-----------------------------------L
F9HJP6      -------------------MPVLE-----------------------------------L
Q4JYT9      -------------------MPTLA-----------------------------------I
Q4JZY1      -------------------MPTLA-----------------------------------I
E1LQJ7      -------------------MPTLE-----------------------------------I
F9HC65      -------------------MPTLE-----------------------------------I
E1LPE7      -------------------MAKLE-----------------------------------L
F9MJW5      -------------------MAKLE-----------------------------------L
E8KDN2      -------------------MAKLE-----------------------------------L
E8K322      -------------------MAKLE-----------------------------------L
F9PEU4      -------------------MAKLE-----------------------------------L
F9PZP7      -------------------MAKLE-----------------------------------L
C1CBD1      -------------------MPTLE-----------------------------------I
Q7WVX0      -------------------MPTLE-----------------------------------I
P96475      -------------------MPTLE-----------------------------------I
Q9AHD2      -------------------MPTLE-----------------------------------I
Q4K2Q7      -------------------MPTLE-----------------------------------I
Q4K0T5      -------------------MPTLE-----------------------------------I
Q4K0E1      -------------------MPTLE-----------------------------------I
Q9AH95      -------------------MPTLE-----------------------------------I
Q4K1M4      -------------------MPTLE-----------------------------------I
Q4JZ18      -------------------MPTLE-----------------------------------I
Q54520      -------------------MPTLE-----------------------------------I
Q4JYH5      -------------------MPTLE-----------------------------------I
Q4K0V2      -------------------MPTLE-----------------------------------I
A5M4L1      -------------------MPTLE-----------------------------------I
B2ILP5      -------------------MPTLE-----------------------------------I
C1CCB9      -------------------MPTLE-----------------------------------I
Q4K1S7      -------------------MPTLE-----------------------------------I
P72512      -------------------MPTLE-----------------------------------I
Q4JZ84      -------------------MPTLE-----------------------------------I
Q4K0X5      -------------------MPTLE-----------------------------------I
Q4K0Z6      -------------------MPTLE-----------------------------------I
Q4K195      -------------------MPTLE-----------------------------------I
Q4K0A0      -------------------MPTLE-----------------------------------I
Q4K0K2      -------------------MPTLE-----------------------------------I
Q4K1F9      -------------------MPTLE-----------------------------------I
Q4K045      -------------------MPTLE-----------------------------------I
G6C7Z1      -------------------MPTLE-----------------------------------I
D2ERX8      -------------------MPTLE-----------------------------------I
F9LZC4      -------------------MPTLE-----------------------------------I
F9P1W8      -------------------MPTLE-----------------------------------I
I0J9C9      -------------------MPTLE-----------------------------------I
A6YIA8      -------------------MPTLE-----------------------------------I
Q4K005      -------------------MPTLE-----------------------------------I
Q4JZL7      -------------------MPTLE-----------------------------------I
E5F5C5      -------------------MPTLE-----------------------------------I
Q4JZG7      -------------------MPTLE-----------------------------------I
Q4JZK1      -------------------MPTLE-----------------------------------I
A5LJS0      -------------------MPTLE-----------------------------------I
Q9AHB7      -------------------MPTLE-----------------------------------I
Q4K1B7      -------------------MPTLE-----------------------------------I
Q4JYK8      -------------------MPTLE-----------------------------------I
Q4K0M3      -------------------MPTLE-----------------------------------I
Q9AHA4      -------------------MPTLE-----------------------------------I
Q9X9A1      -------------------MPTLE-----------------------------------I
Q9ZII6      -------------------MPTLE-----------------------------------I
Q8KWQ0      -------------------MPTLE-----------------------------------I
Q4JZW7      -------------------MPTLE-----------------------------------I
Q4JYX9      -------------------MPTLE-----------------------------------I
Q4K0R7      -------------------MPTLE-----------------------------------I
Q4K1K6      -------------------MPTLE-----------------------------------I
Q4JZS3      -------------------MPTLE-----------------------------------I
Q4K0I2      -------------------MPTLE-----------------------------------I
Q4K254      -------------------MPTLE-----------------------------------I
Q4K237      -------------------MPTLE-----------------------------------I
B1I967      -------------------MPTLE-----------------------------------I
G6J8A4      -------------------MPTLE-----------------------------------I
G6LKG5      -------------------MPTLE-----------------------------------I
Q9ZFT8      -------------------MPTLE-----------------------------------I
D6ZQI8      -------------------MPTLE-----------------------------------I
Q4K2A8      -------------------MPTLE-----------------------------------I
Q8VU31      -------------------MPTLE-----------------------------------I
Q4K2E1      -------------------MPTLK-----------------------------------I
Q4K2F7      -------------------MPTLE-----------------------------------I
A5YTV7      -------------------MPTLE-----------------------------------I
F9Q345      ------------------------------------------------------------
Q6L5R0      -------------------MPTLE-----------------------------------I
A5YTT9      -------------------MPTLE-----------------------------------I
E6KKS0      -------------------MPTLE-----------------------------------I
F2QF90      -------------------MPTLE-----------------------------------I
E0Q2S8      -------------------MPTLE-----------------------------------I
A1ILY1      -------------------MPTLE-----------------------------------I
Q6L5T0      -------------------MPTLE-----------------------------------I
E9FEC5      -------------------MPTLE-----------------------------------I
E0PPH9      -------------------MPTLE-----------------------------------I
F5VSG9      -------------------MPTLE-----------------------------------I
E3CBS0      -------------------MNTLE-----------------------------------I
F9M366      -------------------MNTLE-----------------------------------I
E8K786      -------------------MNTLE-----------------------------------I
F8DFF4      -------------------MNTLE-----------------------------------I
I1ZPH7      -------------------MNTLE-----------------------------------I
E7S8W3      -------------------MATLE-----------------------------------I
D0RXH2      -------------------MATLE-----------------------------------I
Q83YR5      -------------------MATLE-----------------------------------I
Q8GP54      -------------------MPLLK-----------------------------------L
F8HDC3      -------------------MPLLK-----------------------------------L
F8LJ75      -------------------MPLLK-----------------------------------L
E9DM17      -------------------MPLLK-----------------------------------L
I0QIK6      -------------------MPLLK-----------------------------------L
E8KUY8      -------------------MPLLK-----------------------------------L
Q7X553      -------------------MPLLK-----------------------------------L
Q8GP92      -------------------MPLLK-----------------------------------L
Q7X561      -------------------MPLLK-----------------------------------L
Q7X549      -------------------MPLLK-----------------------------------L
G6ERT1      -------------------MPLLK-----------------------------------L
O87931      -------------------MPLLK-----------------------------------L
Q8GPF6      -------------------MPLLK-----------------------------------L
Q7X555      -------------------MPLLK-----------------------------------L
Q7X557      -------------------MPLLK-----------------------------------L
Q7X563      -------------------MPLLK-----------------------------------L
Q8GMA5      -------------------MPLLK-----------------------------------L
Q8GPA8      -------------------MPLLK-----------------------------------L
Q55205      -------------------MPLLK-----------------------------------L
C2LSE6      -------------------MPLLK-----------------------------------L
Q7X559      -------------------MPLLK-----------------------------------L
F8LXJ4      -------------------MPLLK-----------------------------------L
Q1WCR1      -------------------MPLLK-----------------------------------L
Q8GPC3      -------------------MPLLK-----------------------------------L
E8JMT9      -------------------MPQLE-----------------------------------L
F5X0J9      -------------------MPQLE-----------------------------------L
H2A602      -------------------MPQLE-----------------------------------L
E0PD83      -------------------MPQLE-----------------------------------L
F5X652      -------------------MPQLE-----------------------------------L
G5KD11      -------------------MSHLE-----------------------------------L
B9DUJ4      -------------------MAQLE-----------------------------------L
G5KAJ2      -------------------MAQLD-----------------------------------L
F1Z124      -------------------MARLE-----------------------------------L
Q2KM74      -------------------MSQLN-----------------------------------L
C6LDI8      ----------------------MQ-----------------------------------I
D4J4T6      ---------------------MNS-----------------------------------I
D4LTH2      -------------------MDE-------------------------------------L
D4LG06      -------------------MNK-------------------------------------L
A7VF42      -------------------MKK-------------------------------------L
A8SQS8      -------------------MKK-------------------------------------L
D5HFS4      -------------------MKK-------------------------------------L
C9LAS1      -------------------MEQKV-----------------------------------V
F3AH92      -----------------MNTELKV-----------------------------------V
I5ASF8      -----------------MMLTNYV-----------------------------------K
E7GL81      -------------------MGKEI-----------------------------------S
G5F9E2      -------------------MGKEI-----------------------------------S
E7GL57      -------------------MDNEV-----------------------------------F
G5F9A9      -------------------MDNEV-----------------------------------F
E7GL40      -------------------MHDEIVIEDLISPDERGMGEL-------------------V
G5F9H2      -------------------MHDEIVIEDLISPDERGMGEL-------------------V
A8RK85      -------------------MDEIL-----------------------------------H
G5HTB2      -------------------MDQIL-----------------------------------N
G5HNC5      -------------------MGQTL-----------------------------------S
C0CZV9      -------------------MRQTV-----------------------------------A
A8RSK9      -------------------MSQFV-----------------------------------T
C5EN03      -------------------MKQII-----------------------------------T
G5HG45      -------------------MKQII-----------------------------------T
D9ST44      ---------------------------------MNNNRLI-------------------T
G2Z8Q3      -------------------------------MPKERSKLL-------------------I
C8W5K2      ---------------------------------MFSNKLI-------------------T
A5V0I3      ---------------------------MNHTNGYADSPLI-------------------A
F5LM71      -----------------------------MSPSNKQRPII-------------------A
D7VBW4      -----------------MKLRRRVAN------MHTGIQLT-------------------T
F9UQ54      -----------------MKLRRRVAN------MHTGIQLT-------------------T
H6LKR8      ---------------------------------MNLASLI-------------------T
E0I7B5      -----------------------------MSRQNSQANLI-------------------T
D7UYE4      ------------------MKKKETGM-------RRGLSLI-------------------A
Q4A120      -----------------MAKKIDTEI-------T---TLI-------------------T
D9SVC7      ----------------------------------MFKSLI-------------------T
D9S1J9      -------------------------------MEEMDAQLF-------------------V
C0GGR5      -------------------MKKKKRKTNTHATDNYLDKLI-------------------T
C6CSC8      -----------------------------MSQSENKRRLI-------------------S
A3ICA3      -----------------MLFKRKTKR------IPMARKLI-------------------T
B1HR41      -----------------MLFKRKTKK------IPMARKLV-------------------T
D6Y034      -----------------MAFRNPFAKKVEDHLTEKQRSLI-------------------T
Q8EME8      -----------------MARKKLSNV------NNKMRHLI-------------------T
F3Y922      -----------------MSEKNSLKK-----QRTKPISLI-------------------T
G4L594      -----------------MKRKNERKG-----TQTHAVSLV-------------------S
C9B454      -----------------MARTQKQKA-----AQTNAVSLI-------------------T
Q3XYS6      -----------------MARTQKQKV-----IQTHAVSLI-------------------T
C9ALZ9      -----------------MARTQKQKA-----AQTHAVSLV-------------------T
C9BUG7      -----------------MARTQKQKA-----AQTHAVSLV-------------------T
D4RJF4      -----------------MARTQKQKA-----AQTHAVSLI-------------------T
C8ZXT9      -----------------MAKQQERKG-----TQTHAVSLI-------------------T
G5IRQ6      -----------------MAKQQERKG-----TQTHAVSLI-------------------T
C9A6V5      --------------------------------------MI-------------------T
C9CHY8      -----------------MPKKQERTG-----TETHAVSLI-------------------T
Q814Z0      -----------------MALNLFKKK----KSHRQRRQLI-------------------A
B9IRQ6      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
B7HXB4      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
Q72XH8      -----------------MALNLFKKK----KNHRQRRQLI-------------------T
A0RL70      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
Q6HB09      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
F0PU64      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
B7HFH1      -----------------MVLNLFKKK----QNYRQRRQLI-------------------A
B7IQS8      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
B3ZRD6      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
B5UQ73      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
G9QCG3      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
Q3EV64      -----------------MALNLFKKK----KNHRQRRQLI-------------------A
Q5WBB4      -----------------MARLTRAKK----KPVQKKRQLI-------------------A
B1YMM5      -------------------MAKKNKM------NKDARNLI-------------------T
D7WMM8      -----------------MFWKKKKKK----KLVKMARKLV-------------------T
A7Z921      -----------------MGFRKKKSR--------RGLAQI-------------------S
I2CAF2      -----------------MGFRKKKSR--------RGLAQI-------------------S
A7Z9K0      -----------------MLTRKKDKP--------GKRSVI-------------------A
I2CB16      -----------------MLTRKKDKP--------GKRSVI-------------------A
I2HW53      -----------------MLTRKKDKP--------GKRSVI-------------------A
G9QKR4      -------------------MARKTKK------IDNKRKLI-------------------A
D5DBK3      -------------------MARKRKENKNDKVLTLKRRLL-------------------A
D5DY81      -------------------MARKKKDQKNDKMLTLKRRLL-------------------A
Q2BFS5      -----------------MLFKNKPKA----SVNDSRRKLV-------------------A
A4ITF3      -------------------MAAKKRK----KFQKAERNLI-------------------T
C5D961      -------------------MARRDRK----KIQKIERSLI-------------------T
G8MZ93      -------------------MARKPAT----SIRKAERRLI-------------------T
F0G6H5      VSDPGEIEWTTGLPVIATVPRGESPRLAGADARNRPHASA-------------------A
F2I4B7      -----------------------------------------------------------M
Q74BQ8      APRQMEDLQPLERAELPPLPAEP------LEGIRHDNPLL-------------------A
F0JCB8      PVMEAASPVDASLDFSPLQSDCLD--------RARQQRML-------------------V
Q314L3      SGVPHTPAEDSGGPAGPLPAPRVA-----AARQVRLSPKL-------------------V
B5EA81      SALPPQTPQPVGSPALPPQPPQIPAVSPQYGRLAPQNPFL-------------------V
C6DZX5      SALPPQTPQPVVSPALPPQPPQISPVSPQYGRLAPQNPFL-------------------V
A1ARV8      MRQPQETAARSGMVHTAPLPDMV------VNKVMSDDPLL-------------------V
C6CW37      ----------------------------MSMRRSTSDNRL-------------------V
G9RSY9      ------------------------------------------------------------
B9Y884      --------------------------------MLRVGEEL-------------------I
A5Z5P9      ----------------------------------MNKIKM-------------------D
Q1AUN8      ----------------MVVRTSLRRRAREEQRKGDLSGRL-------------------I
F2I6Z7      --------------MFNFKQRKI---DKKNKE-QRRGVSL-------------------I
D4YHG7      ---------------MFKNKRKHF--DKMNAE-QRRGASL-------------------I
C1J9I3      --------------MMQLSFSKLFHRHQEDQETQKNGVML-------------------V
B1MZT1      --------------MAFFKKNKALG-DGLSAETMTKGARL-------------------I
H1WR06      --------------MAFFKKNKALG-DGLSAETMTKGARL-------------------I
H1X4N2      --------------MSFFKKRSSVDKDGLSVETMTTGARL-------------------I
Q03W95      --------------MSFFNKGRAVGKDGLSVETMTKGARL-------------------I
F0SX22      ----------------MRGIKRLLNKGRNKTPDIVRDKLN-------------------I
B6W7H4      ------------------------------------MAKK-------------------H
F0GT81      ------------------------------------MSKK-------------------G
B1R3X6      --------------------------------------MF-------------------L
Q8XN76      --------------------------------------MF-------------------L
B1BNK1      --------------------------------------MF-------------------L
B1V0N7      --------------------------------------MF-------------------L
Q0SVR8      --------------------------------------ML-------------------I
B1BNH3      --------------------------------------ML-------------------I
Q8XN46      --------------------------------------ML-------------------I
B1V1Z4      --------------------------------------ML-------------------I
G5GFW0      ----------------------------MDIRGQNGTVKL-------------------R
C2EFR6      ------------------MEIMVKVRANGERGCEWMQKFE-------------------L
F3ATF5      --------------------------------MAEQKVIM-------------------T
D4M2S0      --------------------------------MAIQRVML-------------------T
F4BS19      ------------------------MFKKRLKEKKYEDKNL-------------------I
D4CG08      ------------------------------MGKMMKVVNI-------------------H
D4MP30      ------------------------------MGKMMKVVNI-------------------H
C6LCS5      ----------------------------------MANINI-------------------D
B0P2G2      ----------------------------------MKKLVM-------------------D
D4MW29      ----------------------------------MKKLVM-------------------D
E5VMX8      ----------------------------------MKKLVM-------------------D
D4JMC2      ----------------------------------METVVI-------------------N
D6E0V4      ----------------------------------METVVI-------------------N
D6E330      ----------------------------------MELVKF-------------------G
C4Z8M5      ----------------------------------MELVKF-------------------G
D4JI67      ----------------------------------MELVKF-------------------G
D3AC80      ----------------------------------MQKVLL-------------------R
G5IFS3      ----------------------------------MEQIRF-------------------R
D4RX67      ----------------------------------MQKISI-------------------S
A6BIG7      -------------------------------MEDMADIVL-------------------K
C0C0F8      -------------------------------MMEMQEIYL-------------------K
Q97EP8      ------------------------------MLVV--------------------------
Q97ER5      ------------------------------MLVV--------------------------
D2RIR2      ------------------------------MEEIKLIV----------------------
G0VNK6      ------------------------------MAEIDFIT----------------------
I0GRR2      ------------------------------MANIDLIV----------------------
A0PZ02      ------------------------------MLIV--------------------------
B1B736      ------------------------------MLIV--------------------------
F6BI62      ------------------------------MIDVNNNVFK-------------------N
Q8RBS5      ------------------------------MVMARNLI----------------------
G2MWC2      ------------------------------MVAARNLI----------------------
B0K4N1      ------------------------------MVVARNPI----------------------
B0KAR5      ------------------------------MVVARNPI----------------------
E8UV29      ------------------------------MVVARNPI----------------------
C7ISF7      ------------------------------MVIARNPI----------------------
F7K9V1      ----------------------------------MQTVTF-------------------N
F7K8E9      ----------------------------------MQTITF-------------------S
F7KL96      ----------------------------------MQTVTF-------------------N
C9AAE5      ------------------------------MRSMKENYSI--------------------
H7F6C8      ------------------------------MSNTKRNKRR--------------------
H7F5T6      ---------------------------MKKTDKKDLKNRL-------------------V
E6PYQ3      IQSRRSSRLKSLYLCLSLPQFQSIGMSWHPDHPAKNGIAL-------------------I
B1R3V1      ------------------------------MWESKGGKWML------------------I
I5B296      DTALVCDNPDSQVYKQSDEVTQ--------SGSRRTDSAL-------------------V
D4YF13      --------------MFNFKSKKKQQKL---ENEQKLGSPL-------------------V
E6U7N4      ---------------------------MANKHRVLSHDVL-------------------L
C8VYQ6      ----------------------------------MAVEKL-------------------I
C0QCJ2      SREDDLQDDTAGEENSRGDESPETGAH---VQEDPQTIELPQSLDKSL-----------V
C2MBF8      -------------------------------MIDQASRTF-------------------V
D3AE78      ----------------------------------MQKVEF-------------------K
Q39U17      ------ESRVLVEQREVPRAVIEPEVFQPDTRIAVDNPYL-------------------V
B9M2X6      ------GKVPGSPLAVAHGSVHAYQQPMPNERLKVKNPLV-------------------V
A5G424      ------ERSNVTVGKTVATAVHVPPLPSSPAAAKIENPFI-------------------V
E8WSZ5      QAQARPDTATAAAAPRAREAERVPPVVPAGQALSPQNPFL-------------------V
C7LPS3      ------GMQSGLHSKGNRAGVSGIARAPMGESTSVGGVRLAEETM--------------V
C3WFM9      ----------------------------------MSKRKI-------------------F
A4J8V0      ------------MMLNNRL----------------------------------------V
A8U9F4      --------------MFNKKKK---------QLDTSERPSL-------------------V
F4BSD9      --------------MFNKKEK---------KLDNNERPSL-------------------V
F7V792      -------------MEYRNQEGFERKSGSGENIIPKHSLEI-------------------E
F6IR93      ------------MGLKRLKRK---------TTAETSGVQL-------------------T
G0M0F9      ------------MGLKRLKRK---------TTAETSGVQL-------------------T
F6ITB4      --------------MFKRKEQ---------STTTTAPINL-------------------T
G0M1X9      --------------MFKRKEQ---------NTTTTAPINL-------------------T
G0LYN9      --------------MFKRKGQ---------NITTTAPINL-------------------T
D7VC13      --------------MFKRKEK---------NIATTAPINL-------------------T
F9UMZ6      --------------MFKRKEQ---------NITTTAPINL-------------------T
G7QCG1      ------GMPRPEARLFFRQEATLPPPSQAIDPARLSEEKL-------------------V
I2Q341      ------GMPRPEARLFFRQDAPLPQPSQAIDPARLSEEKL-------------------V
H8YYB9      ------AAQLADVPVLSTQKVIAQEQE---TKPAGPGVQVSYTETRSLSLDPEQLRAKRV
I5AV01      -----------------------------------MDVIK-------------------I
B0GAL3      ------EKQARTTYTNAQAKAAMSRRD---NKASKLRVEL-------------------T
G1WUK2      ------EKQAKTTYTNAQAKAAMSRRD---NKASKLRVEL-------------------T
E0RZL3      ---------------------------------MQNAKLH-------------------F
D8FLF8      ------------MAFGRKN-----YLD---NETMKNGAKL-------------------I
F0K0J7      ------------MAFGRKK-----HLN---NDTMKNGVKL-------------------I
Q1G8E4      ------------MAFGRKK-----HLN---NDTMKNGVKL-------------------I
C4VP08      ------------MALFRKK-----RGT---DETMHYGAKL-------------------I
D6S4X4      ------------MALFRKK-----RGT---DETMHYGAKL-------------------I
D0DJH0      ------------MALFRKK-----RGT---DDTIKNGAQL-------------------I
C7XKF3      ------------MALFRKK-----RGT---DDTIKHGAKL-------------------I
E3R264      ------------MALFRKK-----RGT---DDTIKHGAKL-------------------I
D5GZJ8      ------------MSLFRKK-----RGT---DDTIKHGAQL-------------------I
C2EPK5      ------------MSLFRRK-----RGT---NETIEKGAKL-------------------I
A4ZGZ8      ------------MSLFKKK-----RGT---DETIKKGAKL-------------------I
A8YX89      ------------MSLFKKK-----RGT---DETIKKGAKL-------------------I
F0NWJ7      ------------MSLFKKK-----RGT---DETIKKGAKL-------------------I
E4SMV5      ------------MPLFKKK-----RGT---DDTIKNGAKL-------------------I
F0TGY2      ------------MPLFKKK-----RGT---DDTIKNGAKL-------------------I
Q5FIC7      ------------MPLFKKK-----RGT---DETIKHGAKL-------------------I
F2M2M6      ------------MPLFKKK-----RGT---DDTIKNGAKL-------------------I
G7M0Q3      ----------------------MKIRN---KKNKNKKNIF-------------------S
G7M1R9      ------------------MFKARKLEK---AVASQQYRGF-------------------V
A6M2L9      ----------------MKRYK--LEKT---VVDNRIHAGF-------------------I
G7M566      ----------MSVLEAIKHYKKGKDNN---TIDDRIHAGF-------------------I
G2KUP1      ----------MIMSLFRKN----KKLD---DNTMKNGAPL-------------------I
G8PE06      ------------MSIFNRK----RKLD---DESLKNGVGL-------------------I
Q03GL8      --------------MFKKK----QKLD---NESLKNGVGL-------------------V
E0NHP4      --------------MFFKK---KPKLD---NESLKNGVGL-------------------I
F4FXQ7      ------------MNIFRRK---QKKIS---TDTLRNGVKL-------------------I
C0WV35      ------------MNIFHRK---RKKLS---TDTLRNGVKL-------------------I
H1LCW3      ------------MNIFHRK---RKKLS---TDTLRNGVKL-------------------I
C2JZS1      ------------MTLKFKKLFSHNHVD---QETQKNGVFL-------------------V
Q58Z10      ------------MNFSLEKILHRHKED---QETQKNGVML-------------------V
E9SAU1      ------------MASIKKN----QSSN---TRTRRRTLMD-------------------K
Q38VG5      ------------MGLFRKE----KKLD---QDSMKEGVGL-------------------I
F0HVF1      ------------MALFGRK----NHLD---NETIKNGVKL-------------------I
G6F8G9      ---------------------------------MKNGVKL-------------------I
C2EWM3      ------------MSLFKKK----TNAS---NETIRYGAKL-------------------I
F8DRU2      ------------MSLFHRT----QQQS---TDTMNNGAKL-------------------I
B3XL23      ------------MSLFHRT----QQQS---TDTMDNGAKL-------------------I
F8KGP1      ------------MSLFHRT----QQQS---TDTMDNGAKL-------------------I
H4GK03      ------------MGLFSRK----KIQS---VDTMVNGANL-------------------V
B2GF33      ------------MGLFKHR----YTES---TDTMDNGAML-------------------I
C0WW26      ------------MGLFKHH----YTES---IDTMDNGAML-------------------I
D0DSJ4      ------------MGLFKHR----YTES---TDTMDNGAML-------------------I
C0ZHV8      -------------------------MSMRRQKPDDRYQKL-------------------I
H1BJT1      -----------------------------------------------------------M
F8FCE2      -----------------------------MPQRSSKNNVI-------------------I
H6NE43      -----------------------------MPQRSSKNNVI-------------------I
I0BSG4      -----------------------------MPQRSSKNNVI-------------------I
Q83VF9      --------------------------MAKNKRSIDNNLYL-------------------I
G8P3D7      --------------------------MAKNKRSIDNNRYI-------------------I
O06030      --------------------------MAKNKRSIDNNHYI-------------------I
G9M880      --------------------------MAKNKRSIDNNRYI-------------------I
G6FD42      --------------------------MAKNKRSIDNNRYI-------------------I
F9VC44      --------------------------MAKNKRSIDNNRYI-------------------I
A9QSJ4      --------------------------MAKNKRSIDNNRYI-------------------I
Q3ZK50      --------------------------MAKNKRSIDNNRYI-------------------I
E3GPC6      -----------------------------------MKDSI-------------------I
G0V447      -------------------------------------MKP-------------------I
H7F1R7      -------------------------------MLKLSERKL-------------------I
E3H7M5      ----------------------------------MRRRKL-------------------V
E6UHY4      -----------------------MANTKKIPGGNRNRRRT-------------------L
D9QTC6      ---------------------MIKMDKERRERIQSRDVEL-------------------I
D9SR41      -----------------------------------MLKSL-------------------V
E3HB18      ----------------------------------MTERKL-------------------Y
P95696      -----------------------------MSKKENTTTTL-------------------F
Q2G1K7      -----------------------------MSKKENTTTTL-------------------F
A8YPQ5      -----------------------------MTNTRRSTSSL-------------------I
Q2FUV2      -----------------------------MTNTRRSTSSL-------------------I
P39851      -----------------------------MAKKKSTISPL-------------------Y
C5QNG4      ---------------------------MMAEKRKKLEQPL-------------------F
Q4L9H7      ------------------------MPKKNKEKRKKLSHPL-------------------Y
A7NQ71      -------------------MNTTNDARAMNQTNGYAESPL-------------------I
E4Q5T5      ---------------------------------MNAVKEV-------------------I
E4SDX4      ---------------------------------MNAVKEV-------------------I
E4S7Y6      ---------------------------------MSIVKEV-------------------I
C6CS80      -----------------------------MSRSDLKLRPV-------------------V
E6LD64      ------------------------MAKNNKRGTETKPVSL-------------------I
F0EKB9      ----------------------MMAKKQERTGTQTHAVSL-------------------I
H7F571      -----------------------------MGERTSGGKNL-------------------I
F5LE48      -----------------------------MLASTNNSKVL-------------------I
E7RDR3      -------------------------MARKKKVLQETARKL-------------------I
E7RG08      -------------------------MVKKKNKPEVKNRKL-------------------I
F6CNF5      -------------------------------MSKANGYEL-------------------I
G2FWX4      -----------------------------------MAYSL-------------------I
G2FM59      -----------------------------------MAYSL-------------------I
G7WJV1      -----------------------------------MVYSL-------------------I
H5XZD4      -----------------------------------MVYSL-------------------I
H5XZG7      -----------------------------------MSHSL-------------------I
G7W773      -------------------------------------MTL-------------------I
G2FWT8      -----------------------------------MAYSL-------------------I
I4DBG8      -----------------------------------MKHSL-------------------I
C0EBA6      -----------------------------MSINHKKHTHL-------------------D
Q9K6R0      -----------------------MLGKGSKQKNGSKQREL-------------------I
I2HVL2      -----------------------MRRLGFRKKKSRRGLAQ-------------------I
D4G1R2      ------------------------------------------------------------
G4EQZ7      --------------------------MIFRKKKARRGLAQ-------------------I
P71051      --------------------------MIFRKKKARRGLAQ-------------------I
E0U2Z3      --------------------------MFFRKKKARRGLAQ-------------------I
G4P114      --------------------------MVFRKKKARRGLAQ-------------------I
A9VRC3      ---------------------MALNSLFKKKQNHRQRRQL-------------------I
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ---------MVCTVQEKKQKERLRRLAPKKTKLLNTRRKL-------------------I
P96716      ----------------------MALRKNR---GSRMQRNV-------------------I
G4EQF3      -----------------------------------MQRNV-------------------I
D4G2E1      -----------------------------------MRRNV-------------------I
I0F9R6      -----------------------------------MRRNV-------------------I
E0TTZ6      ----------------------MALRKTR---GSWMRRTV-------------------I
G4P1M7      ----------------------MALRKSS---GSWIRRNV-------------------I
A8FHL9      ----------------------MIFKRKK---REKRDLSC-------------------I
Q5KUM5      ---------------------MKPLARKPATSIRKAERRL-------------------I
D3FZP4      ----------------------MLKRNQSVSTRTQQQRKV-------------------V
I0JRK4      ----------------------MALSKKK-KNQQTSVRSI-------------------I
I3EBB3      ----------------------MVLKNKK-KALLQHKRKL-------------------I
E3CP62      -------------------------------------------------------MPLLK
C2KHF1      -------------------------------------------------------ARLIT
I0UTA5      RRSVDQRIRTRDDAVKATGSSILGVLPTSDDLTE---------------------ENIVT
B7BDT8      RENMNSKVR-GRKDLESLSVPFVGEIPLVGSGKKKKKTANTA-------------KEIVI
G9WIQ9      -------------------------------------------------------VPLIT
A0NKF6      -------------------------------------------------------VPLVT
Q04DV8      -------------------------------------------------------VPLVT
E7T801      RAMLRRGVE-APEQLEEHGISVYATIPMSEWLDKRTRLRKKNLFSNQQRHRTKN-IPFLA
F4SM97      RIFLRRGIE-SPEQLEEIGINVYASIPVAENSV-----KKASQIKRFKQKAEKEYTTFLF
G5Q4J0      RSLFNRGIE-SPQVLEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQ------SQLLA
G5LQM6      RSLFNRGIE-SPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQ------SQLLA
G5SDT8      RSLFNRGIE-SPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQ------SQLLA
F3CAY9      RQAFYRGIE-SAEVIESLGMPVYASLPHSRQQE-----RLEKRDQDSKD------SRLLS
A3K8W7      QTPLPQSTRLQTDTAWR-------DLPVARFEL-----SQLNRHRVVTA------DRL--
G7EJX6      FDALNDTAKTKNDVEGKLAQRMLGLLPHVKLPK-----NSVFPIHAYLD------ENY--
B7B947      LMVSDTKVRSRKDVEGVLSVPFLGEIPMRDKKDKNEVVVHENGR-----------DSV--
D3LB10      -----------------------------PQKLSANDLRSSRYG-----------VPLIT
S9QRP1      QAEAPVAKNSARGTTTADPWDALRSISVDERQLDRNRVITAGRH-----------DPA--
G8AU96      SLGVGLVGSTALAVALVLLLERLSSGLRTPTQVERATGVPCLGM-----------VPSLP
D0D9W0      APAVATRTAQSPTLPQQRGWDDLAEFSVDARHLERNRIVTAARQ-----------DPA--
Q0FMP0      AETAPAQAPRSPARKPTPLWHRLQEFTVNPRHLERHRIITAERQ-----------DPA--
A3W0H7      PVVASDVAPEPTPAPPPLLWPALRRVVLDPKHLAMHRLISATRE-----------DPA--
I1AYC5      RQAGADRQAK-DDASPDMVWSRLPVFSVNARHLDRNRIVTAGRQ-----------DPA--
                                                                        

E9TE88      ----------------------------MMQ------------------AQNNVLMM-TG
B8D0N2      VNYSRYTNDPAL-EAYRLLRANLEF---V-AKK----------------NEARTVLI-TS
C2CI44      SKKNSYYSASMYDEAIRSVRTNIQF---S-SLD----------------KKNKIIAV-TS
C7RGH6      TSRNNYYSASMYDEAIRSVRTNIQF---S-SLD----------------KKNKVISI-TS
C0CK73      VLPNEELEYGAA-EAIKTLRTNIMY---S--------------------EDVKAIML-TS
Q1WTC8      RLDDIDFQSQ---ESFKTLRFNVEF---S-G------------------EKNQVFYI-TS
E8JWI5      AKKKKISISRVE-EYYNALRTNIQL---S-G------------------EDIKVIAV-SS
F3AHH0      KVPKLGY--NSA-ESYKSLRANLQF---C-G------------------DDKKVLAI-TS
F7K0U1      NGLEKDF--RSN-EAYKNLRTNIEF---S-G------------------EENKVLVF-TS
C4Z672      KKSYLDF--RTR-EAYKMLRTNIEF---S-G------------------DNNKVIFI-TS
P0C0T9      VDSKLRQAKKTE-EYFNAIRTNIQF---S-G------------------KENKILAI-TS
Q04663      VDSKLRQAKKTE-EYFNAIRTNIQF---S-G------------------KENKILAI-TS
Q67AY4      VDSKLRQAKKTE-EYFNAIRTNIQF---S-G------------------KENKILAI-TS
Q3K0T0      VDSKLRQAKKTE-EYFNAIRTNIQF---S-G------------------KENKILAI-TS
C5NWJ8      LTNQKIVDPKNE-EYYNALRTNIQF---L-G------------------KDKKVIAI-TS
F3A499      LTNQKIVDPKND-EYYNAIRTNIQF---L-G------------------KDKKVIVI-TS
Q4JZ55      TRKYYQLYNETK-EYFNALQTNIQL---S-G------------------DGLKVISV-TS
G5JTD5      SSKQEKTIDKAE-EYYNSIRANIQF---S-G------------------SDIKVIAL-TS
G3G7C1      ARTKKELVNKTE-EYFNAIRTNIQL---S-G------------------EDIKVVGI-TS
G3G7J9      ARTKKELVNKTE-EYFNAIRTNIQL---S-G------------------EDIKVVGI-TS
G3G7G6      ARTKREIVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G8DUB0      ARTKKELVNKTE-EYLNAIRTNIQL---S-G------------------ADIKVVGI-TS
G3G7I8      ARTKREIVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G3G7J4      ARTKREIVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G7SG34      ARTKKELVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G8DTZ0      ARTKKELVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G8DU07      ARTKKELVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
A4VTU3      ARTKREGVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G7SNU6      ARTKREIVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
G8DU31      ARTKREIVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
D5AGQ5      ARTKREGVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
Q9X4U7      ARTKREGVNKTE-EYFNAIRTNIQL---S-G------------------ADIKVVGI-TS
A3CQY2      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
E8KLY9      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F0FHA8      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F0I4H5      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F0IAY3      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F0IJI2      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F0IS53      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F2C9N0      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F2CH53      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F3SM32      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F3UDW7      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F3UNJ4      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
F0FQQ5      VRKKRNLVKLTE-EYYNALSTNVQL---S-G------------------ANIKMVEI-SS
D6R2T8      VRKRRDLVKLTE-EYYNALSTNVQL---S-G------------------ANIKVVEV-TS
F3UUQ2      VRKRRDLVKLTE-EYYNALSTNVQL---S-G------------------ANIKVVEV-TS
E6IZC2      AKNKEKTIKKTE-EYYNALRTNIQL---S-G------------------DNIKVIAV-TS
G6A745      AKNKEKALKKSE-EYYNALRTNIQL---S-G------------------ENIKVIAV-TS
A8AZR3      SNNKKQSIQKTE-EYYNALRTNIQL---S-G------------------EDIKIVAV-TS
F9HJP6      STKKKNSIQRTE-EYYNALRTNIQL---S-G------------------ENIKIVSL-TS
Q4JYT9      EQKRLDFAKKAE-ENYNALRTNIQL---S-G------------------DNLRVLSI-SS
Q4JZY1      EQKRLDFAKKAE-ENYNALRTNIQL---S-G------------------DNLKVLSI-SS
E1LQJ7      AQKHLNFAKKAE-EHYNALRTNIQL---S-G------------------DNLKVLSI-SS
F9HC65      SKKRLDFAKKAE-EHYNALRTNIQL---S-G------------------DNLKVLAI-SS
E1LPE7      SQQKLNSVKKAE-EYYNALRTNVQL---S-G------------------NDLKVIVV-TS
F9MJW5      SQQKLNSVKKAE-EYYNALRTNVQL---S-G------------------NDLKVIVV-TS
E8KDN2      SVKRQAFVKKAE-EYYNALRTNIQL---S-G------------------DKLKVIAI-SS
E8K322      SEQRLHSVKKAE-EYYNALRTNIQL---S-G------------------DGLKVIAL-SS
F9PEU4      SEQRLHSVKKAE-EYYNALRTNIQL---S-G------------------DGLKVIAL-SS
F9PZP7      SQQRLNSVKKAE-EYYNALRTNIQL---S-G------------------DGLKVIAL-SS
C1CBD1      VQKKLEFIKKTE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q7WVX0      VQKKLEFIKKTE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
P96475      AQKKLEFIKKAE-EYYNTLCTNIQL---S-G------------------DKLKVISV-TS
Q9AHD2      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K2Q7      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0T5      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0E1      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q9AH95      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K1M4      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4JZ18      AQKKLEFIKKAE-EHYNALCTNIQL---S-G------------------DKLKVISV-TS
Q54520      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4JYH5      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0V2      AQKKLEFVKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
A5M4L1      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
B2ILP5      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
C1CCB9      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K1S7      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
P72512      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4JZ84      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0X5      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0Z6      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K195      AQKKLEFIKKAE-EHYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0A0      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K0K2      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K1F9      AQKKLEFIKKAE-EYYNALCTNIQL---S-G------------------DKLKVISV-TS
Q4K045      SQAKLDFVKKVE-ENYNALCTNLQL---S-G------------------DDLKVFSI-TS
G6C7Z1      SQAKLDLVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
D2ERX8      SQAKLDLVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
F9LZC4      SQAKLDLVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
F9P1W8      SQAKLDLVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
I0J9C9      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
A6YIA8      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4K005      SQAKLDFVKKAE-ENYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4JZL7      SHAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
E5F5C5      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4JZG7      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4JZK1      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
A5LJS0      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q9AHB7      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4K1B7      SQAKLDSVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4JYK8      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4K0M3      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q9AHA4      SQAKLDFVKKAE-EYYNSLCMNLQL---S-G------------------DGLKVFSI-TS
Q9X9A1      SQAKLDFVKKAE-EYYNSLCMNLQL---S-G------------------GGLKVFSI-TS
Q9ZII6      SQAKLDFVKKAE-EYYNSLCTNLQL---S-G------------------DGLKVFSI-TS
Q8KWQ0      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4JZW7      SQAKLDFVKKAE-ENYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4JYX9      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DNLRVFSI-TS
Q4K0R7      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DNLKVFSI-TS
Q4K1K6      SQAKLDFVKKAE-EYYNALCTNLQL---S-G------------------DGLKVFSI-TS
Q4JZS3      SQAKLDFVKKAE-ENYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4K0I2      SQAKLELAKKTE-EYYNALCTNPQL---S-G------------------DDLKVFSI-SS
Q4K254      SQAKLEPVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4K237      SQVKLELAKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
B1I967      SQAKLELVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
G6J8A4      SQAKLELVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
G6LKG5      SQAKLELVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q9ZFT8      SQAKLELVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
D6ZQI8      SQAKLELVKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4K2A8      SQVKLELAKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q8VU31      SQVKLELAKKAE-EYYNALCTNLQL---S-G------------------DDLKVFSI-TS
Q4K2E1      TQKKLEIVKKAE-EYYNALRTNIQL---S-G------------------DNLKVISI-TS
Q4K2F7      TQKKLEIVKKAE-EYYNALRTNIQL---S-G------------------DNLKVISI-TS
A5YTV7      SQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVIAI-TS
F9Q345      ------MARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
Q6L5R0      AQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
A5YTT9      AHKKLDQARKAE-EYYNALRTNIQL---S-G------------------NNLQVISI-TS
E6KKS0      AHKKLDQARKAE-EYYNALRTNIQL---S-G------------------NNLQVISI-TS
F2QF90      AHKKLDQARKAE-EYYNALRTNIQL---S-G------------------NNLQVISI-TS
E0Q2S8      VQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
A1ILY1      AQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVIAI-TS
Q6L5T0      AQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
E9FEC5      VQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
E0PPH9      VQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
F5VSG9      VQKKLDLARKAE-EYYNALRTNIQL---S-G------------------NNLKVISI-TS
E3CBS0      SKNKLQEIHKAE-EYFNALATNIQL---S-G------------------VNLKVIAV-SS
F9M366      SKNKLQEIHKAE-EYFNALATNIQL---S-G------------------VNLKVIAV-SS
E8K786      SKNKLQEVRKAE-EYFNALATNIQL---S-G------------------VDLKVIAI-SS
F8DFF4      SKNKLQEIHKAE-EYFNALATNIQL---S-G------------------VDLKVIAV-SS
I1ZPH7      SKNKLQEIHKAE-EYFNALATNIQL---S-G------------------VDLKVIAV-SS
E7S8W3      VKSKLAAMTQAE-EYFNALSTNIQL---S-G------------------TNIKVVAI-SS
D0RXH2      IKNKLAEMHQAE-EYFNALSTNIQL---S-G------------------SDIKVVAV-SS
Q83YR5      IKNKLAEMHQAE-EYFNALSTNIQL---S-G------------------SDIKVVAV-SS
Q8GP54      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
F8HDC3      VKSKADFAKKTE-EYYNAIRTNIQF---S-G------------------ANFKVIAV-SS
F8LJ75      VKSKADFAKKTE-EYYNAIRTNIQF---S-G------------------ANFKVIAV-SS
E9DM17      VNSKVNFAKQTE-EYYNAIRTNIQF---S-G------------------AQMKVIAV-SS
I0QIK6      VKSKVNFAKQTE-EYYNAIRTNIQF---S-G------------------AQMKVIAV-SS
E8KUY8      VKSKVQFAKQTE-EYYNAIRTNIQF---S-G------------------AQMKVISI-SS
Q7X553      VKSKVDFAKKTE-EYYNTIRTNIQF---S-G------------------AQMKVIAI-SS
Q8GP92      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQMKVIAI-SS
Q7X561      VKSKVNFAKQTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
Q7X549      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQMKVIAI-SS
G6ERT1      VKSKVDFAKKTE-EYYNTIRTNIQF---S-G------------------AQMKVIAI-SS
O87931      VKSKVDFAKKTE-EYYNTIRTNIQF---S-G------------------AQMKVIAI-SS
Q8GPF6      VKSKVNFAKQTE-ENYNAIRTNIQF---S-G------------------AQIKVIAI-SS
Q7X555      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
Q7X557      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
Q7X563      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQIKVIAV-SS
Q8GMA5      VKSKVNFAKQTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
Q8GPA8      VKSKVNFAKQTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
Q55205      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQIKVIAI-SS
C2LSE6      VKSKVNFAKQTE-EYYNAIRTNIQF---S-G------------------TQMKVIAI-SS
Q7X559      VKSKVNFFKQTE-EYYNAIRTNIQF---S-G------------------AQMKVIAI-SS
F8LXJ4      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQMKVIAI-SS
Q1WCR1      VKSKVDFAKKTE-EYYNAIRTNIQF---S-G------------------AQMKVIAI-SS
Q8GPC3      VKSKVNFFKQTE-EYYNAIRTNIQF---S-G------------------AQMKVIAI-SS
E8JMT9      VRAKAQMVKSME-EYYNSIRTNIQF---S-G------------------RDLKVITL-TS
F5X0J9      VRAKAQMIKSME-EYYNSIRTNIQF---S-G------------------RDLKVITL-TS
H2A602      VRAKAQMVKSME-EYYNSIRTNIQF---S-G------------------RDLKVITL-TS
E0PD83      VRSKAQMVKSME-EYYNSIRTNVQF---S-G------------------RDLKVITL-TS
F5X652      VRAKAQMVKSME-EYYNSIRTNVQF---S-G------------------RDLKVITL-TS
G5KD11      VRSKQELYNTAE-EYYNTIRTNIQF---S-G------------------RDLKVIVL-TS
B9DUJ4      VRSKQELYTRAE-EYYNSIRTNIQF---S-G------------------RDLRVIVL-TS
G5KAJ2      IRSKRDLFLAAE-EYYNSIRTNIQF---S-G------------------RDLRVIVL-TS
F1Z124      VKSKKELYDIAE-EYYNSIRTNIQF---S-G------------------RDLKVITL-TS
Q2KM74      VRSKREHYQHAE-EYYNSIRTNIQF---S-G------------------RDYKAIVL-TS
C6LDI8      AFEKLRTMDSVSREAYKALRTNITF---C-G------------------EDIKAIAI-TS
D4J4T6      NLTRIDDGEAVS-EYYKQLRTNIYF---C-G------------------QDKQCIAF-TS
D4LTH2      KLVFPDLPYAVE-EAMNRLRINVKF---C-G------------------KNTKKIML-TS
D4LG06      KVVFPDLPYAVE-EAMNRLRINVKF---C-G------------------KNTKKILL-TS
A7VF42      SIDFNEMPYAIE-EAMNRLRINIKF---C-G------------------KNTKKLLI-TS
A8SQS8      NVEFQELPYAVE-EAMNRLRINIKF---C-G------------------KNTKKILI-TS
D5HFS4      NIEFQELPYAVE-EAMNRLRINIKF---C-G------------------KNTRKILI-TS
C9LAS1      LTDIRKKDYFYE-EAIKTLRTNIQF---T-G------------------KNVKTIMF-TS
F3AH92      MKDPKRSDYFYE-EALKTLRTNIQF---S-N------------------KEVKVILL-TS
I5ASF8      LIDSEEGDCFYR-EEIKKLRANIVF---T-G------------------RKYKKIMF-TS
E7GL81      LMRDQKEDYQYE-EAIKTLRTNIQF---S-G------------------TNLQVIML-TS
G5F9E2      LMRDQKEDYQYE-EAIKTLRTNIQF---S-G------------------TNLQVIML-TS
E7GL57      LKRTAIEDYQYN-EAMKTLRTNIQF---S-G------------------TGIQVVML-TS
G5F9A9      LKRTAIEDYQYN-EAMKTLRTNIQF---S-G------------------TGIQVVML-TS
E7GL40      LKGFEVNDYQYE-EAMKTLRTNIQF---S-G------------------SNIHAVMF-TS
G5F9H2      LKGFEVNDYQYE-EAMKTLRTNIQF---S-G------------------SNIHAVMF-TS
A8RK85      LKNTGRKDYFYE-EAIKTLRTNIQF---C-G------------------SGLKTIMF-TS
G5HTB2      LKNTGEKNYHFE-ESIKTLRTNMQF---C-G------------------SSLKTIMF-TS
G5HNC5      LKNTGRKDYHYE-EAVKTLRTNIQF---C-G------------------NNLKTIMF-TS
C0CZV9      LNRSMKDDYHYN-EAVKTLRTNIQF---C-G------------------SGIRVIMM-TS
A8RSK9      LNRIMKDDYHYN-EAIKTLRTNIQF---C-G------------------NGIKTIML-TS
C5EN03      LNREMKDDYHYN-EAIKTLRTNIQF---C-G------------------SGIRTIML-TS
G5HG45      LNRDMKDDYHYN-EAIKTLRTNIQF---C-G------------------NGIRTIML-TS
D9ST44      VEHPNSQIS----EAYRTLRTNIQF---S-SLD----------------KNVKTIVV-TS
G2Z8Q3      KHQKGSKTA----EQFRMIRTNIEF---I-SKQ----------------RMLKIMMI-TS
C8W5K2      INNPKSPIA----EAYRILRTNIHF---S-VLN----------------KPLKTLLI-TS
A5V0I3      LRDPRSPAA----EAYRTLRTNIQF---S-SLD----------------KPLQTLLA-TS
F5LM71      HSNPMSPIS----ETYRTLRTNIQY---S-GVD----------------GEIRTLMV-TS
D7VBW4      LTAPMSVVT----EQVKTIRTNLNY---A-MVG----------------KPLKTLMI-TS
F9UQ54      LTAPMSVVT----EQVKTIRTNLNY---A-MVG----------------KPLKTLMI-TS
H6LKR8      LNDPTSHVT----ESYKLLRTNLNF---I-NLE----------------NKYQVLLF-TS
E0I7B5      ISNPKSPIS----EAYRTLRTNIQF---S-SVD----------------EPIKVIMI-AS
D7UYE4      HNKPKSIVS----EKFRGIRTNIMF---S-TAD----------------SEVKTVVV-TS
Q4A120      HKKPKAVVS----EKFRGIRSNILF---S-TAD----------------AEIQTLLI-AS
D9SVC7      YRDPDSITS----EIYRTLKTKLQF---V-NID----------------NDIRTLLV-TS
D9S1J9      MDDPKSVVS----EAFRVLRTNLQF---S-SID----------------RPLKKVVV-TS
C0GGR5      SKNAKSPVS----EAFRTIRTNIEF---S-DID----------------KDKKTLLT-TS
C6CSC8      VANPRSPVS----ETYRTLRTNIEF---A-AID----------------SALQVIMV-SS
A3ICA3      VSDIMSIPS----EQYRTIRANIKF---S-QPN----------------QDVKTILV-TS
B1HR41      VSDMMSIPS----EQYRTIRANIKF---S-QPN----------------QDVKTILV-TS
D6Y034      HFSPKSPIS----EQFRAIRTNIQF---A-SPD----------------ISLKRLLV-TS
Q8EME8      KINPRSPIS----EQYRTIRTNLQF---A-SVD----------------SDLRSILL-TS
F3Y922      MSDPASPIS----EQYKTIRTNIQY---A-MVD----------------KTLQTLAI-TS
G4L594      LIDPSSPVA----EQYRTIRTNIQF---ASSAD----------------QQVKTIVV-TS
C9B454      LTNPSSPIA----EQYRTIRTNIQF---ASAAG----------------QQIKTIVV-TS
Q3XYS6      LTNPSSPIS----EQYRTIRTNIQF---ASAAG----------------QQIKTIVV-TS
C9ALZ9      LTNPSSPIA----EQYRTIRTNIQF---ASAAG----------------QQIKTIVV-TS
C9BUG7      LTNPSSPIA----EQYRTIRTNIQF---ASAAG----------------QQIKTIVV-TS
D4RJF4      LTNPSSPIA----EQYRTIRTNIQF---ASAAG----------------QQIKTIVV-TS
C8ZXT9      LVDPSSPIS----EQYRTIRTNIQF---ASSAD----------------QQIKTLVV-TS
G5IRQ6      LVDPSSPIS----EQYRTIRTNIQF---ASSAD----------------QQIKTLVV-TS
C9A6V5      LIDPSSPIS----EQYRTIRTNIQF---ASSAD----------------KQIKTIVV-TS
C9CHY8      LVDPSSPIA----EQYRTIRTNIQF---ASSAD----------------KQIKTIVV-TS
Q814Z0      HQQPKSPIS----EQYRNIRTNIEF---A-AID----------------MNLHSLLV-TS
B9IRQ6      HQQPKSPIS----EQYRNIRTNIEF---A-AVD----------------TNLHSLMV-TS
B7HXB4      HQQPKSPIS----EQYRNIRTNVEF---A-SVD----------------TNLHSLMV-TS
Q72XH8      HQQPKSPIS----EQYRNIRTNIEF---A-AVD----------------KNLHSLMV-TS
A0RL70      HQQPKSPIS----EQYRNIRTNVEF---A-AVD----------------TNLHSLMV-TS
Q6HB09      HQQPKSPIS----EQYRNIRTNVEF---A-AVD----------------TNLHSLMV-TS
F0PU64      HQQPKSPIS----EQYRNIRTNVEF---A-AVD----------------TNLHSLMV-TS
B7HFH1      HQQPKSPIS----EQYRNIRTNIEF---A-AVD----------------TNLHSLMI-TS
B7IQS8      HQQPKSPIS----EQYRNIRTNIEF---A-AID----------------TNLHSLMV-TS
B3ZRD6      HQQPKSPIS----EQYRNIRTNIEF---A-AVD----------------TNLHSLMV-TS
B5UQ73      HQQPKSPIS----EQYRNIRTNIEF---A-AID----------------TNLHSLMV-TS
G9QCG3      HQQPKSPIS----EQYRNIRTNIEF---A-AID----------------TNLHSLMV-TS
Q3EV64      HQQPKSPIS----EQYRNIRTNIEF---A-AVD----------------TNLHSLMV-TS
Q5WBB4      DVNRRSPIT----EQYRTIRTNIEY---S-AVD----------------TEIKSLLV-TS
B1YMM5      VTQPKSPVA----EQYRTIRTNIEF---M-AVD----------------REIQVILV-TS
D7WMM8      IANGHSFIS----EQFRTIRTNITF---S-MPD----------------REIKTILV-TS
A7Z921      VLHHKSLVA----EQYRTIRTNIEF---S-SVQ----------------THLRSILV-TS
I2CAF2      VLHHKSLVA----EQYRTIRTNIEF---S-SVQ----------------THLRSILV-TS
A7Z9K0      MSEPKSINS----EQYRTIRTNIEF---S-SVD----------------TEVKSLLI-TS
I2CB16      MTEPKSINS----EQYRTIRTNIEF---S-SVD----------------TEVKSLLI-TS
I2HW53      MSEPKSINS----EQYRTIRTNIEF---S-SVD----------------TEVKSLLI-TS
G9QKR4      KLNPKSPIS----EQYRTIRTNIQF---A-SAD----------------GELRSFMV-TS
D5DBK3      HNSPKDPVA----EQYRTIRTNIQF---S-DAD----------------EEIKALLV-TS
D5DY81      HNSPKDPVA----EQYRTIRTNIQF---S-GAD----------------EDIKSLVL-TS
Q2BFS5      AYNTKSPIA----EQYRTVRTNIQF---S-SVD----------------QDVRSILV-TS
A4ITF3      FDDPKSPIS----EQYRTIRTNIQF---S-FID----------------EPLRSLMV-TS
C5D961      MEDPKSPIS----EQYRTIRTNVQF---S-FVD----------------KTMRSIMI-TS
G8MZ93      VDNPKSPIA----EQYRTIRTNIQF---S-FID----------------APLRSLIV-TS
F0G6H5      SRGGLADP--AI-ESLRNFRTTLQL---SLPD-----------------APNRIVLI-SG
F2I4B7      VVDNPTSA--MA-EQFRTIRTNIQF---SMLD-----------------KELKTFNV-TS
Q74BQ8      TLNDPHSY--VS-EEYRKLKSAIVA---GTSVG----------------EFRNTIMI-TS
F0JCB8      AMNEPISL--AA-EEFRKLKQSLVR---KTKRE----------------GFQNTILV-TS
Q314L3      TATAMQSG--LS-EEYRKLKERLVK---LTKRS----------------GFQNMLMV-TS
B5EA81      NLHDPHSP--AA-EEYRKLKSALVK---MTTGD----------------VFRNCLMV-TS
C6DZX5      NLHDPHSP--AA-EEYRKLKSALVK---MTTGD----------------VFRNCLMV-TS
A1ARV8      SLNDPASP--VA-EEYRKLKAILVK---MTSVH----------------PFKNVLMV-TS
C6CW37      VLLNPSSP--VA-EAYRTLRTNIQY---SSVD-----------------APIQLLMA-AS
G9RSY9      ------TPFQYQ-EAYKSLRTNLNF---MAMG-----------------KACKKLIF-TS
B9Y884      TILDPESS--AS-EAYRTLRTNILM---RNFDR-----------------DMKVINI-IS
A5Z5P9      LTKELPYA--VE-ESINRLRINVSF---LG--N-----------------EIKKIMV-VS
Q1AUN8      TLHDPSDP--AS-EAYRTLRTGLLY---AVVDA-----------------PPRVISL-TS
F2I6Z7      TAADPNHV--IS-EQFRTIRTNIQF---AIDAY-----------------HLKTLMF-TS
D4YHG7      TVTQPNDV--IS-ESFRQIRTNIQF---SMVDH-----------------DFKSIMF-TS
C1J9I3      AFAEPKHV--VS-EQFRTVRTNIEF---AGAAL----------------DRCQVVMF-TS
B1MZT1      AAAEPKNP--VS-EQFRTLRTNIDF---ASVAK----------------GNVKTLLV-SS
H1WR06      AAAEPKNP--VS-EQFRTLRTNIDF---ASVAK----------------GNVKTLLV-SS
H1X4N2      TAAEPKNP--VS-EQFRTLRTNIEF---AAVSR----------------GEIKTLLI-SS
Q03W95      TAAEPKNP--VS-EQFRTLRTNIEF---ASVAK----------------GEIKTLLI-SS
F0SX22      LNSDSAFS--TI-EEYKALRTNITF---CLPSG-----------------QCKIIGI-TS
B6W7H4      GYYNTTSV--FD-EAIRSVRTNIQF---SDIDN-----------------KKRVIAM-TS
F0GT81      NKYYTASL--YD-EAIRSLRTNIQF---SSLDN-----------------KNKVIAI-TS
B1R3X6      VDKDPKSI--AA-ESYRVLRTSLEY---SSIDK-----------------ELKSIVI-TS
Q8XN76      VDKDPKSI--AA-ESYRVLRTSLEY---SSIDK-----------------ELKSIVV-TS
B1BNK1      VDKDPKSI--AA-ESYRVLRTSLEY---SSIDK-----------------ELKSIVV-TS
B1V0N7      VDKEPKSI--AA-ESYRVLRTSLEY---SSIDK-----------------DLKSIVV-TS
Q0SVR8      LEKNPKSV--AA-ESYRTLRTNIQY---SSFDN-----------------PVKSIVI-TS
B1BNH3      LESNSQSV--AA-ESYRTLRTNIQY---SSFDN-----------------PVKSIVI-TS
Q8XN46      LESNSQSV--AA-ESYRTLRTNIQY---SSFDN-----------------PVKSIVI-TS
B1V1Z4      LESNSQSV--AA-ESYRTLRTNIQY---SSFDN-----------------PVKSIVI-TS
G5GFW0      PPNKEDYF--YN-EAIKALRTNIQF---CG--N-----------------NIHVIMI-TS
C2EFR6      RLDDIDFQ--SQ-ESFKTLRFNVEF---SG--E-----------------KNQVFYI-TS
F3ATF5      DPRQEDYF--YQ-EAIKTLRTNIQF---AG--M-----------------DVKTILF-TS
D4M2S0      DSRKEDVF--YE-EAIKTLRTNMQF---SG--V-----------------ETKSIVL-TS
F4BS19      TLIDPSSI--IS-EEFRTLRTNIQF---SMIDK-----------------ELKTLMV-TS
D4CG08      TDENRDFR--FE-EAIKTLRTNIQF---SG--P-----------------DIKTVMF-TS
D4MP30      TDENRDFR--FE-EAIKTLRTNIQF---SG--P-----------------DIKTVMF-TS
C6LCS5      TMTKLSFR--VS-EAYKSLRTNITF---CG--K-----------------DCRVIAI-TS
B0P2G2      LPEINDYR--MV-EGLNQLKTNLAF---CG--K-----------------DIKVITM-TS
D4MW29      LPEINDYR--MV-EGLNQLKTNLAF---CG--K-----------------DIKVITM-TS
E5VMX8      LPEINDYR--MV-EGLNQLKTNLAF---CG--K-----------------DIKVITM-TS
D4JMC2      QIKDQSYT--MK-ESLRALKTSISF---SG--K-----------------GVKSILF-TS
D6E0V4      QIKDQSYT--MK-ESLRALKTSISF---SG--K-----------------GVKSILF-TS
D6E330      KLKEQSYT--MK-ESLRALKTNIQF---CG--D-----------------DIRTLLV-TS
C4Z8M5      KLKEQSYT--MK-ESLRALKTNIQF---CG--D-----------------DIRTLLV-TS
D4JI67      KLKEQSYT--MK-ESLRALKTNIQF---CG--D-----------------DIRTLLV-TS
D3AC80      KHEKLDFR--AN-EAFKTLRTNILF---SG--H-----------------DTRVITL-TS
G5IFS3      KREQLDFR--AT-EAFKALRTNILF---CG--D-----------------NIKVIGL-TS
D4RX67      KIGKLDYR--TN-EAFKRLRTNILF---SG--S-----------------DVKCIAI-TS
A6BIG7      KVIK-DYR--SS-EAYKTLRTNIEF---SG--A-----------------DKKVIVF-TS
C0C0F8      NMTK-DYR--SN-EAYKTLRTNVEF---SG--A-----------------DNKVIVF-TS
Q97EP8      -KDKPKSP--IS-EAYRTLRSNIQF---SSFDK-----------------DMQLILI-TS
Q97ER5      -KDKPKSP--IA-EAYRTLRSNIQF---SSFDK-----------------DMQLILV-TS
D2RIR2      -ENDPKSP--IA-ETYRAIRTNLQF---AGAGQ-----------------DLKYICF-TS
G0VNK6      -HYDSRSP--VS-EAYRAIRTNLQF---AGAGK-----------------QLKTLVF-TS
I0GRR2      -HNDAKSP--IS-EAYRAIRTNLQF---AGAGK-----------------MIKFISF-TS
A0PZ02      -EKEPKSI--AA-EAYRTLRTNIQY---SSFDK-----------------ELKTIIV-TS
B1B736      -EKEPKSI--AA-EAYRTLRTNIQY---SSFDK-----------------ELKTIIV-TS
F6BI62      NVVNSKTT--VS-EAFRSLRTNLQF---TSVDK-----------------KVKSILI-TS
Q8RBS5      -LSDPKSP--FA-EAFRALRTNLQF---TGIDK-----------------KVKSILI-TS
G2MWC2      -VADPKSP--FA-EAFRALRTNLQF---TSVDK-----------------KVKSILI-TS
B0K4N1      -VADPKSP--FA-EAFRALRTNLQF---TSVDR-----------------KVKSILI-TS
B0KAR5      -VADPKSP--FA-EAFRALRTNLQF---TSVDR-----------------KVKSILI-TS
E8UV29      -VADPKSP--FA-EAFRALRTNLQF---TSVDR-----------------KVKSILI-TS
C7ISF7      -VADPKSP--FA-EAFRALRTNLQF---TSVDR-----------------KVKSILI-TS
F7K9V1      SIEKLDFR--TK-ESYKTLRTNLEF---SG-------------------KDRKVISI-TS
F7K8E9      AIEKLDFR--TK-ESYKTLRTNLEF---SG-------------------KDRRVISI-TS
F7KL96      AIEKLDFR--TK-ESYKTLRTNLEF---SG-------------------KDRRVISV-TS
C9AAE5      ----------IS-EQVKLIRENVEY---LCQQ-----------------QEAQTILI-TS
H7F6C8      --KDSYSP--TS-EQFKLIRTGIDF---SGID-----------------EKKQVILI-TS
H7F5T6      ALHEPSSP--QA-EYFRTIKTNIEM---MNID-----------------SKVKSLLI-TS
E6PYQ3      TLLAPRSA--SA-EAYRLLRTSISL---MPVS-----------------QKHRVIAL-TS
B1R3V1      LESNSQSV--AA-ESYRTLRTNIQY---SSFD-----------------NPVKSIVI-TS
I5B296      TASDPHSP--VS-EQFRLLKNNILF---PEKG-----------------TPPKTIMV-TS
D4YF13      TYFEPMSA--IA-EQYKTIRTNIEF---AQIG-----------------SSVKSIAV-TS
E6U7N4      SSGNVPFQ--FV-ESYKTLRTNLDF---IPID-----------------EPCKKFLI-TS
C8VYQ6      TLHSPKSP--IA-EAYRILRTNIQF---SSLD-----------------KPIKSLLV-TS
C0QCJ2      THLKPHSS--EA-EQFRILKTTILF---PKTG-----------------IPPRTIMV-TS
C2MBF8      VGRHRRSL--VS-EAFTVIRSNISF---LAPDN----------------GAPVKRILVTS
D3AE78      KLPRLDFR--AN-EAFKTLRTNITF---CG-------------------DAQRVILF-TS
Q39U17      TISEPRSP--VT-EEYRKLKSIILK---LTNS-----------------GQFKNTIMVTS
B9M2X6      SVTAPQTS--VA-EEYRKLKSLLVK---LTNG-----------------DRFRNTLMVTS
A5G424      TVNDPHTP--AA-EEYRKLKSILVK---LTKG-----------------EHFQNTLMVTS
E8WSZ5      TILDPHSQ--AA-EEYRKLKSMLVK---LTDG-----------------ENFKNAVMVTS
C7LPS3      VINAPLSP--MA-EEYRKLKEALVK---MTKR-----------------ERFDNLIAVTS
C3WFM9      FIQEDNME--AT-EAFRTVRTNLAF---QNDK-----------------EIGRKIMV-TS
A4J8V0      VLENPKSP--VA-EAYRIARTNIQF---AAVD-----------------KELKTLLI-TS
A8U9F4      TLTRPSSV--IA-EQFRTIRTNIQF---SMVD-----------------KNLKTLVI-TS
F4BSD9      TLTRPSSV--IA-EQFRTIRTNIQF---SMVD-----------------KNLKTLVI-TS
F7V792      GIQELSYA--LE-EAINRLRINVSF---MG-------------------KKVRKIMV-TS
F6IR93      TITAPMSV--VT-EQIKTIRTNLNY---AMVG-----------------KPLKTLMV-TS
G0M0F9      TITAPMSV--VT-EQIKTIRTNLNY---AMVG-----------------KPLKTLMV-TS
F6ITB4      AINEPMSV--IT-EQIKTIRTNINF---AASD-----------------RKLRTLMV-TS
G0M1X9      AINEPMSV--IT-EQIKTIRTNINF---AASD-----------------RKLRTLMV-TS
G0LYN9      TINEPKSV--IT-EQIKTIRTNINF---AATD-----------------KNLRTLMV-TS
D7VC13      TINEPMSV--IT-EQIKTIRTNINF---TATD-----------------HKLRTLMV-TS
F9UMZ6      TINEPMSV--IT-EQIKTIRTNINF---AATD-----------------HKLRTLMV-TS
G7QCG1      VLKSPASP--EA-EEFRKLKEALVK---AIRDP----------------DNFNNIILVTS
I2Q341      VLKSPASP--EA-EEFRKLKEALVK---AIRDP----------------DGFNNVILVTS
H8YYB9      LLNEVRSP--IV-DAYNVLRTRILQ---RLRA-----------------NAWNAVAI-TS
I5AV01      KQPDQDYF--TR-EAYKTLRANFLF---SG-------------------PEKKVIDV-TS
B0GAL3      DPRKSNYF--YE-EALKTLRTNIQF---AGAD-------------------IKTILV-TS
G1WUK2      DPRKSNYF--YE-EALKTLRTNIQF---AGAD-------------------IKTILV-TS
E0RZL3      SQSENNYQ--IK-EAYKTLRSNIEF---SG-------------------QNVKVVSV-TS
D8FLF8      TLANPQSV--IS-EQFRNIRTNINF---MNVD-----------------KEVKTIAF-TS
F0K0J7      TLANPQSV--IS-EQFRNIRTNINF---MNVD-----------------REVKTIVF-TS
Q1G8E4      TLANPQSV--IS-EQFRNIRTNINF---MNVD-----------------REVKTIVF-TS
C4VP08      TIAKPQSQ--IT-EQFRTVRTNINF---KAID-----------------HDINTLAF-TS
D6S4X4      TVAKPQSQ--TT-EQFRTVRTNINF---KAID-----------------HDINTLAF-TS
D0DJH0      TVADPRSA--IS-EQFRTIRTNSNF---MSVD-----------------KEIHTLAF-TS
C7XKF3      TVADPRSA--VS-EQFRTIRTNINF---MAVD-----------------EEISTLAF-TS
E3R264      TVADPRSA--VS-EQFRTIRTNINF---MAVD-----------------EEISTLAF-TS
D5GZJ8      TVADPRSA--VA-EQFRTIRTNINF---MAVD-----------------EEINTLAF-TS
C2EPK5      TVAKPKGP--VS-EQFRTIRTNINF---MAVD-----------------HDIKSVAF-TS
A4ZGZ8      TVADPKSP--VT-EQFRTIRTNINF---MAVD-----------------HDIKSVAF-TS
A8YX89      TVADPKSP--VT-EQFRTIRTNINF---MAVD-----------------HDIKSVAF-TS
F0NWJ7      TVADPKSP--VT-EQFRTIRTNINF---MAVD-----------------HNIKSVAF-TS
E4SMV5      TVAKPKSP--IA-EQFRTVRTNINF---MAVD-----------------HDIKSLAF-TS
F0TGY2      TVAKPKSP--IA-EQFRTVRTNINF---MAVD-----------------HDIKSLAF-TS
Q5FIC7      TVAKPKSP--IA-EQFRTVRTNINF---MAVD-----------------HDIKSLAF-TS
F2M2M6      TVAKPKSP--IA-EQFRTVRTNINF---MAVD-----------------HDIKSLAF-TS
G7M0Q3      VEDKPKSV--VS-EAYKTLRTNIQY---SSFD-----------------NEIKSLVI-TS
G7M1R9      VEKKPKSI--VS-EAYRTLRTNIQY---SSFD-----------------KQIRTIVV-TS
A6M2L9      VEDKPKSI--VA-EAYRTLRTNIQY---SSFD-----------------KEIRTIAV-TS
G7M566      VEEKPKSV--VS-EAYRTLRTNIQY---SSFD-----------------KEIRTIAV-TS
G2KUP1      VEYKPISP--IA-EQFRTVRTNIKF---SIVA-----------------NQNKVVSI-TS
G8PE06      AYTEPASV--IA-EQFRTIRTNIKF---SAID-----------------QKLKTIVF-TS
Q03GL8      TFTDPTST--IA-EQFRTVRTNIQF---SSVD-----------------KALKSIVF-TS
E0NHP4      TYNDPTST--IA-EQFRTVRTNIQF---SSVD-----------------KQLKSIVF-TS
F4FXQ7      TDVDPKDI--VS-EQFRTVRTNINF---SAVN-----------------QKLKTIIF-TS
C0WV35      TDVDPKDI--VS-EQFRTVRTNINF---SAVN-----------------QKLKTIIF-TS
H1LCW3      TDVDPKDI--VS-EQFRTVRTNINF---SAVN-----------------QKLKTIIF-TS
C2JZS1      TFAEPKHV--VS-EQFRTVRTNIEF---AGAAL----------------DKCQVIMF-TS
Q58Z10      TFAEPKHV--VS-EQFRTVRTNIEF---AGAAL----------------DQCQVVMF-TS
E9SAU1      SVAFP-----VT-EAYKNLRTNLSF---ALST-----------------KKNHIIAI-SS
Q38VG5      TLTSPTSV--IA-EQFRTIRTNIQF---SSID-----------------QKLRSIVF-TS
F0HVF1      TLANPQSV--IS-EQFRNIRTNINF---MNVD-----------------KEVKTIAF-TS
G6F8G9      TLANPQSV--IS-EQFRNIRTNINF---MNVD-----------------KEVKTIVF-TS
C2EWM3      TVKDPKNV--IS-EQFRTIRTNISF---MGID-----------------HPIKTLAF-TS
F8DRU2      TVAHPKSP--IS-EQFRTIRTNINF---MAID-----------------KPIKTLAM-TS
B3XL23      TVAHPKSP--IS-EQFRTIRTNINF---MAID-----------------KPIKTLAM-TS
F8KGP1      TVAHPKSP--IS-EQFRTIRTNINF---MAID-----------------KPIKSLAL-TS
H4GK03      TLTKPQSL--VA-EQFRTIKTNITF---MGVD-----------------HPIKALAF-TS
B2GF33      TLADPKSG--PA-EQFRTIRTNIHF---MSVD-----------------RPLKTVAF-TS
C0WW26      TLADPKSG--PA-EQFRTIRTNIHF---MSVD-----------------RPLKTVAF-TS
D0DSJ4      TLANPKSG--PA-EQFRTIRTNIHF---MSVD-----------------RPLKTVAF-TS
C0ZHV8      AHWEPLSP--LV-EGYRTLRLNIQF---SMGD-----------------KLMQTILV-TS
H1BJT1      SKNKNTYKFDNM-EAFRKLKTNIEF---SAVE-----------------KPIKVVNI-TS
F8FCE2      TEANPQSP--IS-ESYRTLRTNIDF---SLVD-----------------NDNKVIMV-TS
H6NE43      TEANPQSP--IS-ESYRTLRTNIDF---SLVD-----------------NDNKVIMV-TS
I0BSG4      TEANPQSP--IS-ESYRTLRTNIDF---SLVD-----------------NDNKVIMV-TS
Q83VF9      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
G8P3D7      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
O06030      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
G9M880      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
G6FD42      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
F9VC44      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
A9QSJ4      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
Q3ZK50      TSVNPQSP--IS-EQYRTIRTTIDF---KMAD-----------------QGIKSFLV-TS
E3GPC6      TYKSPKDP--IS-EAFRNMRTNITF---ADID-----------------EELRVLTI-TS
G0V447      LLKNPKSP--IS-EAYRTLRTNVQF---SSVD-----------------KNLKVILV-TS
H7F1R7      TYANPSSP--IA-EQFKTLRAGIHF---SSAD-----------------HKYKTILI-TS
E3H7M5      FFDRDKEH--IA-EAIRILRTNLYF---TES------------------KDRKVVLV-TS
E6UHY4      MDKNVAFP--VT-EAYKNLRTNISF---ALST-----------------KKNKIFAI-SS
D9QTC6      TNYSSKSP--LA-EAYRTLRTNIEF---LSPD-----------------DPLETMVI-TS
D9SR41      THLDPKSV--IS-ETYRTLRTNIQY---ANID-----------------GDLRSIII-TS
E3HB18      FKLDGQSP--VA-ESLRVLRTNIHF-----IDE----------------KEKKTVVV-TS
P95696      VYEKPKST--IS-EKFRGIRSNIMF---SKAN-----------------GEVKRLLV-TS
Q2G1K7      VYEKPKST--IS-EKFRGIRSNIMF---SKAN-----------------GEVKRLLV-TS
A8YPQ5      VHEQPKSP--IS-EKFRGIRSNIMF---ANPD-----------------SAVQSIVI-TS
Q2FUV2      VHEQPKSP--IS-EKFRGIRSNIMF---ANPD-----------------SAVQSIVI-TS
P39851      VHDKPKST--IS-EKFRGIRSNIMF---SNAE-----------------NEIKSLLI-TS
C5QNG4      VNDKPKSI--IS-EKFRGIRSNIMF---SRAK-----------------DEIVSIIV-TS
Q4L9H7      VHDKPKSV--AS-ERFRGIRSNIMF---SGV------------------EEANSIIV-TS
A7NQ71      ALRDPRSP--AA-EAYRTLRTNIQF---SSLD-----------------KPLHTLLA-TS
E4Q5T5      ALYNPRSP--IT-ESYRMLRTNIQY---SSLD-----------------KPIKTIVI-TS
E4SDX4      ALYNPRSP--IT-ESYRMLRTNIQY---SSLD-----------------KPIKTIVV-TS
E4S7Y6      AYYNPRSP--IT-ESYRMLRTNIQY---SSLD-----------------KPIKSLVI-TS
C6CS80      ADANPTSP--IS-EAYRTLRTNLQY---AETD-----------------RPLQLLMV-TS
E6LD64      TLIDKSSP--IS-EQYRTIRTNIQF---ASTVD----------------HEIKTIVV-TS
F0EKB9      TLIDPSSP--IS-EQYRTIRTNIQF---ASSAD----------------KQIKTIVV-TS
H7F571      TIVNPNGP--IS-EQFKTLRTGIHF---SSVD-----------------TNYKTIMV-TS
F5LE48      ADVNPKSQ--IS-EAYRVLRTNIQY---SSID-----------------KEITTILV-TS
E7RDR3      AFTTPRSV--VT-EQFRTLRTNINF---SSPD-----------------SEIRTMVV-TS
E7RG08      AFTNPKSR--VS-EQFRTLRTNIHF---TVPG-----------------GKVRSLVV-TS
F6CNF5      THKHPRSP--VA-EAYRVLRTNLGF---SGLD-----------------RPCRSILV-TS
G2FWX4      TLEESKSP--IS-EAYRTLRTNIQF---RSVN-----------------SENNKIMI-TS
G2FM59      TLEQTKSP--IS-EAYRMLRTNVQF---TSVD-----------------LDTQKIMI-TS
G7WJV1      TFEKTKSP--IS-EAYRTLRTNVQF---TNVD-----------------SNTQKIVV-TS
H5XZD4      TFEQTKSP--IS-EAYRSLRTNVQF---TSVD-----------------SDTQKIVV-TS
H5XZG7      THEQTKSP--IS-EAYRTLRTNVQF---TSVD-----------------SKTKKIMI-TS
G7W773      THEQTKSP--IS-EAYRTLRTNVQF---TSID-----------------TKTKRIMV-TS
G2FWT8      TLEQSKSP--IS-EAYRTLRTNVQF---TSVD-----------------SETKKIMI-TS
I4DBG8      TLEQSKSP--VS-EAFRTLRTNVQF---TSVD-----------------SQTKKIMV-TS
C0EBA6      VVLGKTSPFAIT-EAYKTMRTNLSF---ALAD-----------------AKNKRVVI-TS
Q9K6R0      THIKKNSP--IS-EQYRTIRTNIEF---AAVD-----------------RELKTIVV-TS
I2HVL2      SVLHHKSL--VA-EQYRTIRTNIEF---SSVQ-----------------THLRSILV-TS
D4G1R2      ------------------------------------------------------------
G4EQZ7      SVLHNKSV--VA-EQYRTIRTNIEF---SSVQ-----------------TNLRSILV-TS
P71051      SVLHNKSV--VA-EQYRTIRTNIEF---SSVQ-----------------TNLRSILV-TS
E0U2Z3      SVLHNKSI--VA-EQYRTIRTNIEF---SSVQ-----------------TNLRSILV-TS
G4P114      SVLHNKSI--VA-EQYRTIRTNIEF---SSVQ-----------------TNLRSILV-TS
A9VRC3      AHQQPKSP--IS-EQYRNIRTNVEF---ASVD-----------------TNLHSLMV-TS
C2QJY5      -------------------------------------------------------MI-TS
C2RG49      -------------------------------------------------MNLHSLLV-TS
C2T8T6      -------------------------------------------------MNLHSLLV-TS
C2MTG3      -------------------------------------------------------MV-TS
C2SSX8      -------------------------------------------------------MV-TS
C2YZB2      -------------------------------------------------------MV-TS
C3GBJ8      -------------------------------------------------------MV-TS
C2SBU4      -------------------------------------------------------MV-TS
C2NQN6      -------------------------------------------------------MV-TS
C3GRR0      -------------------------------------------------------MV-TS
C2PN22      -------------------------------------------------------MV-TS
C2Y452      -------------------------------------------------------MV-TS
C2WVG6      -------------------------------------------------------MV-TS
C3EBC0      -------------------------------------------------------MV-TS
C2XJH9      -------------------------------------------------------MF-TS
C2P8H3      -------------------------------------------------------MV-TS
C2ULR6      -------------------------------------------------------MV-TS
C2V4M2      -------------------------------------------------------MV-TS
C3H979      -------------------------------------------------------MV-TS
G2TR25      AKLNPKSP--IS-EQFRTIRTNISF---SSVD-----------------NDLQLLMV-TS
P96716      AMTEPKSL--NS-EQYRTIRTNIEF---ASVD-----------------RQMKSVMI-TS
G4EQF3      AMTEPKSL--NS-EQYRTIRTNIEF---ASVD-----------------RQMKSVMI-TS
D4G2E1      AMTEPKSL--NS-EQYRTIRTNIEF---ASVD-----------------RQMKSVMI-TS
I0F9R6      AMTEPKSL--NS-EQYRTIRTNIEF---ASVD-----------------RQMKSVMI-TS
E0TTZ6      AMTEPKSL--NS-EQYRTIRTNIEF---ASVD-----------------RQMKTVMI-TS
G4P1M7      AMTEPKSL--NS-EQYRTIRTNIEF---ASVD-----------------RQMKSVMI-TS
A8FHL9      SVLNPHSV--IA-EQFRTIRTNIEF---TSIQ-----------------TRLKSILV-TS
Q5KUM5      TVDNPKSP--IA-EQYRTIRTNIQF---SFID-----------------APLRSLIV-TS
D3FZP4      SHSNPKSP--IA-EQYRTLRTNIQF---ANMDG----------------EEMRSILV-TS
I0JRK4      ANDNPKSP--IA-EQYRTIRTNLQF---ASVD-----------------KELETMIV-TS
I3EBB3      TKLNPKSP--IS-EQYRTIRTNIQF---SSID-----------------KEIRSLIV-TS
E3CP62      LVKSKVQFAKQTEEYYNAIRTNIQF---SGAQM-------------------KVISI-SS
C2KHF1      AAEPK----NHVSEQFRTLRTNIEF---AAVSR----------------GEIKTLLI-SS
I0UTA5      GSSND----HIAQESIRQLRTNLRF---VNIDE----------------PP-RSFLV-TS
B7BDT8      HQGKR----DIVNEAFRVLRTNLEFILDAKEDK----------------DKASVTLI-TS
G9WIQ9      LDDPQ----DVVSEQFRVLRANIDF---AAATI----------------NHFQTILF-TS
A0NKF6      VQDPQ----NVVAEQFRVLRANIDF---AAASL----------------KNFKTVLF-TS
Q04DV8      VQDPQ----NVVAEQFRVLRANIDF---AAASL----------------KNFKTVLF-TS
E7T801      VDNPA----DSAVEAVRALRTSLHF---AMMET----------------EN-NILMI-TG
F4SM97      IENPA----DLAIESIRGLRTSLHF---AMMEA----------------RN-NILMI-SG
G5Q4J0      VGNPT----DLAIEAIRSLRTSLHF---AMMQA----------------QN-NVLML-TG
G5LQM6      VGNPT----DLAIEAIRSLRTSLHF---AMMQA----------------QN-NVLML-TG
G5SDT8      VGNPT----DLAIEAIRSLRTSLHF---AMMQA----------------QN-NVLML-TG
F3CAY9      IAAPG----ELAIESLRSLRTSLHF---AMLEA----------------RN-NVLMI-SS
A3K8W7      ---------DPAHATFDVLRTRLMH---TLSER----------------GW-KRVAV-TS
G7EJX6      ---------RRFAESVRTFRTSLLL---TQLER----------------DL-KVIAV-TS
B7B947      ------------SEAFRIVRTNMDF---MRVKE----------------KNMQVVMF-TS
D3LB10      VQDPQ----DVVAGQFRVLRANI-D---FAAASL---------------KNFKTVLF-TS
S9QRP1      ------------HTAFDVLRTRL-L---QALAE----------------HGWTRVAI-TS
G8AU96      RNEAT----WNLPLHPDSRRARE-I---GAFREAIQTVRTMACMPRKRGTPPKVLLV-TS
D0D9W0      ------------HAAFDILRTKL-L---QGLAD----------------HGWKRVAI-TS
Q0FMP0      ------------HAAFDVLRTRL-L---QALAE----------------RGWTRVAI-TS
A3W0H7      ------------HVAFDVLRTKL-L---AALRA----------------NGWHRVAI-TS
I1AYC5      ------------HAAFDVLRTRL-L---QALSE----------------NGWRRVAI-TS
                                                                        

E9TE88      VSPS-IGKTFVCANLAAVIS-Q-T-NKRVLLIDCDMRKG-YT--HELLGTN--------N
B8D0N2      TGPGAEGKSTISVNLAFAFA-E-I-GKRVMLVDADLRKP-RL--HKILSIN--------P
C2CI44      TKPS-EGKSTVIYKLAKSFA-D-N-GERVILIDCDLRSP-SL--YEIAGIN-----D---
C7RGH6      TKPA-EGKSTVIYKLAKSFA-D-N-GDKVILLDCDLRSP-SI--SEIAGIN-----D---
C0CK73      TMPS-EGKSTVSLELARSFA-A-L-GKNTVLMDCDMRKS-YL--VRRLGIQ-----E--K
Q1WTC8      TYPN-EGKSTVSLELALAFS-D-N-GKKALLIDADLRKS-VS--RQLIRTG-----S--I
E8JWI5      TFPG-EGKTTTSTNLALTFA-K-A-GHKTLLIDADIRNSKML--GGVFKSG-----E--K
F3AHH0      CTPN-EGKSSVTLNLAVSLA-E-S-GKKVLLLDADLRKS-ML--LGRTKIK-----G--T
F7K0U1      CTPN-EGKSTVSLSVASSLA-E-S-GKKVLFIDADLRKS-VL--AGRHRVQ-----G--E
C4Z672      TTPG-EGKSTVSFELAMSFA-Q-N-GMKTLLIDADTRKS-VM--KNRWRKG-----K--I
P0C0T9      VREG-EGKSTTSTSLALSLA-Q-A-GFKTLLIDADTRNS-VM--SGTFKAT-----G--T
Q04663      VREG-EGKSTTSTSLALSLA-Q-A-GFKTLLIDADTRNS-VM--SGTFKAT-----G--T
Q67AY4      VREG-EGKSTTSTSLALSLA-Q-A-GFKTLLIDADTRNS-VM--SGTFKAT-----G--T
Q3K0T0      VREG-EGKSTTSTSLALSLA-Q-A-GFKTLLIDADTRNS-VM--SGTFKAT-----G--T
C5NWJ8      TSEN-EGKSTVSTNLAISLA-K-L-GLKTILVDADTRKS-VM--AGRFKFK-----H--K
F3A499      TSEN-EGKSTVSTNLAISLA-K-L-GLKTILVDADTRKS-VM--AGRFKFK-----H--K
Q4JZ55      TVKN-EGKSTISVGLSMSLA-L-S-GYKVLLLDVDLRNS-VM--SGMFHSR-----E--R
G5JTD5      VQPK-EGKSTTTMSLAVSFA-R-A-GYRTLLIDADTRNS-VM--MGSFKPD-----G--P
G3G7C1      VQLN-EGKSTIAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPI-----T--K
G3G7J9      VQLN-KGKSTIAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--SGFFEPI-----T--K
G3G7G6      VQSN-EGKSRTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPV-----T--K
G8DUB0      VQSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPI-----T--K
G3G7I8      VQSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPI-----T--K
G3G7J4      VQSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--PGFFKPI-----T--K
G7SG34      VQSN-EGKSTTAASLALAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPI-----T--K
G8DTZ0      VQSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPI-----T--K
G8DU07      VQSN-EGKSTTAASLALAYA-R-S-GYKTVLVDADIRNS-VM--SGFFKPI-----T--K
A4VTU3      VKSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--PGFFKPI-----T--K
G7SNU6      VQSN-EGKSTTAASLAIAYA-R-S-DYKTVLVDADIRNS-VM--PGFFKPI-----T--K
G8DU31      VQSN-EGKSTTAASLAIAYA-R-S-DYKTVLVDADIRNS-VM--PGFFKPI-----T--K
D5AGQ5      VKSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--PGFFKPI-----T--K
Q9X4U7      VKSN-EGKSTTAASLAIAYA-R-S-GYKTVLVDADIRNS-VM--PGFFKPI-----T--K
A3CQY2      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
E8KLY9      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F0FHA8      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F0I4H5      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F0IAY3      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F0IJI2      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F0IS53      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F2C9N0      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F2CH53      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F3SM32      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F3UDW7      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F3UNJ4      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
F0FQQ5      VTAN-EGKSTTSVNLAAAFA-R-A-GHKTLMIDADIRNS-VM--SGVFSSQ-----R--K
D6R2T8      VMPN-EGKSTTSTNLAIAFA-R-S-GYKTLLIDSDIRNS-VM--SGVFKSH-----G--K
F3UUQ2      VMPN-EGKSTTSTNLAIAFA-R-S-GYKTLLIDSDIRNS-VM--SGVFKSH-----G--K
E6IZC2      VQSG-EGKSTTSTNLAIAFA-R-S-GYNTLLIDADIRNS-VM--SGIFKTR-----D--K
G6A745      VQSG-EGKSTTSTNLAIAFA-R-S-GYNTLLIDADIRNS-VM--SGVFKTR-----D--K
A8AZR3      VQPN-EGKSTTSTNLAIAFA-R-A-GYTTLLIDADIRNS-IM--SGVFKSK-----E--K
F9HJP6      VHPN-EGKSTTSTNLAIAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSS-----A--K
Q4JYT9      VKPG-EGKSTTSINIAWAFA-R-A-GYKALLVDADIRNS-IM--SGVFKSR-----E--K
Q4JZY1      VKPG-EGKSVTSMNIAWAFA-R-A-GYKALLVDADIRNS-IM--SGVFKSR-----E--K
E1LQJ7      VKSG-EGKSTTSINIAWAFA-R-A-GYKTLLVDADIRNS-VM--SGVFKSR-----E--K
F9HC65      VKPG-EGKSTTATNIAWAFA-R-A-GYKTLLVDADIRNS-VM--SGVFKSR-----E--K
E1LPE7      VDSS-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--R
F9MJW5      VDSS-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--R
E8KDN2      VRPG-EGKSTTSINIAWAFA-R-A-GYKTLLVDADIRNS-VM--SGDFMSR-----E--K
E8K322      VRPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
F9PEU4      VRPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
F9PZP7      VRPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
C1CBD1      VNPG-EGKTTTSINIAWSFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKSR-----E--K
Q7WVX0      VNPG-EGKTTTSINIAWSFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKSR-----E--K
P96475      VNPG-EGKTTTSVNIAMSFA-R-A-GYKTLLFDGDIRNS-VM--SGFFKSR-----E--K
Q9AHD2      VNPG-EGKTTTSINIAWSFA-R-A-GYKTLLIDGDTRNS-VM--LGVFKSR-----E--K
Q4K2Q7      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLLDGDTRNS-VI--SGFFKSR-----E--K
Q4K0T5      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4K0E1      VNPG-EGKTTTSVNIAWSFA-R-A-GYKTLLIDGDTRNS-VM--SGVFKSR-----E--K
Q9AH95      VNPG-EGKTTTSINIAWSFA-R-A-GYKTLLIDGDTRQS-VM--SGVFKSR-----E--K
Q4K1M4      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VM--SGFFKSR-----E--K
Q4JZ18      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VM--SGFFKSR-----E--K
Q54520      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VM--SGFFKSR-----E--K
Q4JYH5      VNPG-EGKTTTSVSIARSFA-R-A-GYKTLLIDGDIRNS-VM--SGFFKSR-----E--K
Q4K0V2      VNPE-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VM--SGFFKSR-----E--K
A5M4L1      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
B2ILP5      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
C1CCB9      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4K1S7      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
P72512      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4JZ84      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4K0X5      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4K0Z6      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4K195      VSPG-EGKTTTSVNIAWSFA-R-A-GYKTLLIDGDTRNS-VI--SGFFKSR-----E--K
Q4K0A0      VNPG-EGKTTTSVNIARSFA-R-A-GYKTLLIDGDTRNS-VI--SGVFKSR-----E--K
Q4K0K2      VSPG-EGKTTTSVNIAWSFA-R-A-GYKTLLIDGDTRNS-VI--SGFFKSR-----E--K
Q4K1F9      VSPG-EGKTTTSVNIAWSFA-R-A-GYKTLLIDGDIRNS-VI--SGFFKSR-----E--K
Q4K045      VKLG-EGKSMTSTSIAWTFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
G6C7Z1      VKAG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKAR-----D--K
D2ERX8      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKAR-----D--K
F9LZC4      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKAR-----D--K
F9P1W8      VNPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKAR-----D--K
I0J9C9      VKLG-EGKSTTSTNIAWAFA-H-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
A6YIA8      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4K005      VKAG-EGKSMTSTNIAWAFA-H-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4JZL7      VKIG-EGKSTTSANIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----N--K
E5F5C5      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----N--K
Q4JZG7      VKIG-EGKSTTSANIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----N--K
Q4JZK1      VKIG-EGKSTTSANIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----N--K
A5LJS0      VKIG-EGKSTNSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q9AHB7      VKIG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4K1B7      VKIG-EGKSTTSANIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----N--K
Q4JYK8      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4K0M3      VKLG-EGKSTTSTNIAWAFA-H-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q9AHA4      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q9X9A1      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q9ZII6      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q8KWQ0      VKLG-EGKSTTSINIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4JZW7      VKLG-EGKSTTSTNIAWAFA-H-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4JYX9      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKAR-----D--K
Q4K0R7      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--SGVFKAR-----D--K
Q4K1K6      VKLG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDGDIRNS-VM--LGVFKAR-----D--K
Q4JZS3      VKQG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--LGVFKAR-----D--K
Q4K0I2      VKAG-EGKTTTSTNIAWAFA-H-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
Q4K254      VKAG-EGKTTTSINIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKPR-----E--R
Q4K237      VKAG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
B1I967      VKAG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
G6J8A4      VKAG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
G6LKG5      VKAG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
Q9ZFT8      VKAG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
D6ZQI8      VKVG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
Q4K2A8      VKPG-EGKTTTSTNIAWAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKPR-----E--R
Q8VU31      VKPG-EGKTTTSTNIARAFA-R-A-GYKTLLIDADMRNS-VM--SGVFKSR-----E--R
Q4K2E1      VKPG-EGKSTTSTNIAWAFA-H-A-GYKTLLIDADIRNS-VM--SGVFRSS-----E--K
Q4K2F7      VKPG-EGKSTTSTNIAWAFA-H-A-GYKTLLIDADIRNS-VM--SGVFRSS-----E--K
A5YTV7      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
F9Q345      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
Q6L5R0      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
A5YTT9      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
E6KKS0      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
F2QF90      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
E0Q2S8      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
A1ILY1      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
Q6L5T0      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
E9FEC5      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
E0PPH9      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
F5VSG9      VKPG-EGKSTTSTNIAWAFA-R-A-GYKTLLIDADIRNS-VM--SGVFKSR-----E--K
E3CBS0      VQEN-EGKSTTSTNLAVAFA-R-A-GYKTLLVDCDIRNS-VM--TGVFRSR-----D--K
F9M366      VKEN-EGKSTTSTNLAVAFA-R-A-GYKTLLVDCDIRNS-VM--TGVFRSR-----D--K
E8K786      VQEN-EGKSTTSTNLAVAFA-R-A-GYKTLLVDCDIRNS-VM--TGVFRSR-----D--K
F8DFF4      VQEN-EGKSTTSTNLAVAFA-R-A-GYKTLLVDCDIRNS-VM--TGVFRSR-----E--K
I1ZPH7      VQEN-EGKSTTSTNLAVAFA-R-A-GYKTLLVDCDIRNS-VM--TGVFRSR-----E--K
E7S8W3      VQPN-EGKSTISTNLATAFA-R-A-GYRTLLIDADIRNS-VM--TGVFKSQ-----G--R
D0RXH2      VQPN-EGKSTISINLSLAFA-R-A-GYRTLLIDADIRNS-VM--TGVFKSQ-----R--K
Q83YR5      VQPN-EGKSTISINLSLAFA-R-A-GYRTLLIDADIRNS-VM--TGVFKSQ-----R--K
Q8GP54      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
F8HDC3      VQPG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
F8LJ75      VQPG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
E9DM17      VEAG-EGKSTTSVNIAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
I0QIK6      VEAG-EGKSTTSVNIAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
E8KUY8      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLFIDADTRNS-VL--SGTFKSN-----A--P
Q7X553      VEAR-EGKSTTSVNLAISFA-S-V-GLPTLLIDADTRNS-VL--SGTFKSN-----E--P
Q8GP92      VEVG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q7X561      VEAG-EGKSPTSLNLAISFA-S-V-GLRTLLIDADTRNS-VF--SGTFKTN-----E--P
Q7X549      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
G6ERT1      VEAR-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
O87931      VEAR-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q8GPF6      VEVG-EGKTTTSVNLAISFA-S-I-GIRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q7X555      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q7X557      VEVG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q7X563      VEAG-EGKSAISVNLAISFA-S-V-GLRTLLIDADLRNS-VL--SGTFKSN-----E--P
Q8GMA5      VEAG-EGKSTTSLNLAISFA-S-V-GLRTLLIDADTRNS-VF--SGTFKSN-----E--P
Q8GPA8      VEAG-EGKSTTSLNLAISFA-S-V-GLRTLLIDADTRNS-VF--SGTFKTN-----E--P
Q55205      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
C2LSE6      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q7X559      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
F8LXJ4      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q1WCR1      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
Q8GPC3      VEAG-EGKSTTSVNLAISFA-S-V-GLRTLLIDADTRNS-VL--SGTFKSN-----E--P
E8JMT9      AQPG-EGKSTTSVNLAISFA-H-A-GFRTLLIDADTRNS-VM--SGTFKSN-----E--R
F5X0J9      AQPG-EGKSTTSVNLAISFA-R-A-GFRTLLIDADTRNS-VM--SGTFKSN-----E--R
H2A602      AQSG-EGKSTTSVNLAISFA-R-A-GFRTLLIDADTRNS-VM--SGTFKSK-----E--R
E0PD83      AQAG-EGKSTTSVNLAISFA-R-A-GFRTLLIDADTRNS-VM--SGTFKSN-----E--R
F5X652      AQAG-EGKSTTSVNLAISFA-R-A-GFRTLLIDADTRNS-VM--SGTFKSN-----E--R
G5KD11      VQPN-EGKSTTSVNLAISLA-K-A-GLKTLLIDADIRNS-VM--SGTFKSD-----S--K
B9DUJ4      VQPN-EGKSTTSVNLAVSFA-K-A-GLKTLLIDADIRNS-VI--SGTFKAD-----E--K
G5KAJ2      VQPG-EGKSTSSINLAVSFA-N-A-GFKTLLIDADIRNS-VM--SGTFKSD-----E--K
F1Z124      VQPG-EGKSTTSANIAISFA-K-A-GLKTLLIDADIRNS-VM--SGTFKAD-----E--K
Q2KM74      VQPG-EGKSTTSINLAISFA-K-A-GFKTLLIDADVRNS-VM--SGAFKSD-----D--R
C6LDI8      SMPN-EGKSTVAFSLAQAFA-E-D-NKQVLLIDADNRKS-TL--EYRYGVD-----R--T
D4J4T6      SFPN-EGKSTVVFNLCKALA-E-D-GKRVILLDADLRKS-VL--YNRCMPD-----Q--E
D4LTH2      CLPN-EGKSTVAVYLWKMLA-E-A-GFPSVLVDVDLRNS-VL--MKSVQVD-----V-SD
D4LG06      CMPN-EGKSTVSSYLWKMLA-E-A-GFSTVMVDVDLRKS-VQ--MQRMQVE-----NASE
A7VF42      SLPN-EGKSTISINLWKMMA-E-A-GFPTVFLDVDLRKS-VI--KGRHNMK-----SESE
A8SQS8      SMPN-EGKSSIAINLWKMLA-E-A-GFPTVLVDVDLRKS-VI--KERHHIN-----NTEK
D5HFS4      SMPN-EGKSSVAINLWKMLA-E-A-GFPAVLVDVDLRKS-VI--KDRHHIK-----DADK
C9LAS1      CFPN-EGKSDVTFQLCQEIG-N-M-GKRVLLIDADIRKS-AY--VSRYRIK-----Q--K
F3AH92      CYPN-EGKSDIAFNLSKEMG-S-I-GKKVLLLDADIRKS-VY--VKRYSVK-----Q--E
I5ASF8      CFQG-EGKSDTVFHLAVDMT-K-L-GKRVLLIDADIRNS-QY--VSRFGVK-----Q--H
E7GL81      AVPN-EGKSEISFSLASSLA-Q-I-DNRVLLIDADVRKS-VL--VTRYKLD-----R--K
G5F9E2      AVPN-EGKSEISFSLASSLA-Q-I-DNRVLLIDADVRKS-VL--VTRYKLD-----R--K
E7GL57      SVPG-EGKSETTFHLAASLA-Q-L-DKKVLLIDADIRKS-IL--VTRYQLD-----R--R
G5F9A9      SVPG-EGKSETTFHLAASLA-Q-L-DKKVLLIDADIRKS-IL--VTRYQLD-----R--R
E7GL40      SAPN-EGKSETTFQLAASMV-Q-L-GKKVLLIDADIRKS-VL--VSRYHLE-----H--Q
G5F9H2      SAPN-EGKSETTFQLAASMA-Q-L-GKKVLLIDADIRKS-VL--VSRYHLE-----H--Q
A8RK85      SMPD-EGKSETAFALASSFG-N-I-GKKVLLVDADIRKS-VM--VKRYEIK-----G--N
G5HTB2      SLPN-EGKSEITFSVAASLG-S-I-GKKVLMIDADIRKS-VL--IKRYEIK-----G--N
G5HNC5      SLPS-EGKSDTTFAVAASFG-S-I-GKKVLLIDGDIRKS-VI--VKRHEIQ-----G--N
C0CZV9      ALPD-EGKSDMAFALASSLA-Q-I-GKRVLLIDADIRKS-VL--VSRYQLE-----D--E
A8RSK9      SLPD-EGKSDITFAMASSLA-Q-I-GKRVVMIDADIRKS-VL--VSRYQLE-----H--E
C5EN03      SLPD-EGKSDITFAMASSLA-Q-I-GKKVVMIDADIRKS-VL--VSRYQLD-----T--E
G5HG45      SLPD-EGKSDITFAMAASLA-Q-I-GKKVVMIDADIRKS-VL--VSRYQLE-----T--E
D9ST44      SVAG-EGKSTTCANLGVVMA-E-N-GYNTILIDCDFRNP-SL--HRQFNIP--------N
G2Z8Q3      TKPQ-EGKSTIIANLADVMG-R-Q-ELKVLIIDADLRLP-SQ--HYILGVD--------N
C8W5K2      AGCG-EGKTLTVANLGVAFA-Q-A-GEKAVLLDCDFRKP-GL--HTVFGQS--------N
A5V0I3      TAPD-EGKSTTLANLAVTIA-Q-A-EQRVILVDCDLRRP-SL--HTLFGLS--------N
F5LM71      ASPW-EGKSTTIDNLAVVYA-Q-T-DKKVLLIDADLRKP-TA--HRTFGLS--------N
D7VBW4      AIQG-EGKSTVGSNLAVEYA-K-K-GLQVLLVDADLRRP-TI--HQTFAIS--------N
F9UQ54      AIQG-EGKSTVSSNLAVEYA-K-K-GLQVLLVDADLRRP-TI--HQTFAIS--------N
H6LKR8      AAKE-EGKTTTIANLAITLA-Q-S-GKRVLLIDADLRLP-RI--GKIFDIS-----L--N
E0I7B5      AQAG-EGKTTTVTNLAITYA-M-E-GKRVLLIDADLRKP-SL--HRMFDLS--------N
D7UYE4      EKPS-SGKSTISANLAITYA-Q-A-GFKTLLIDGDMRKP-TQ--HYQFNKS--------N
Q4A120      DKPS-SGKSTVSANIAVTYA-Q-A-GFKTLLIDGDMRKP-TQ--HYIFNKN--------N
D9SVC7      ASKA-EGKSTTTANLAITVA-Q-S-GRKVLIIDSDIRKP-YI--HKLFSLP--------N
D9S1J9      SIPQ-EGKSTVIANLAVSIA-S-A-GSRVLLVDADLRRP-KL--YKLFLLE--------N
C0GGR5      ATQG-EGKSVVTANLGVTMA-M-A-GKRVLILDADLRNP-TM--HKIFNVR--------N
C6CSC8      AGPG-EGKSTTIANLAVTFS-Q-S-DRKVVLIDADMRKP-TA--HKTFQIS--------N
A3ICA3      SIAG-EGKSTNAANIGVVFS-Q-E-GKRVLIIDADMRKP-TL--HHTFYLD--------N
B1HR41      SIAG-EGKSTNAANIGVVFS-Q-E-GKRVLIIDADMRKP-TL--HHTFYLD--------N
D6Y034      TSPG-EGKSTTAANLAIVLA-Q-Q-ENRVLLIDGDMRKP-TG--HFTFQLP--------N
Q8EME8      AGPS-EGKSMTTANLAIVYA-Q-Q-GKRVLLVDADLRKP-TI--HYTFRLD--------N
F3Y922      SNAS-EGKSTSTINLAIVFA-N-S-NKKVLLVDADMRNP-TI--AKTFELI--------N
G4L594      SGPS-EGKSLSSANLAAVFA-Q-T-GQKVLLVDADLRKP-TI--HKTFQLN--------N
C9B454      SGPG-EGKSTIAANIAVVFA-K-S-GQRVLLVDADLRKP-VV--YETFQLN--------N
Q3XYS6      SGPG-EGKSTTAANIAVVFA-K-S-GQRVLLVDADLRKP-VV--YKTFQLN--------N
C9ALZ9      SGPG-EGKSTTAANIAVVFA-K-S-GQRVLLVDADLRKP-VI--YKTFKLN--------N
C9BUG7      SGPG-EGKSTTAANIAVVFA-K-S-GQRVLLVDADLRKP-VV--YKTFQLN--------N
D4RJF4      SGPG-EGKSTTSANIAVVFA-K-S-GQRVLLVDADLRKP-VV--YKAFQLN--------N
C8ZXT9      SGPG-EGKSTTSANLAVVFA-K-S-GQRVLLVDADMRKP-TV--HKTFNLL--------N
G5IRQ6      SGPG-EGKSTTSANLAVVFA-K-S-GQRVLLVDADMRKP-TV--HKTFNLL--------N
C9A6V5      SGPG-EGKSTTSANLAVVFA-K-S-GQRVLLVDADMRKP-TV--YKTFSLN--------N
C9CHY8      SGPA-EGKSTTSANLAVVFA-K-S-GQRVLLVDADMRKP-TV--YKTFNLN--------N
Q814Z0      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
B9IRQ6      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
B7HXB4      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
Q72XH8      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
A0RL70      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
Q6HB09      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
F0PU64      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
B7HFH1      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
B7IQS8      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
B3ZRD6      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
B5UQ73      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
G9QCG3      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
Q3EV64      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD--------N
Q5WBB4      AGPG-EGKSTTASNLAVVIA-Q-N-GQTVLLIDADMRKP-TA--HYTFGLM--------N
B1YMM5      ATQG-EGKSTTSSNLAVAYA-Q-Q-GKKVLIIDTDMRRP-TV--HYTFRVA--------N
D7WMM8      ATPG-EGKSTNAANIGVVFA-Q-E-GKRVVIVDADLRKP-TM--HYTFLLQ--------N
A7Z921      SVPG-EGKSFSAANLAAVFA-Q-Q-EKKVLLVDADLRKP-TI--HETYQLE--------N
I2CAF2      SVPG-EGKSFSAANLAAVFA-Q-Q-EKKVLLVDADLRKP-TI--HETYQLE--------N
A7Z9K0      AGPE-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HFTFKLD--------N
I2CB16      AGPE-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HFTFKLD--------N
I2HW53      AGPE-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HFTFKLD--------N
G9QKR4      ASQG-EGKSTTAANLAIVFA-Q-Q-GKRVLLVDSDLRKP-TM--HYTFRVT--------N
D5DBK3      SGSA-EGKSTTASNLATVYA-Q-Q-GLKVLLIDADLRKP-TA--HYTFRLE--------N
D5DY81      SGPS-EGKSTTAANLATVYA-Q-Q-GLNVLLIDGDLRKP-TA--HYTFRLE--------N
Q2BFS5      SGPG-EGKSTTVANLAVVFA-Q-Q-NKRVLLVDADLRKP-TA--HYTFNLT--------N
A4ITF3      SAPS-EGKSTTAANLAVVFA-Q-Q-GKKTLLVDADLRKP-TV--HYTFRLN--------N
C5D961      AGPG-EGKSTTTVNLAIVFA-Q-Q-GKKVLLIDADLRKP-TV--HYTFRLN--------N
G8MZ93      TGPG-EGKSTTAANLAVVFA-Q-Q-GKKTLLIDADLRKP-TV--HYTFRLN--------N
F0G6H5      PTTG-VGKSYIASNLAALAA---AASQRVLLIDADLRKG-AL--HDHFRYS---------
F2I4B7      PGPA-SGKSFLSANIAAAFASD---DKRVLLLDADMRKP-TV--HKTFGVP-----N---
Q74BQ8      TLGG-EGKSITALNLAITLA-Q-EYDNTVLLIDADLRKP-MT--AQYLGIP---------
F0JCB8      GTVG-EGKSVTAVNLAISLA-Q-EFDHTVLLVDADIRSP-SC--HELLCME---------
Q314L3      ALSR-EGKSLTSANLAISLA-Q-EFDHTVLLIDADLRGP-TC--HELLGVA---------
B5EA81      SIPS-EGKSLTALNLALSLA-Q-ELDHTVLLVDADLRRP-SV--HRYLNVE---------
C6DZX5      SIPS-EGKSLTALNLAISLA-Q-ELDHTVLLVDADLRRP-SV--HRYLNVE---------
A1ARV8      AIPN-EGKSLTSLNLAISLA-Q-EYDHTVLLLDADLRRP-SL--HRYLNIE---------
C6CW37      AQSG-EGKSTVISNLAVAYALE---GKRVLLIDTDLRKP-TI--HRIFSQT-----N---
G9RSY9      AIPG-EGKSSVALNLAVSLA-E-T-GSRVLVIDCDLRKP-VI--HRYLKID-----N--S
B9Y884      TTAQ-EGKTTCVLNLAMVYA-Q-L-QKKVLVIDLDLRMP-TI--HKKLKLK-----N---
A5Z5P9      TMPN-EGKSFVTLQMWKQMA-S-A-GIKSVFVDGDMRNS-VI--VNKYGIEKEDGSE---
Q1AUN8      PGPT-EGKSTVCANLGVVLA-Q-A-NKRTLLIDGDLRRP-SL--HAVFDLR-----N---
F2I6Z7      SGPW-EGKSTIAANVATTMA-HLD-GVRVLMIDCDLRKP-TV--HKTFDIH----SR---
D4YHG7      SGVW-EGKSTVTANTAAVMA-Q-Q-GLRVLLVDADLRKP-TV--AKTFNIN----TT---
C1J9I3      SAMS-EGKSTVSANVAVTWA-Q-A-GKKVLLIDADLRRP-TI--HATFRTL----NI---
B1MZT1      ALPS-EGKSTITANLAVVYA-Q-Q-GKRVLLVDADLRRP-TV--AITFDVT----DN---
H1WR06      ALPS-EGKSTITANLAVVYA-Q-Q-GKRVLLVDADLRRP-TV--AITFDVT----DN---
H1X4N2      ALPS-EGKSTVSSNLAIVYA-Q-Q-GKKVLLVDADLRRP-TV--SVSFGLN----RN---
Q03W95      ALPS-EGKSTVTANLAVAYA-Q-Q-GKKVLLVDSDLRRP-TV--AVTFGLN----KN---
F0SX22      AEAE-EGKSITCINLALAFA-E-T-KARVLIIDCDLRRP-RI--SSLLSMP-----A---
B6W7H4      SKPS-EGKTTVLYSIAKSFA-E-N-GNSVVLLDFDLRMP-KV--GKVAGIE-----T---
F0GT81      TKPS-EGKSTVIYNLAKSFA-Q-N-GERVILLDCDLRSP-SI--SEVSGIK-----D---
B1R3X6      SEPG-EGKSTVAGNLASIIA-Q-N-DKKVIIIDCDLRRP-TI--HKKFGIS-----N---
Q8XN76      SEPG-EGKSTVAGNLASIIA-Q-N-NKKVIIIDCDLRRP-TI--HKKFGIS-----N---
B1BNK1      SEPG-EGKSTVARNLASIIA-Q-N-NKKVIIIDCDLRRP-TI--HKKFGIS-----N---
B1V0N7      SEPG-EGKSTVAGNLASIIA-Q-N-NKKVIIIDCDLRRP-TI--HKKFGIS-----N---
Q0SVR8      SEPG-EGKSTTSANLALSFA-Q-D-GKKVILIDCDLRKP-VV--HKEFQIS-----N---
B1BNH3      SEPG-EGKSTTSANLALSFA-Q-D-GKRVIIIDCDLRKP-VV--HKNFGIS-----N---
Q8XN46      SEPG-EGKSTTSANLALSFA-Q-D-GKRVIIIDCDLRKP-VV--HKNLGIS-----N---
B1V1Z4      SEPG-EGKSTTSANLALSFA-Q-D-GKRVIIIDCDLRKP-VV--HKNFGIS-----N---
G5GFW0      SIPG-EGKTMTSFALARSFS-Q-I-GRKTLFIDADIRKS-VM--LTRYQVD----ID---
C2EFR6      TYPN-EGKSTVSLELALAFS-D-N-GKKALLIDADLRKS-VS--RQLIRTG----SI---
F3ATF5      CYPN-EGKSDITFQLSQEIG-K-L-GKKVLLLDADIRKS-IL--ASRYGVG----KQ---
D4M2S0      CYPN-EGKSDVAFQLAVEIG-K-M-GKRVLIIDADIRKS-SY--IKRYQVK----QK---
F4BS19      SKQG-EGKSTIAANLAVVFA-S-Q-GKKVLLVDADMRNP-SL--HKLFKVR-----N---
D4CG08      AVPG-EGKSQITISEAMSLA-G-L-GKKVLVVDADIRKS-VL--LTRYQVE----QE---
D4MP30      AVPG-EGKSQITVSEAMSLA-G-L-GKKVLVVDADIRKS-VL--LTRYQVE----QE---
C6LCS5      CTPN-EGKSNVSLNLAASLA-E-T-GKKVLFIDADLRKS-VL--IGRLGVT----EK---
B0P2G2      SVPN-EGKSSVSLSLSRTLA-E-S-GKKILMVDADLRKS-VM--AARYHIQ----GI---
D4MW29      SVPN-EGKSSVSLSLSRTLA-E-S-GKKILMVDADLRKS-VM--AARYHIQ----GI---
E5VMX8      SVLN-EGKSSVSLSLSRTLA-E-S-GKKILMVDADLRKS-VM--AARYHIQ----GI---
D4JMC2      SVPN-EGKTTVVMDLARSMA-D-S-KKSVLIVDTDMRKS-VL--VGRLRAKVESGGK---
D6E0V4      SVPN-EGKTTVVMDLARSMA-D-S-KKSVLIVDTDMRKS-VL--VGRLRAKVESGGK---
D6E330      SVPN-EGKSTVALDLARSLT-E-S-GNRVLFIDTDMRKS-VL--AGRLRATAASGGE---
C4Z8M5      SVPN-EGKSTVALDLARSLT-E-S-GNRVLFIDTDMRKS-VL--AGRLRATAASGGE---
D4JI67      SVPN-EGKSTVALDLARSLT-E-S-GNRVLFIDTDMRKS-VL--AGRLRATAASGGE---
D3AC80      STPN-EGKSSLSFQLAISFA-E-A-DNRVLFIDADIRKS-VL--VGRYKAE----GN---
G5IFS3      STPD-EGKTSVSVQLATSFA-E-A-GKRVLLIDADIRKS-VI--LGRYRIN----KE---
D4RX67      CLPG-DGKSTVSMNLAKSFA-E-M-GKKTIFIDSDLRKS-VL--MGRYKIS----KS---
A6BIG7      CIPN-EGKSTVTMGLAEALA-E-G-EKRVLFIDADLRKS-VL--VGRYKVT----GK---
C0C0F8      CTPN-EGKSTVSLSLAQSLA-E-G-GKRVLFVDADLRKS-VL--MGRHKVN----GD---
Q97EP8      SGPG-EGKSTTSCNLALAMA-E-A-GNSVLLLDCDLRKP-SV--HKKFKIS-----N---
Q97ER5      SGPG-EGKSTTSCNLALAMA-E-A-GNSVLLMDCDLRKP-SV--HKKFKIS-----N---
D2RIR2      SVPG-EGKSTTISNMALTLA-Q-D-GKKVLLVDCDLRKP-VQ--HKIFGVI-----N---
G0VNK6      AIPG-EGKSTTVANLAIAMG-Q-D-DKKILLIDCDMRKP-VV--HRRFGLL-----N---
I0GRR2      ATPG-EGKSTTISNVAIAMA-Q-D-GKRVLLIDADMRKP-VQ--HKKFRLQ-----N---
A0PZ02      SGPS-EGKSTTSGNLALSMA-Q-S-DRKVLLIDCDLRKP-TV--HKKFHIS-----N---
B1B736      SGPS-EGKSTTSGNLALSMA-Q-S-DKKVLLIDCDLRKP-TV--HKKFNIS-----N---
F6BI62      SLPN-EGKSTIIKNLAYALA-M-T-GVKVIVVDCDLRNP-TV--HQMFKIP-----N---
Q8RBS5      SLPN-EGKSTVVKNLAYSVA-L-T-GNKVVVIDGDLRNP-TV--HKSFNLP-----N---
G2MWC2      SLPN-EGKSTVVKNLAYSVA-L-T-GSKVIVIDADLRNP-TV--HKTFNLP-----N---
B0K4N1      SLPN-EGKSTIVKNLSYSVA-L-T-GSKVIVIDADLRNP-TV--HKTFNLS-----N---
B0KAR5      SLPN-EGKSTIVKNLSYSVA-L-T-GSKVIVIDADLRNP-TV--HKTFNLS-----N---
E8UV29      SLPN-EGKSTIVKNLSYSVA-L-T-GSKVIVIDADLRNP-TV--HKTFNLS-----N---
C7ISF7      SLPN-EGKSTIVKNLSYSVA-L-T-GSKAIVIDADLRNP-TV--HKTFNLS-----N---
F7K9V1      STPN-EGKTSVSFQLALSIA-E-G-GKKVVLVDADLRKS-VL--KGRYKTN-----A--A
F7K8E9      STPN-EGKTSVSFQLAMSIA-E-G-GKKVILVDADLRKS-VL--KGRYKSN-----A--A
F7KL96      STPN-EGKTSVSFQLAISIA-E-G-GKKVILVDADLRKS-VL--KGRYKSN-----A--S
C9AAE5      GESG-TGKSTVSANLAVAYA-Q-K-GNRTLLIDADLRKP-TQ--HYLFSQE-----M---
H7F6C8      PESG-TGKSTVSSHLAVAYA-E-K-GARTLLIDADMRKP-TL--HKRFSKN-----L---
H7F5T6      PTQD-SGKTMISVNLASTYA-N-D-GVKTLLIDLDLRRP-SL--GFAIPIV-----K--A
E6PYQ3      GGPG-EGKSTTTLNLAVVLA-T-Q-SKRVLLIDADLRKP-TI--AQRLKMS-----A--T
B1R3V1      SEPG-EGKSTTSANLALSFA-Q-D-GKRVIIIDCDLRKP-VV--HKNFGIS-----N---
I5B296      ASPH-EGKSFVAANLAVSIA-Q-SIDEYVLLMDCDLRSP-TI--HTSFGYS-----G--K
D4YF13      SISM-EGKSTTTVNLAYTYA-Q-T-GKKVLIVDTDLRKP-TL--HKTFKLN-----N---
E6U7N4      SIPE-EGKSTVSINLAITLA-E-S-QKRVLLIDLDLRKP-TI--KKNLKLK-----D--V
C8VYQ6      AGPN-EGKSLTVANLAVAFA-Q-A-GLKVLIIDCDMRKP-TQ--HKIFELS-----N---
C0QCJ2      TAPG-EGKSFVASNIAISIA-K-SIDEHVLLIDCDLRLP-SL--HTRFGFS-----D---
C2MBF8      AIPG-SGKTFTSSNLALSLA-Q-S-GKRVLLIDCDIRKN-TL--SKAIGMH-----C--R
D3AE78      TIPN-EGKTSVVFQLARSFA-E-D-GKRVLLLDADMRKS-VL--MGHYRVD-----Q--E
Q39U17      AVSG-EGKTITSINLAVALA-Q-EFDHTVLLVDADLRRP-GT--SSYLGIR-----A---
B9M2X6      AFAS-EGKSITAINLAVSLA-Q-EFDHTVLLVDADLRKP-SI--HKYFGFE-----P---
A5G424      SVGS-EGKSLTALNLAVSLA-Q-EYDHTVLLVDADLRKP-SI--HQYIGLD-----P---
E8WSZ5      SVPN-EGKSLTALNLAVSLA-Q-GLDHTVLLIDADLRRP-SL--HDYLEIE-----P---
C7LPS3      STAG-EGKSMTAVNLAASLA-G-EYDHTVLLVDADLRRP-AV--HKYLGLG-----S---
C3WFM9      SIPG-EGKSTLAGNYGASLA-I-A-GKKVLLIDCDIRRP-RA--HESFGIK-----V---
A4J8V0      SGPA-EGKSTTAANLGIAFA-Q-S-GKSVIIVDADLRKP-TQ--HKVWEID-----N---
A8U9F4      AGPG-AGKSTISANLAVTFA-M-Q-GKKVLIVDADMRKP-TV--HKTFRLP-----N---
F4BSD9      AGPG-AGKSTISANLAVTFA-M-Q-GKKVLIVDADMRKP-TV--HKTFRLP-----N---
F7V792      TFPN-EGKSFIAQQLWRRMA-E-A-GIDSVLVDADLRNS-TLADRCRMETD-----S--G
F6IR93      AIQG-EGKSTVAGNLAIEYA-K-K-GLQVLLVDADLRRP-TV--HQTFGVP-----N---
G0M0F9      AIQG-EGKSTVAGNLAIEYA-K-K-GLQVLLVDADLRRP-TV--HQTFGVP-----N---
F6ITB4      AMLG-EGKSTVSGNLAVEYA-K-E-GMQVLLVDADLRRP-TI--HKTFGLK-----N---
G0M1X9      AMLG-EGKSTVSGNLAVEYA-K-E-GMQVLLVDADLRRP-TI--HKTFGLK-----N---
G0LYN9      AMLG-EGKSTVSCNLAVEYA-K-E-GMQVLLVDADLRRP-TI--HTTFGLE-----N---
D7VC13      AMLG-EGKSKVSGNLAVEYA-K-E-GMQVLLVDADLRRP-TI--HKTFGLK-----N---
F9UMZ6      AMLG-EGKSTVSGNLAVEYA-K-E-GMQVLLVDADLRRP-TI--HKTFGLK-----N---
G7QCG1      AHHG-EGKSLLVVNLAISLA-Q-EFDHTVLVVDADLRAP-TC--HRYLEVA-----P---
I2Q341      AHHG-EGKSLLVVNLAISLA-Q-EFDHTVLVVDADLRAP-TC--HRYLEVA-----P---
H8YYB9      PRPG-CGKTLTSINLAISLA-R-EVNQTVLLVDLDLRRP-SV--IRYFTDA-----D---
I5AV01      CSEN-EGKSTVSMQLAISLA-Q-S-GKRTLLIDADMRKS-VL--VGRTGVS-----G--K
B0GAL3      CFPN-EGKSDVVFQLAKEMG-M-A-GKKTVLLDADIRKS-VL--VQRYLVD-----S--D
G1WUK2      CFPN-EGKSDVAFQLAREMG-M-A-GKKTVFLDADIRKS-VL--VQRYFVD-----S--D
E0RZL3      CTPG-EGKTTVAMALARAFA-E-A-GKKTVLVDADMRKS-VL--VGRYKTG-----S--V
D8FLF8      AMAS-AGKSTVSANVSITMA-Q-A-GKKTILIDADLRRP-TL--HSTFNVS-----N---
F0K0J7      AMAS-AGKSTVSANVAITMA-Q-A-GKKTILVDADLRRP-TM--HSTFNVS-----N---
Q1G8E4      AMAS-AGKSTVSANVAITMA-Q-A-GKKTILVDADLRRP-TM--HSTFNVS-----N---
C4VP08      AAIS-EGKSTVAANVAITYA-Q-S-GKKTLLIDGDLRRP-TV--HSTFSLS-----N---
D6S4X4      AAIS-EGKSTVAANVAITYA-Q-S-GKKTLLIDGDLRRP-TV--HSTFSLT-----N---
D0DJH0      ANIS-EGKSTVTANVAITYA-Q-A-GRKTLLIDGDLRRP-TL--HSTFNVK-----N---
C7XKF3      ANIS-EGKSTVTANVAITYA-Q-A-GRKTLLIDADLRRP-TL--HSTFNVK-----N---
E3R264      ANIS-EGKSTVTANVAITYA-Q-A-GRKTLLIDADLRRP-TL--HSTFNVK-----N---
D5GZJ8      ANIS-EGKSTVTANVAITYA-Q-A-GRKTLLIDADLRRP-TL--HSTFNVK-----N---
C2EPK5      ANIS-EGKSTIAANVAITYA-Q-A-GRKTLLIDGDLRRP-TV--HTTFNLS-----N---
A4ZGZ8      ASIS-EGKSTVAANVAVTYA-Q-A-GHKVLLIDADLRRP-TV--HRTFNLS-----N---
A8YX89      ASIS-EGKSTVAANVAVTYA-Q-A-GHKVLLIDADLRRP-TV--HRTFNLS-----N---
F0NWJ7      ANIS-EGKSTVAANVAVTYA-Q-A-GRKVLLIDADLRRP-TV--HRTFNLS-----N---
E4SMV5      ANIS-EGKSTVAANVAVTYA-Q-A-GRKVLLVDADLRRP-TV--HSTFNLS-----N---
F0TGY2      ANIS-EGKSTVAANVAVTYA-Q-A-GRKVLLVDADLRRP-TV--HSTFNLS-----N---
Q5FIC7      ANIS-EGKSTVAANVAVTYA-Q-A-GRKVLLVDADLRRP-TV--HSTFNLS-----N---
F2M2M6      ANIS-EGKSTVAANVAVTYA-Q-A-GRKVLLVDADLRRP-TV--HSTFNLS-----N---
G7M0Q3      AEMA-EGKSTVAENIALTFA-Q-G-EKRVLLIDCDLRKP-SV--HVNFNVS-----N---
G7M1R9      AEAA-EGKSTVSGNLALSFA-Q-N-EKKVIIVDCDLRKP-SV--HKNFKVS-----N---
A6M2L9      AEMA-EGKSTVAGNIAASFA-Q-N-EKKVILVDCDLRKP-SV--HKNFKVS-----N---
G7M566      AEMA-EGKSTVAGNIALTFA-Q-S-DKKVILVDCDLRKP-SV--HKNFKAS-----N---
G2KUP1      ANPS-EGKSVFISNLACTFA-E-Q-GEKTILIDADMRRP-TV--YKTFMVS-----N---
G8PE06      SAPS-EGKSTVSNNVAVTWA-V-Q-GRKILLVDADLRRP-TV--HRTFSQN-----N---
Q03GL8      SAPS-EGKSTVSNNVAVTWA-D-Q-GKRVLIVDADMRRP-TV--HRTFSVS-----N---
E0NHP4      SAPS-EGKSTVSNNVAVTWA-D-Q-GKSVLIVDADMRRP-TV--HRTFRTS-----N---
F4FXQ7      SAVS-EGKSTVSANLAVIWA-Q-Q-GQKVLFIDSDLRRP-TL--HTTFGLL-----N---
C0WV35      SAVS-EGKSTVSANLAVIWA-Q-Q-GQKTLFIDSDLRRP-TL--HTTFGLL-----N---
H1LCW3      SAVS-EGKSTVSANLAVIWA-Q-Q-GQKTLFIDSDLRRP-TL--HTTFGLL-----N---
C2JZS1      SAMS-EGKSTVSANVAVTWA-Q-A-GKKVLLVDADLRRP-TV--HATFRKL-----N---
Q58Z10      SAMS-EGKSKVSANVAVTWA-Q-A-GKKVLLIDADLRRP-TV--HATFRTL-----N---
E9SAU1      ALAA-EGKSTVAANIAITLA-Q-N-NNSVLLIDGDLRKP-VQ--HKVFNIK-----N---
Q38VG5      SGPS-QGKSTISANVAVTWA-D-Q-GVNVLLVDADMRRP-TI--HQTFQVP-----N---
F0HVF1      AMAS-AGKSTVSANVSITMA-Q-A-GKKTILIDADLRWP-TL--HSTFNVS-----N---
G6F8G9      AMAS-AGKSTVSANVAITMA-Q-A-GKKTILVDADLRRP-TM--HSTFNVS-----N---
C2EWM3      ANIS-EGKSTVTDNIAVVWA-N-A-GKRVLLIDADLRRP-TL--HQTFNIS-----N---
F8DRU2      ANVS-EGKSTVTDNVAVVWA-Q-T-GQRVLLIDSDLRRP-TL--HATFSKN-----N---
B3XL23      ANVS-EGKSTVTDNVAVVWA-Q-T-GQKVLLIDSDLRRP-TL--HATFNKS-----N---
F8KGP1      ANVS-EGKSTVTDNVAVVWA-Q-T-GQKVLLIDSDLRRP-TL--HATFNKS-----N---
H4GK03      SNIS-EGKSTVTANVGVTWA-Q-D-NKRVLMVDADLRRP-TM--HSTFDLD-----N---
B2GF33      SGIS-EGKSTVTANVAIAWA-Q-E-GKRVLLIDADLRRS-TL--HATFGLS-----N---
C0WW26      SGIS-EGKSTVMANVAIAWA-Q-E-GKQVLLIDADLRRS-TL--HATFGLS-----N---
D0DSJ4      SGIS-EGKSTVTDNVAIAWA-Q-E-GKRVLLIDADLRRS-TL--HATFGLS-----N---
C0ZHV8      PGAS-EGKTITAANLSLMMA-K-D-HKKTVLLDFDLRNP-RV--HFTFDMP-----N---
H1BJT1      SCAN-EGKSTVAFHLAQVYA-A-K-YKKVLVIDCDLRRP-KM--HRYFQIS-----N---
F8FCE2      TQQA-EGKTTTAVNMAVAYA-Q-T-EKKVLIVDADMRRP-NV--HNMFRRP-----N---
H6NE43      TQQA-EGKTTTAVNMAVAYA-Q-T-EKKVLIVDADMRRP-NV--HNMFRRP-----N---
I0BSG4      TQQA-EGKTTTAVNMAVAYA-Q-T-EKKVLIVDADMRRP-NV--HNMFRRP-----N---
Q83VF9      SEAA-AGKSTVSANIAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--DITFKVQ-----N---
G8P3D7      SEAA-AGKSTESANLAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--NLTFKVQ-----N---
O06030      SETD-EGKTTVSANIAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--NITFKVQ-----N---
G9M880      SEAA-AGKSTSSANIAVAFA-Q-Q-GKKVLLIDSDLRKP-TV--NITFKVQ-----N---
G6FD42      SEAA-AGKSTASANIAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--NITFKVQ-----N---
F9VC44      SEAA-AGKSTASANLAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--NITFKVQ-----N---
A9QSJ4      SEAA-TGKSTESANLAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--NITFKVQ-----N---
Q3ZK50      SEAA-AGKSNGSANLAVAFA-Q-Q-GKKVLLIDGDLRKP-TV--NITFKVQ-----N---
E3GPC6      TGKG-EGKSTIIANYAVALA-Q-S-KKKVLLIDCDLRRP-RI--HRLFEQP-----N---
G0V447      SGPS-EGKTTTAVNLALSFA-E-L-NKKVLVIDCDLRKP-TV--HKRFNLS-----N---
H7F1R7      TEPE-SGKSTVSANLAVVYA-Q-H-GQKTLLIDADMRKP-TG--HLTFRIR-----S---
E3H7M5      SIPK-EGKSTIAANYALSVA-I-S-GEKVILVDCDIRRP-RV--VDSFGIK-----A---
E6UHY4      ALAS-EGKSTVAANIAITLA-Q-N-NNHVLLIDGDLRKP-VQ--HRVFSLT-----N---
D9QTC6      SVPQ-EGKSITIANLAVSMA-E-N-GQQVIVIDADMRKP-MQ--HRIFEIT-----N---
D9SR41      SSPS-EGKSTTVANLAIATA-Q-T-GKKILIIDADLRKP-SV--HKKFGIS-----N---
E3HB18      AIPK-EGKSFIAANYAMSEA-M-V-GKKVLLLDCDLRRP-RA--HSTFGVE-----G---
P95696      EKPG-AGKSTVVSNVAITYA-Q-A-GYKTLVIDGDMRKP-TQ--NYIFNEQ-----N---
Q2G1K7      EKPG-AGKSTVVSNVAITYA-Q-A-GYKTLVIDGDMRKP-TQ--NYIFNEQ-----N---
A8YPQ5      EAPG-AGKSTIAANLAVAYA-Q-A-GYKTLIVDGDMRKP-TQ--HYIFNLP-----N---
Q2FUV2      EAPG-AGKSTIAANLAVAYA-Q-A-GYKTLIVDGDMRKP-TQ--HYIFNLP-----N---
P39851      EKSA-SGKSILSANIAVTYA-Q-A-GYKTLIIDGDMRKP-TQ--HYIFDLP-----N---
C5QNG4      EKPA-AGKSIVSANIATTYA-Q-A-GYRTLIIDGDMRKP-TQ--NYIFEEA-----N---
Q4L9H7      EKPA-AGKSIVSANIAITYA-Q-A-GYKTLIIDGDMRKP-TQ--HYVFETS-----N---
A7NQ71      TAPD-EGKSTTLANLAVTIA-Q-A-EQRVILVDCDLRRP-SL--HTLFGLT-----N---
E4Q5T5      TGPS-EGKTITCANLAVVMA-Q-A-GSKVLVIDADLRRP-AI--HKVFGVS-----N---
E4SDX4      TGPS-EGKTVTCANLAVVMA-Q-A-GSKVLVIDADLRRP-AI--HKVFGVS-----N---
E4S7Y6      SGPS-EGKTITTANLAVVMA-Q-A-GSKVLVIDADLRRP-AI--HKVFGVN-----N---
C6CS80      AGPE-EGKSTTILNLAVTYA-Q-M-ERRTILVDADLRKP-TS--HYNFGLS-----N---
E6LD64      SGAG-EGKSTTAANLAVVFA-N-A-GQRVLLVDADLRKP-TV--HKTFHLQ-----N---
F0EKB9      SGPG-EGKSTTSANLAVVFA-K-S-GQRVLLVDADMRKP-TV--YKTFSLN-----N---
H7F571      PEPG-SGKSTISANLAVCYA-K-Q-GIRTLLIDADMRKP-TV--HRAFGIR-----V---
F5LE48      AQPA-EGKSTTVSNLAITYA-Q-E-EKNVLLIDADLRKP-TM--HKLFGIS-----N---
E7RDR3      AAPS-EGKSTTAANLAVVFA-Q-E-GKKVLLIDGDMRKP-TT--HYTFRMG-----N---
E7RG08      ASHL-EGKSTTSSNLAIVFA-Q-E-GKRVLLIDADMRKP-TM--HQTFKIS-----N---
F6CNF5      AGPE-DGKSTTAANLAVVLA-Q-A-GNKVILVDCDLRKP-TQ--HRIFEVE-----N---
G2FWX4      AGRR-EGKSFTVANLAVSMA-Q-D-GKSVLVVDADLRNP-TQ--DKLFGLD-----N---
G2FM59      SGPR-EGKSHTVANLAVSMA-Q-S-GKSVLIIDADLRNP-TQ--HKLFGLD-----N---
G7WJV1      SGPG-EGKSHTVANLAVSMA-Q-S-GKSVLIIDADLRNP-TQ--HKLFGLD-----N---
H5XZD4      SGPR-EGKSHTVANLAVSIA-Q-S-GKSVLIIDADLRNP-TQ--HKLFGLD-----N---
H5XZG7      SGPR-EGKSTTAANLAVSIA-Q-S-GKSVLLIDADMRNP-TQ--HKLFGLS-----N---
G7W773      SGPR-EGKSTTVANLAVSMA-Q-S-GKSVLVIDADLRNP-TQ--HKLFELE-----N---
G2FWT8      SGPR-EGKSSTVANLAVSIA-Q-A-GKSVIVVDADMRNP-TQ--HKLFGLD-----N---
I4DBG8      AGPQ-EGKSSTVANLAVSIA-Q-T-GKTVLVVDADLRNP-TQ--HKLFGLP-----N---
C0EBA6      SLPN-EGKSTTATNIAITLA-Q-T-GKKTLLIDADMRKP-TQ--YKIFRLT-----R---
Q9K6R0      SGPG-EGKSTTSANLAVVMA-Q-N-GHNVLFVDADLRKP-TA--HYTFRAV-----N---
I2HVL2      SVPG-EGKSFSAANLAAVFA-Q-Q-EKKVLLVDADLRKP-TI--HETYQLE-----N---
D4G1R2      -MPG-EGKSFSAANLAAVFAQQ-Q-EKKVLLVDADLRKP-TI--NQTFQVD-----N---
G4EQZ7      SVPG-EGKSFSAANLAAVFAQQ-Q-EKKVLLVDADLRKP-TI--NQTFQVD-----N---
P71051      SVPG-EGKSFSAANLAAVFAQQ-Q-EKKVLLVDADLRKP-TI--NQTFQVD-----N---
E0U2Z3      SVPG-EGKSFSAANLAAVFAQQ-Q-EKKVLLVDADLRKP-TI--NQTFQVE-----N---
G4P114      SVPG-EGKSFSAANLAAVFAQQ-Q-EKKVLLVDADLRKP-TI--NQTFQVE-----N---
A9VRC3      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2QJY5      AKPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQTD-----N---
C2RG49      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2T8T6      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2MTG3      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2SSX8      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2YZB2      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C3GBJ8      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2SBU4      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2NQN6      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C3GRR0      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2PN22      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2Y452      ANPS-EGKTTTTANIAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2WVG6      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C3EBC0      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2XJH9      ANPS-EGKTTTTANIAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2P8H3      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2ULR6      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C2V4M2      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
C3H979      ANPS-EGKTTTTANMAVVFA-Q-Q-GKKVLLIDADMRKP-AM--HQMFQVD-----N---
G2TR25      SGPG-EGKSTIVGNLAVVFA-Q-Q-GKRVLLVDADLRRP-TV--HYTFGMT-----N---
P96716      ACPG-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HTAFFLE-----N---
G4EQF3      ACPG-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HTAFFLE-----N---
D4G2E1      ACPG-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HTAFFLE-----N---
I0F9R6      ACPG-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HTAFFLE-----N---
E0TTZ6      ACPG-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HTAFHLE-----N---
G4P1M7      ACPG-EGKSTTAANLAVVFA-Q-Q-GKKVLLIDADLRKP-TV--HTAFHFE-----N---
A8FHL9      SLPK-EGKSFTAANLAAVFA-Q-Q-KKRVLLMDADLRKP-AV--HEYFDLS-----H---
Q5KUM5      TGPG-EGKSTTAANLAVVFA-Q-Q-GKKTLLIDADLRKP-TV--HYTFRLN-----N---
D3FZP4      AGPG-EGKSTTIANLAIVLA-Q-Q-GKRVLLLDADLRKP-TV--HYTFQVD-----N---
I0JRK4      AGPS-EGKSLTTANVAVVFA-Q-Q-GKKVLLVDADLRKP-TV--HYTFRAD-----N---
I3EBB3      PGPG-EGKTTTIANLAVVFA-Q-Q-GKTVLLIDADMRKP-TV--HYTFNLM-----N---
E3CP62      VEAG-EGKSTTSVNLAISFA-S-VGL-RTLFIDADTRNS-VL--SGTFKSN--------A
C2KHF1      ALPS-EGKSTVSSNLAIVYA-Q-QGK-KVLLVDADLRRP-TV--AVSFGLN--------R
I0UTA5      AVPS-EGKSTVSLSLARSMA-E-SGQ-AVILIDADLRRP-TL--AKKLNVD--------A
B7BDT8      FNPG-SGKTFLTMNTAATFA-M-KGK-RVLVVDGDLRHG-SA--SAYVGSP--------K
G9WIQ9      SEMS-DGKSTVAQNLAVTWA-Q-TGK-RVLLVDADFRRP-TI--HKTFGLT--------N
A0NKF6      AEMS-DGKSTAAQNLAVTWA-Q-TGK-RVLLLDADFRRP-TL--HKTFAVP--------N
Q04DV8      AEMS-DGKSTAAQNLAITWA-Q-TGK-RVLLLDADFRRP-TL--HKTFAVP--------N
E7T801      ATPD-SGKTFVSSTLAAVIA-Q-SDQ-KVLFIDADLRRG-YS--HNLFTVS--------N
F4SM97      ASPN-AGKTFVSSNLAAIIA-Q-TGK-KVLFIDTDMRKG-YT--HKLFNKN--------N
G5Q4J0      VSPS-IGKTFVCANLAAVIS-Q-THK-RVLLIDCDMRKG-YT--HELLGTN--------N
G5LQM6      VSPS-IGKTFVCANLAAVIS-Q-THK-RVLLIDCDMRKG-YT--HELLGTN--------N
G5SDT8      VSPS-IGKTFVCANLAAVIS-Q-THK-RVLLIDCDMRKG-YT--HELLGTN--------N
F3CAY9      PTPG-AGKSFVSSNLATIIA-Q-TGR-RVLLIDADMRKG-YL--HRLFGLQ--------P
A3K8W7      PGKG-CGKTFTVANLAISLS-R-QENTRTLVMDFDMRRP-SL--HRVLGVD--------S
G7EJX6      SSPG-EGKTTTSANLAMSLA-Q-MG--KVLIIDGDLRKP-SI--AKRFDIP--------V
B7B947      FNPG-AGKTFVSINLAMSFA-L-T-HKKVVLVDLDIRKG-TL--SSHVQVS--------D
D3LB10      AEMS-DGKSTVAQNLAVAWA-Q-N-GKRVLLLDADFRRP-TV--HKTFAIS--------N
S9QRP1      PTKD-CGKTFTAANLAISLS-R-QENCRTLLLDCDLRRP-SL--HRVLGVE--------P
G8AU96      SIPK-EGKSVLAANLARSLA-G-L-GLNTLLIDADFRRP-SI--AKLLGYQ--------P
D0D9W0      PTKD-CGKTFTAANLAISLS-R-HQNCRTLLLDCDLRRP-SL--HKIMGFR--------D
Q0FMP0      PTKD-CGKTFTAANLAISLS-R-QQNCRTMLIDCDLRRP-SL--HKVLGVK--------N
A3W0H7      PSPD-CGKSFVAANLAISLS-R-QSSVRTVLMDMDLRRP-SL--AHTLGQP--------D
I1AYC5      PTKD-CGKTFTAANLAISLS-R-HQNCRALLIDCDLRRP-TL--HKVMGAD--------N
                  **:                    :..* * *                       

E9TE88      V-NGLSEILI------GQ---GDITTAAKPT-SI-AKFDLIPRGQVPPNPSELLMSERFA
B8D0N2      D-PGLSDILK------GQ-T-T-PTEVTRKYLNP-HEIEIVPCGTREKKSAPIIDRLSFT
C2CI44      N-VGVTNYLT------GK-V-SIQRAINKDR-DQ-ANLDLIFTGPVPPNPAEILASQVFK
C7RGH6      N-VGITNYLT------GK-V-NIQRAINKDR-EQ-SNLDMIFTGPVPPNPAEILASNAFK
C0CK73      I-QGVSEYLS------KQ-----SMKIVYRT-SD-PNLSIIFSGSYPPNPSELLSGIRFE
Q1WTC8      E-MGLSDYLV------GR-A-Q-FDDVIAQS-NI-ENFSMIFSGPVPPNPSEILDGERFK
E8JWI5      V-SGLTEYLA------RN-T-D-LSQGLCET-DE-ENLFVITSGQASPNPTALLQSERFT
F3AHH0      A-KGMTHFLS------GQ-V-E-IKDVLCST-NI-ENMHIAYAGPVPPNPAELLGSKRFH
F7K0U1      L-KGLSHFLS------GR-A-K-VEDVVCKT-QI-EGLMVIFAGIIPPNPAELLGQERFG
C4Z672      K-YGLTHYLS------GK-N-E-LTDVISVS-DE-PNFCMIFAGPVPPNPSELVGNDRFA
P0C0T9      I-KGLTNYLS------GN-A-D-LGDIICET-NV-PRLMVVPSGKVPPNPTALLQNAYFN
Q04663      I-KGLTNYLS------GN-A-D-LGDIICET-NV-PRLMVVPSGKVPPNPTALLQNAYFN
Q67AY4      I-KGLTNYLS------GN-A-D-LGDIICET-NV-PRLMVVPSGKVPPNPTALLQNAYFN
Q3K0T0      I-KGLTNYLS------GN-A-D-LGDIICET-NV-PRLMVVPSGKVPPNPTALLQNAYFN
C5NWJ8      I-SGLTNYLS------GV-S-P-IEDVIYET-DV-EHLNVIPAGQVPPNPTGLLQNKNFN
F3A499      I-SGLTNYLS------GV-S-P-IEDVIYET-DV-EHLNVIPVGQVPPNPTGLLQNKNFN
Q4JZ55      I-TGLTEYLS------GK-A-G-MADSMQET-TL-DNLYILQAGVVSPNPLSLLRSVKFE
G5JTD5      V-KGLTDFLS------GN-A-D-LQTTISRT-NI-PNLTMIPAGQVPPNPTALFQSDNFK
G3G7C1      I-TGLTDYLA------GT-T-D-LSRGLCET-NI-PNLTVIESGKISPNPTALLQSKNFE
G3G7J9      I-TGLTDYLA------GT-T-D-LSRGLCET-NI-PNLTVIESGKISPNPTALLQSKNFE
G3G7G6      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G8DUB0      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G3G7I8      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G3G7J4      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G7SG34      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G8DTZ0      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G8DU07      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
A4VTU3      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G7SNU6      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
G8DU31      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
D5AGQ5      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
Q9X4U7      I-TGLTDYLA------GT-T-D-LSQGLCDT-DI-PNLTVIESGKVSPNPTALLQSKNFE
A3CQY2      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFD
E8KLY9      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-ENLDVILSGPVSPNPTGLLQSKQFD
F0FHA8      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFD
F0I4H5      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFE
F0IAY3      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-ENLDVILSGPVSPNPTGLLQSKQFD
F0IJI2      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-ENLDVILSGPVSPNPTGLLQSKQFD
F0IS53      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFD
F2C9N0      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFD
F2CH53      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-ENLDVILSGPVSPNPTGLLQSKQFE
F3SM32      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFE
F3UDW7      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-ENLDVILSGPVSPNPTGLLQSKQFD
F3UNJ4      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFE
F0FQQ5      V-SGLTDYLS------GQ-A-A-LHEVINDT-DL-DNLDVILSGPVSPNPTGLLQSKQFD
D6R2T8      V-LGLTDFLS------GQ-S-D-VKAILNTT-DI-ANLHIILAGQPSPNPTGLLQSKNFE
F3UUQ2      V-LGLTDFLS------GQ-S-D-VKAILNTT-DI-ANLHIILAGQPSPNPTGLLQSKNFE
E6IZC2      I-TGLTDYLA------GA-T-D-LSNGLCET-NI-DNLFVIEAGQVSPNPTALLQSKNFG
G6A745      I-TGLTDYLA------GA-A-D-LSNGLCDT-NV-ENLFVIEAGQISPNPTALLQSKNFG
A8AZR3      I-TGLTDYLV------GK-N-D-LSQGLCET-DV-PNLFVIESGQSSPNPTALLQSKNFD
F9HJP6      I-TGLTDYLS------GK-T-D-LSQGLCET-DV-KNLFVIESGQSSPNPIALLQSKNFD
Q4JYT9      I-TGLTDFLA------GT-T-D-LSHGLCDT-NI-ENLFVIQAGPVSPNPTALLQSENFA
Q4JZY1      I-TGLTDFLA------GT-T-D-LSHGLCDT-NI-ENLFVIQAGPVSPNPTALLQSENFA
E1LQJ7      I-TGLTDFLA------GT-T-D-LSHGLCDT-NI-ENLFVIQAGPVSPNPTALLQSENFA
F9HC65      I-TGLTDFLA------GT-T-D-LSNGLCDT-NI-DNLFVIQAGPISPNPTALLQSENFH
E1LPE7      I-TGLTDYLA------GT-Q-D-LSNGLCET-NV-DNLFVIESGVSSPNPTALLQSDNFG
F9MJW5      I-TGLTDYLA------GT-Q-D-LSNGLCET-NV-DNLFVIESGVSSPNPTALLQSDNFG
E8KDN2      I-TGLTDYLS------GT-K-D-LSQGLCET-NV-ENLFVIQSGAISPNPTALLQSDKFE
E8K322      I-TGLTDYLS------GT-K-D-LSHGLCET-NV-ENLFVIQSGAVSPNPTALLQSDKFE
F9PEU4      I-TGLTDYLS------GT-K-D-LSHGLCET-NV-ENLFVIQSGAVSPNPTALLQSDKFE
F9PZP7      I-TGLTDYLS------GT-K-D-LSHGLCET-NV-ENLFVIQSGAVSPNPTALLQSEKFE
C1CBD1      I-TGLTEFLS------GT-T-D-LSHGLCDT-NI-ENLFVVQSGAVSPNPTALLQSKNFN
Q7WVX0      I-TGLTEFLS------GT-T-D-LSHGLCDT-NI-ENLFVVQSGAVSPNPTALLQSKNFN
P96475      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q9AHD2      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q4K2Q7      I-TGLTEFLS------GT-A-D-LSHGLCDT-NT-ENLFVVQSGSVSPNPTALLQSKNFN
Q4K0T5      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVIQSGSVSPNPTALLQSKNFN
Q4K0E1      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGTVTPNPTALLQSKNFN
Q9AH95      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q4K1M4      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q4JZ18      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q54520      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGTVSPNPTALLQSKNFN
Q4JYH5      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGTVSPNPTALLQSKNFN
Q4K0V2      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGTVSPNPTALLQSKNFN
A5M4L1      I-TGLTEFLS------GT-A-D-LSYGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
B2ILP5      I-TGLTEFLS------GT-A-D-LSYGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
C1CCB9      I-TGLTEFLS------GT-A-D-LSYGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q4K1S7      I-TGLTEFLS------GT-A-D-LSYGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
P72512      I-TGLTEFLS------GT-A-D-LSYGLCDT-NI-ENLFVVQSGPVSPNPTALLQSKNFN
Q4JZ84      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVIQSGSVSPNPTALLQSKNFN
Q4K0X5      I-TGLTEFLS------GT-A-D-LSRGLCDT-NI-ENLFVIQSGSVSPNPTALLQSKNFN
Q4K0Z6      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVIQSGSVSPNPTALLQSKNFN
Q4K195      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGAVSPNPTALLQSKNFN
Q4K0A0      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVIQSGSVSPNPTALLQSKNFN
Q4K0K2      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q4K1F9      I-TGLTEFLS------GT-A-D-LSHGLCDT-NI-ENLFVVQSGSVSPNPTALLQSKNFN
Q4K045      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIPAGSVSPNPTALLQSKNFS
G6C7Z1      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSKNFS
D2ERX8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGTVSPNPTALLQSKNLS
F9LZC4      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
F9P1W8      I-TGLTEFLS------GT-T-D-LSQGLCDT-TI-ENLFVIQAGSVSPNPTALLQSKNFS
I0J9C9      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSKNFS
A6YIA8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K005      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4JZL7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSENFT
E5F5C5      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFT
Q4JZG7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFT
Q4JZK1      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFT
A5LJS0      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q9AHB7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K1B7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFT
Q4JYK8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K0M3      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSKNFS
Q9AHA4      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q9X9A1      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFT
Q9ZII6      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQRKNFS
Q8KWQ0      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4JZW7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4JYX9      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K0R7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K1K6      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4JZS3      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K0I2      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPIALLQSKNFS
Q4K254      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K237      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
B1I967      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
G6J8A4      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
G6LKG5      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q9ZFT8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFT
D6ZQI8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSKNFS
Q4K2A8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPIALLQSRNFS
Q8VU31      I-TGLTEFLS------GT-T-D-LSQGLCDT-NI-ENLFVIQAGSVSPNPTALLQSRNFS
Q4K2E1      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSISPNPTALLQSENFR
Q4K2F7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSISPNPTALLQSENFR
A5YTV7      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVVQAGSVSPNPTALLQSENFA
F9Q345      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSENFK
Q6L5R0      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSENFK
A5YTT9      I-TGLTEFLS------GT-T-D-LSQGLCET-NV-ENLFVIQAGSVSPNPTALLQSENFA
E6KKS0      I-TGLTEFLS------GT-T-D-LSQGLCET-NV-ENLFVIQAGSVSPNPTALLQSENFA
F2QF90      I-TGLTEFLS------GT-T-D-LSQGLCET-NV-ENLFVIQAGSVSPNPTALLQSENFA
E0Q2S8      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSENFA
A1ILY1      I-TGLTEFLS------GT-T-D-LSQGLCET-NV-ENLFVIQAGSVSPNPTALLQSENFA
Q6L5T0      I-TGLTEFLS------GT-T-D-LSQGLCET-NV-ENLFVIQAGSVSPNPTALLQSENFA
E9FEC5      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSISPNPTALLQSENFA
E0PPH9      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSISPNPTALLQSENFA
F5VSG9      I-TGLTEFLS------GT-T-D-LSQGLCDT-NV-ENLFVIQAGSVSPNPTALLQSENFA
E3CBS0      I-QGLTDFLS------GR-S-Q-LNQILYPT-DF-PNLDIIESGQVAPNPTGLLQSKNFT
F9M366      I-QGLTDFLS------GR-S-Q-LNQILYPT-DF-PNLDIIESGQVAPNPTGLLQSKNFT
E8K786      I-QGLTDFLS------GR-S-Q-LDQILYAT-DF-PNLDIIESGQVAPNPTGLLQSKNFT
F8DFF4      I-QGLTDFLS------GQ-S-Q-LDQVLYTT-EF-PNLDIIESGQIAPNPTGLLQSKNFT
I1ZPH7      I-QGLTDFLS------GQ-S-Q-LDQVLYTT-EF-PNLDIIESGQIAPNPTGLLQSKNFT
E7S8W3      V-AGLTEVLS------GK-S-E-ISQAIATT-DY-PKLDVLLSGQVSPNPTGLLQSKNFE
D0RXH2      V-EGLTEVLS------GN-A-D-ISRALADT-DY-PNLDVFLSGQVSPNPTGLLQGKNFE
Q83YR5      V-EGLTEVLS------GN-A-D-ISRALADT-DY-PNLDVFLSGQVSPNPTGLLQGKNFE
Q8GP54      Y-KGLSNFLS------GN-A-DLLNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
F8HDC3      Y-KGLSNFLS------GN-A-S-LGEVICET-DV-PGLHVLSSGPVPPNPTSLLQNDNFV
F8LJ75      Y-KGLSNFLS------GN-A-S-LGEVICET-DV-PGLHVLSSGPVPPNPTSLLQNDNFV
E9DM17      Y-KGLSNFLS------GN-A-T-LEETVCRT-DI-ASLDVISSGPVPPNPTSLLQNENFT
I0QIK6      Y-KGLSNFLS------GN-A-T-LEETVCRT-DI-AGLDVISSGPIPPNPTSLLQNENFT
E8KUY8      Y-KGLSNFLS------GN-A-D-LNETICQT-NI-SGLDVIASGPVPPNPTSLLQNDNFR
Q7X553      Y-KGLSNFLS------GN-A-V-LNETICQT-DI-SGLDVIASGRIPPNPTSLLQNDNFR
Q8GP92      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q7X561      Y-KGLSNFLS------GN-A-D-LNDRICQP-YI-SGLDVIASGPVPPNPTSLLQNDNFR
Q7X549      Y-KGLSNFLS------GN-G-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
G6ERT1      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPIPPNPTSLLQNDNFR
O87931      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPIPPNPTSLLQNDNFR
Q8GPF6      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q7X555      Y-KGLSNFLY------RN-A-D-LNETICQT-DI-SGLDVISSGPVPPNPTSLLQNDNFR
Q7X557      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q7X563      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q8GMA5      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q8GPA8      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q55205      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
C2LSE6      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q7X559      Y-KGLSNFLS------GN-A-D-LNETICQT-NI-SGLDVIASGPVPPNPTSLLQNDNFR
F8LXJ4      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q1WCR1      Y-KGLSNFLS------GN-A-D-LNETICQT-DI-SGLDVIASGPVPPNPTSLLQNDNFR
Q8GPC3      Y-KGLSNFLS------GN-A-D-LNETICQT-NI-SGLDVIASGPVPPNPTSLLQNDNFR
E8JMT9      Y-QGLTSFLS------GN-A-E-LSDVICDT-SI-DNLMIIPAGQVPPNPTSLIQNDNFK
F5X0J9      Y-QGLTSFLS------GN-A-E-LSDAICDT-SI-DNLMIIPAGQVPPNPTSLIQNDNFK
H2A602      Y-QGLTSFLS------GN-A-E-LSDVICDT-NI-DNLMIIPAGQVPPNPTSLIQNDNFK
E0PD83      Y-QGLTSFLS------GN-A-E-LSDVICDT-TI-DNLMIIPSGQVPPNPTSLIQNDNFK
F5X652      Y-QGLTSFLS------GN-A-E-LSDVICDT-TI-DNLMIIPAGQVPPNPTSLIQNDNFK
G5KD11      Y-EGLSSYLS------GN-T-E-LSKVIVST-NI-DKLMVIPAGQVPPNPTTLLQNAHFN
B9DUJ4      Y-EGLSSYLS------GN-A-D-LSSVISHT-SV-ENLMVIPAGQVAPNPTTLLQNNNFN
G5KAJ2      Y-EGLSSYLS------GN-A-D-LSHVISHT-NI-SNLMIIPAGQVPPNPTTLLQNNNFN
F1Z124      Y-EGLSSYLS------GN-A-E-LSAVISHT-NI-ENLMLIPAGHVPPNPTTLLQNSNFN
Q2KM74      Y-EGLSSYLS------GN-A-E-LSSVISRT-DV-PNLMLIPSGQVPPNPTTVLQNSNFN
C6LDI8      V-KGLSHFLA------GT-A-E-LRDVLCQT-NI-PYFHIILSGAAAPNPSELLGNGKFS
D4J4T6      V-KGLSHYLA------GF-V-P-LNDVICKT-NI-KNMYMAFAGLNAPNPAELLGNPKFK
D4LTH2      K-KGLNHYLS------GL-A-E-YDEVVYKT-NI-ENASIVPCTQLLENPSPLLEDIRFR
D4LG06      T-KGLNHYLS------GM-A-E-YEDVVYKT-NI-ENAYIVPCTQLLENPSPLLEDARFR
A7VF42      I-KDLGYYLS------GQ-A-E-YEDVVYET-NI-PNAYIVPCCNLLENPSALLEDARFA
A8SQS8      L-QDLGYYLS------GQ-A-E-IEDVVYET-QV-ENAYIVPCMNLLENPSALLEDARFA
D5HFS4      L-PDLGYFLS------GQ-S-E-MEDVIYET-QV-ENAYIVPCMNILENPSALLEDARFA
C9LAS1      V-NGLSQYLS------GQ-L-A-KEFLIYQT-NF-LNVDIIFAGPMAPNPSELLEEEAFR
F3AH92      V-KGLSQCLS------GQ-V-D-KEQITYQT-NF-ENVDIVFAGPIAPNPSELLSSKEFD
I5ASF8      V-LGLSEYLS------GQVD-E-VNQIFYQT-NY-DNLFLIFSGAYASNPSEMLADESFG
E7GL81      I-EGLSQYLS------GQ-K-K-LEEVIYTT-NI-PNLDVIFSGPLSPNPAELLEEPLFK
G5F9E2      I-EGLSQYLS------GQ-K-K-LEEVIYTA-NI-PNLDVIFSGPLSPNPAELLEEPLFK
E7GL57      V-DGLSQYLS------GQ-K-K-LEEVVYKT-NL-PNLTMIFSGPYSPNPAELLAEPLFD
G5F9A9      V-DGLSQYLS------GQ-K-K-LEEVVYKT-NL-PNLTMIFSGPYSPNPAELLAEPLFD
E7GL40      V-DGLSQYLS------GQ-C-K-KEEVVYRT-NI-PNLNIIFSGPFSPNPAELLEGELFT
G5F9H2      V-DGLSQYLS------GQ-C-K-KEEVVYRT-NI-PNLNIIFSGPFSPNPAELLEGELFT
A8RK85      P-NGLSQYLS------GQ-K-S-LEEICYET-DM-ENLDMVLSGPFSPNPAELLEDELFK
G5HTB2      P-NGLSQYLS------GQ-K-S-LDEICYAT-DV-ENFDIILAGPYSPNPAELLEDSLFR
G5HNC5      P-CGLSQYLS------GQ-K-T-AEEICYGT-DV-ENLDIILAGPYSPNPSELLEDPLFK
C0CZV9      V-CGLSQYLS------GQ-K-P-LEEIRYAT-SV-ENLHMIFSGPYSPNPAELLEEELFG
A8RSK9      V-PGLSQYLS------GQ-R-P-LEHVLYDT-NI-ENLSIIFAGPYSPNPAELLEESLFS
C5EN03      V-YGLSQYLS------GQ-K-T-LEEVLYDT-NV-ENLSMVFAGPYSPNPAELLEEDLFG
G5HG45      V-YGLSQYLS------GQ-K-T-LADVLYDT-NV-ENLSMVFAGPYSPNPAELLEEDLFE
D9ST44      R-KGLLGFLE------GN-A-L-FSESVQKT-KV-SNLDIAMVGTKANNPSKLISSEKLK
G2Z8Q3      S-IGLTDILE------ET-I-Q-SQNAIQKT-SL-YNVDLISAGQVPHNPSELLSKPILR
C8W5K2      N-KGLVDIIL------GR-L-P-LDLGLKNV-GI-DGLKLITTGSVPPNPVELISSNRTK
A5V0I3      D-IGLTNMIL------AH-N-D-APPPLQET-GV-PGLSLLASGPLPPRPADILGSRRME
F5LM71      R-TGLTDVLT------RQ-A-E-VEEALKET-DI-PGLYVMTCGTVPPNPSEILGSRRMT
D7VBW4      Q-RGVSSWLS------GQ-LTD-VNEAIYPV--L-DHLFVMPSGPKPPNPAELLASDRMT
F9UQ54      Q-RGVSSWLS------GQ-LTD-VNEAIYPV--L-DHLFVMPSGPKPPNPAELLASDRMS
H6LKR8      Q-PGLSNMLV------DG-L-I-FDSVLNKVKDL-EKFEILTAGDRQVSPTELLNSDAFE
E0I7B5      R-IGLTNLLA------GQ-F-H-LSEVEQAT-LV-DNLTVIPSGPVPPNPSELLGSQKMK
D7UYE4      I-EGLSKLII------KK-S-D-FEKSILDT-GI-DNLHLLTSGPIPPYPSELIGSVNFS
Q4A120      I-KGLSNVII------NK-S-T-FEDAVYST-EV-LNLDVLTSGPIPPNPSELIGSSNMM
D9SVC7      K-TGLTTVLT------NQ-C-D-LMDAIQET-EV-DNLHILCGGKIETNSHQLIGSKKMS
D9S1J9      Y-KGLSNLLA------ED-L-P-LDTVVNTT-KV-ENLHVITSGPVPPNPAEVLGSAKMK
C0GGR5      N-VGITNLLL------NG-SIS-LEETL-VS-PR-PNLYFLPCGPLPPNPAELLGSKKMR
C6CSC8      R-FGLSSVIS------QQ-S-T-LQEVIQAT-DI-PNMDVITAGPIPPNPAEMLASKRMT
A3ICA3      I-FGLSSVLS------RQ-A-T-LQEVIQET-FV-EGVDIISSGAIPPNPTELLASETMT
B1HR41      V-FGLSSVLS------RQ-A-T-LQEVIQAT-FV-DGVEIISSGAIPPNPTELLASETMT
D6Y034      K-QGLSNVLA------KQ-A-S-LSSCVQES-QI-EGVSVLTCGPIPPNPAELLGSKQMD
Q8EME8      L-RGLSNILV------GE-T-S-LRDAVESS-DV-ENLDLISCGPIPPNPSELLGSKRMQ
F3Y922      N-RGLSTLLS------NK-TMT-TEEVLQPT-NL-ENLNILPSGPIPPNPSELLDSLQMK
G4L594      E-AGLSTVLS------TG-V-K-AGETAQKT-AV-ENLSILTSGPKPPNPSELLGSAKMN
C9B454      A-SGLSTALS------SS-G-S-VADEIQRT-PV-ENLSILPSGPKPPNPSELLSSPRMD
Q3XYS6      A-SGLSTALS------SL-G-S-VVDVIQRT-PV-ENLSILPSGPKPPNPSELLSSPRMD
C9ALZ9      A-SGLSTVLS------SS-G-S-VADEIQRT-PV-DNLSILPSGPKPPNPSELLSSPRMD
C9BUG7      A-SGLSTALS------SS-G-S-VADVIQRT-PV-ENLSILPSGPKPPNPSELLSSPRMD
D4RJF4      T-SGLSTALS------SS-G-S-VADVIQRT-PV-ENLSILPSGPKPPNPSELLSSPRMD
C8ZXT9      N-VGVSTVLS------TS-T-N-LAEAAQQT-VI-DNLSILPSGPKPPNPSELLGSSRMN
G5IRQ6      N-VGVSTVLS------TS-T-N-LAEAAQQT-VI-DNLSILPSGPKPPNPSELLGSSRMN
C9A6V5      A-SGLSTVLS------TS-T-S-VLEAAQKT-VI-DNLSVLTSGPKPPNPSELLGSARMN
C9CHY8      A-SGLSTVLS------TS-T-S-VLEVAQKT-VI-DNLSVLTSGPKPPNPSELLGSARMN
Q814Z0      I-FGLTNVLT------HS-E-R-LEKCVQTT-SI-DNLSFLACGPIPPNPAELLGSKSMK
B9IRQ6      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
B7HXB4      I-FGLTNVLT------YS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
Q72XH8      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
A0RL70      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
Q6HB09      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
F0PU64      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
B7HFH1      I-FGLTNVLT------HS-E-R-LEKCVQKT-SV-DNLHFLACGPIPPNPAELLGSKSMK
B7IQS8      I-FGLTNVLT------HS-E-H-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMK
B3ZRD6      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
B5UQ73      I-FGLTNVLT------HS-E-R-LEKCVQTT-LV-DNLHFLACGPIPPNPAELLGSKSMK
G9QCG3      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMK
Q3EV64      I-FGLTNVLT------HS-E-R-LEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMK
Q5WBB4      N-RGLTNVLT------RQ-Q-K-QDDVIQET-NV-ENVSLLTCGPIPPNPAELLNSKMME
B1YMM5      G-LGLSSLLT------RQ-A-D-LGKAILPT-KV-DNLSILTAGPIPPNPAELLSSKAME
D7WMM8      A-RGLSNLLT------RH-F-T-ISEVVNNT-DI-ANLYVLTSGPIPPNPAELLASTLMG
A7Z921      V-QGLTNVLV------GN-A-S-LGETVQKT-LI-DNLYVLTSGPTPPNPAELLSSKAMG
I2CAF2      V-QGLTNVLV------GN-A-S-LGETVQKT-LI-DNLYVLTSGPTPPNPAELLSSKAMG
A7Z9K0      G-TGLTSLLL------KQ-M-P-FQKAVLPA-DE-ANLDILTSGPIPPNPAELLSTGAMK
I2CB16      G-TGLTSLLL------KQ-M-P-FQKAVLPA-DE-ANLDILTSGPIPPNPAELLSTGAMK
I2HW53      G-TGLTSLLL------KQ-M-P-FQKAVLPA-DE-ANLDILTSGPIPPNPAELLSTGAMK
G9QKR4      T-VGLTNVLT------RQ-A-S-LVEAVQAT-DV-EKLDLLSSGPIPPNPAELLSSRMME
D5DBK3      H-AGLTNVLT------RQ-S-T-LGQGVQES-EV-PNLYLLTSGPIPPNPAELLSSNQMT
D5DY81      H-TGLTNVLT------RQ-S-S-LGQAVQST-EV-PNLYVLTSGPIPPNPSELLASKQMG
Q2BFS5      N-NGLTNVLT------KS-S-S-LLKAVKET-AI-ENLSVLTSGPIPPNPAELLGSQAME
A4ITF3      Y-AGLTSVLT------NA-S-P-LSSALQDT-SV-ENLTVLTAGPIPPNPAELLSSKMMD
C5D961      Y-MGLTNVLT------NS-A-P-LLPSCQET-SV-ENLYVLTSGPIPPNPAELLSSKAME
G8MZ93      Y-KGLTNVLT------GS-A-P-LLPTCQAT-EI-DHLSILTSGPIPPNPAELLSSNAMA
F0G6H5      RAPGLSDVVM------GTH---RLDEALKR--DVRPGLDFLSMGSIVADPGEVLLQPALA
F2I4B7      D-RGLTNLLT------DSR--LEIHQVIKKS-YV-PNLFYLTCGAIPPNPSELLASKRMQ
Q74BQ8      GERGLSEYLS------VGA---HLPELLVRT-GI-GRLSILPAGKPAANPVELLSSQRMK
F0JCB8      NGYGLSDCLV------DGS---PIGKGLVKT-GI-GKLSFLSAGSPVPNVGELLASKRMA
Q314L3      RTPGLTDCLL------DGT---DVGEALVPT-GL-GRLSFLPAGRAVPNPGELFASTMMQ
B5EA81      QGVGLSELLT------GEA---QVGETIIPT-GI-GKLSIIRAGRAIENPAELFTSQRGK
C6DZX5      QGVGLSELLT------GEA---QVSETIVPT-GI-GKLSIIRAGRAIENPAELFTSQRGK
A1ARV8      RNVGLADCLT------RGV---DLGEAIIPT-GI-GKLSVVTAGCAVSNPAELLSSARMK
C6CW37      R-QGLTNLLT------SQS---TLQEVIKDG-GI-DNLEIITSGPTPPNPAELLGSHRMK
G9RSY9      AYKGITSALA------DG----SLAESIINMKGL--GLHVMVADAIPPNPVELLGSPRMK
B9Y884      K-KGISDIIG------HQA---EFEEVVL--QPY-ENVDVITAGTKIPFASEFIQSNALK
A5Z5P9      M-EGLAHYLA------EEF---PLENVVY-NTPL-EDGDIIPNVENIINPSMLLESDKFG
Q1AUN8      I-NGLVNAIT------GER---GLSEVLS--EPL-PNLRVCTSGPVPPNPAELLSSNRFA
F2I6Z7      K--GLTTYLT------DRD---VDYMDVAQYVAE-VNTYVIPAGPIPPNPAELLSSQRMS
D4YHG7      V--GLTSLLT------DRD---ASIMDTVNYVAD-ANIYILAAGPIPPNPSELLGSNRMA
C1J9I3      D--GVTTILI------G-K---DEAGAVVEETFV-DNLSVITSGPIPPNPSELLNSKRMA
B1MZT1      H--GLTNYLA------DAH---SELGSIIHHTRM-DTLDVITSGPVPPNPAELLASARMT
H1WR06      H--GLTNYLA------DVH---SELGSIIHHTRM-DTLDVITSGPVPPNPAELLASARMT
H1X4N2      S-VGLTNYLG------DSH---KEISYVVHHTAM-DNLDVITSGPIPPNPAELLGSGRMT
Q03W95      A-SGLTNYLG------DSE---KEVGSIIHRTSM-DNLNVMPSGPIPPNPAELLGSGRMT
F0SX22      S-PGLSNVLV------SLS---SPDEVIH-TMSN-STADVILSGDIPPNPSELLASDQMR
B6W7H4      N-MGLTNVIT------GKV---ELDRALIKDQYE-DNLFVLLSGPVPPNPAEILASNHVK
F0GT81      N-VGLTNYLT------GKV---SLERAINADTSQ-DNLDIILTGPVPPNPAEVLASNVFK
B1R3X6      S-IGLTEYII------GKN---DLNNVIQI--LN-ENFSVITSGRIPPNPSEILSSKSME
Q8XN76      S-IGLTEYII------GKN---DLNNVIQI--LN-ENFSVITSGRIPPNPSEILSSKSME
B1BNK1      S-IGLTEYII------GKK---DLNNVIQI--LN-ENFSVITSGRIPPNPSEILSSKSME
B1V0N7      S-IGLTEYII------GKN---DLNNVIQI--LN-ENFSVITSGRIPPNPSEILSSKSME
Q0SVR8      S-RGLSEFLI------GNV---EFSKVVYK--HE-SGLHVLPSGLVPPNPAEMLASRSME
B1BNH3      S-VGLSEFLI------GKV---EFSKVVYK--HE-SGLHVLPSGLVPPNPAEMLASRAME
Q8XN46      S-IGLSEFLI------GKA---EFSKVVYK--HE-SGLHVLPSGLVPPNPAEMLASRAME
B1V1Z4      S-VGLSEFLI------GKV---EFSKVVYK--HE-SGLHVLPSGLVPPNPAEMLASRAME
G5GFW0      V-YGLSQYLS------GQI---KLEEVIY-STNI-EDMDIIFSGRFAPNPAELLEEELFI
C2EFR6      E-MGLSDYLV------GRA---QFDDVIA-QSNI-ENFSMIFSGPVPPNPSEILDGERFK
F3ATF5      V-QGLSNYLS------GQA---SIAEIIY-RTNY-ENMDIIFSGSFAPNPSELLGQEAFG
D4M2S0      T-NGLSQYLS------GQI---SLEEIIY-STNY-RNLEIIFSGPYAPNPSELLEQGRFG
F4BS19      Q-QGLTSILT------TKN---RQIANLLHKTSQ-ENLELLTSGILPPNPSELLASQRMS
D4CG08      V-HGLTEYLS------GQR---QMEEVIC-TTDI-QGMDIIFAGPYSPNPSELLAEPLFK
D4MP30      V-HGLTEYLS------GQR---QMEEVIC-TTDI-QGMDIIFAGPYSPNPSELLAEPLFK
C6LCS5      I-VGLTNYIT------GQC---EFKEIVC-TTNY-PSLHIIFPGPEPPNPAELLGSEAFS
B0P2G2      D-KGLSHYLT------GQA---EVEDIIY-ETEV-EGLCITVAGPLTPDPTSILDSEQFE
D4MW29      D-KGLSHYLT------GQA---EVEDIIY-ETEV-EGLCITVAGPLTPDPTSILDSEQFE
E5VMX8      D-KGLSHYLT------GQA---EVEDIIY-ETEV-EGLCITVAGPLSPDPTSILDSEQFE
D4JMC2      I-YGLSHYLS------GQV---SLDKVVY-ATNI-KGVFILFAGHEVPNPTELLETKEFK
D6E0V4      I-YGLSHYLS------GQV---SLDKVVY-ATNI-KGVFILFAGHEVPNPTELLETKEFK
D6E330      I-CGLSHYLS------GQR---RLEEVMY-GTEI-PGLFMIFAGPSVPNPTEILEKKYFQ
C4Z8M5      I-CGLSHYLS------GQR---RLEEVMY-GTEI-PGLFMIFAGPSVPNPTEILEKKYFQ
D4JI67      I-CGLSHYLS------GQR---RLEEVMY-GTEI-PGLFMIFAGPSVPNPTEILEKKYFQ
D3AC80      K-FGLTHYLS------GQK---TIDDVIC-NTDI-NNMDMIFAGPVSPNPTELLSGDLFA
G5IFS3      V-FGLTHYLT------RQR---GKREVIY-NTNI-PGMDIIIAGPVSPNPTELLSGRLFE
D4RX67      I-GGLSHYLS------GMY---PLEEVVC-TTNV-ENLDMILSGPVPPNPAELLGGKLLK
A6BIG7      I-KGLTHFLS------GQS---DAKDVIQ-KTQD-SNLHMIFAGAIPPNPAELLNSRRFQ
C0C0F8      L-KGLSHFLS------GQS---EVDDIIY-KTQE-PGLMVIFSGVVPPNPAELLGNKRFS
Q97EP8      N-IGLSNVLA------GQT---KFESASH--WYN-QNLCILTAGKIPPNPAEMLSSKRMK
Q97ER5      N-DGLSNVLA------GHT---KFENASN--WYS-KNLCILTAGKIPPNPAEMLASKRMK
D2RIR2      --QGVTNCLA------QGV---PFAQVVH-PNVF-RNLDVLTSGPVPPNPSELIGSEKME
G0VNK6      --RGLSNCFA------EDL---PLKEVIQ-ADVF-PNLDVVTSGPVPPNPAELLGSKKME
I0GRR2      --KGLSNIIA------TGE---SLESMIQ-NNVI-QNLDVLPSGPVPPNPSEMLGSERMD
A0PZ02      E-KGLSNYLV------GEV---PFEEVVV--NYN-ENLYLLPAGTIPPNPAEMVASKKMK
B1B736      I-KGLSNYLV------GEV---SFEEVAV--KYN-ENLYLLPAGTIPPNPAEMVASKTMR
F6BI62      M-SGLTNIIV------EDD---RYEKYVISDKEF-DNLGIITSGPIPPNPSELIGSNRMK
Q8RBS5      N-RGLTNLLI------DEG---DYEAYLNVDNSY-DNLHILTSGPLPPNPTELLGSNKMK
G2MWC2      S-RGLTNLLI------DEG---DYEAYLNIDNSY-NNLHILTSGPIPPNPAELLGSNKMK
B0K4N1      S-RGLTNLLI------DEG---DYEAYLNVDTSY-SNLHILTSGPIPPNPAELLGSNRMK
B0KAR5      S-RGLTNLLI------DEG---DYEAYLNVDTSY-SNLHILTSGPIPPNPAELLGSNRMK
E8UV29      S-RGLTNLLI------DEG---DYEAYLNVDTSY-SNLHILTSGPIPPNPAELLGSNRMK
C7ISF7      S-RGLTNLLI------DEG---DYEAYLNVDTSY-SNLHILTSGPIPPNPAELLGSNRMK
F7K9V1      R-YGLSHYLS------GQA---SISDISCKT-NI-PDFYVIFSGPVPPNPSELLGNDAFR
F7K8E9      R-YGLSHYLS------GQA---SISDIFCKT-NI-PNFYVIFSGPVPPNPSELLGNDAFG
F7KL96      R-YGLSHYLS------GQA---SISDISCKT-NI-PNFYVIFSGPVPPNPSELLGNDAFQ
C9AAE5      H-VGLSNYIR------RDI---SIESCVQQVILEDCEFSIITSGAIMSNPNDLLASSKMT
H7F6C8      H-LGLSNVMT------GDI---SLEDSIQEVELRASTLSILTSGPIPPNPNDLLSSKKMS
H7F5T6      S-PGLTGIL-------DSSQNLTPEDVIVPV-TD-TNLYVLPVGARPLSPYSILNSAKLG
E6PYQ3      DQPGLSRYLS------DSS--VLPEDCVQRVTEI-PGLDVMPVQEIPPFPSELLSQGRLE
B1R3V1      S-VGLSEFLI------GKV---EFSKVVYKH--E-SGLHVLPSGLVPPNPAEMLASRAME
I5B296      E-QGLSDYLA------KNI---PLSSVLKKS-SV-NKLTILPAGQIPPNPSELLSSDQMR
D4YF13      N-VGLTTALV------NEEY--SLESVIQYS-ED-FDLYILPSGPIPPNPAELVGSQEFS
E6U7N4      R-SGISSVLA------DQKSEDDCIVYLSDL-----NLYVMTSGPIPPNPAELIGSDRMQ
C8VYQ6      I-KGLSNVLI------GEL---SLMKGLLDV-GI-EGLKLLPTGPTPPNPSELLGSQRMK
C0QCJ2      I-PGLSEYLR------AGK---SLGSILRKT-AI-DKLSLLPAGKPPANPSELISSEQMR
C2MBF8      GQLGLSSYLS------DAR--ITPEQIMSPSLQT-ESLIFLPSGPIPPNPTELLMSPRFE
D3AE78      T-RGLSHYLV------GQE---SAENVAYRT-NI-DNMDVIFAGPSTPNPAELLGNAKFE
Q39U17      E-VGLSDCLY------GKV---DVKDALVKT-GI-GKLVVLPAGSRVENPVELLSSGRMQ
B9M2X6      K-LGLTDCLT------RGI---DVGETLIKT-GI-GKLSILPYGKKVENPGELFSSSKMK
A5G424      K-VGLAECLL------DGV---DVGEAIVNT-GI-GKLSVLLHGKTIRNPAELFSSLRMK
E8WSZ5      G-AGLSDILK------GEA---DIGETIVQT-GI-GKLAVIRSGSQVENPVELFSSQKMR
C7LPS3      C-KGLSDCMR------EGL---DVGELLVKT-GI-GKLSVLPAGTPTPNPVELFSSDAMR
C3WFM9      E-RGLESVLT------ENV---NPKDVIIKD-LI-PNFDLLPTKHMRYNVTELFIGDKMK
A4J8V0      I-IGLTNILL------GDT---EIATALQPS-PM-KNLHIVTTGPIPPNPAELLGSQRMT
A8U9F4      R-DGLTTLLT------ERD--VEIKDIAHRL-ET-EGLFVITSGAIPPNPSELLASNRMN
F4BSD9      R-DGLTTLLT------ERD--VEIKDIAHRL-DT-EGLFVITSGVIPPNPSELLASNRMN
F7V792      QPMGLSHYLA------NDC---ELEDVLYAT-KT-EGAHIIPNLNNVVNPSILFEGDRMK
F6IR93      Q-RGLSSWLS------GQLE--DVNDAIHPV--L-AHLFVMPSGPKPPNPAELLASDKMT
G0M0F9      Q-RGLSSWLS------GQLE--DVNDAIHPA--L-AHLFVMPSGPKPPNPAELLASDKMT
F6ITB4      Q-KGLSSWLG------NQLD--DVNDAIHPV--I-GNLFVMTSGPKPPNPAELLGSNKMT
G0M1X9      Q-KGLSSWLG------NQLD--DVNDAIHPV--I-GNLFVMTSGPKPPNPAELLGSNKMT
G0LYN9      H-KGLSSWLA------NQMD--NVNDAIHPV--I-GNLFVMTSGPKPPNPAELLGSNKMT
D7VC13      H-KGLSSWLA------NQLD--DVNDAIHPV--I-GNLFVMTSGPKPPNPAELLGSNKMT
F9UMZ6      H-KGLSSWLA------NQMD--DVNDAIHPV--I-GNLFVMTSGPKPPNPAELLGSNKMT
G7QCG1      E-RGLSDCLL------DGL---DVGQALINT-GI-GKLVLLPAGKAVKNPMELLSSNSMR
I2Q341      E-RGLSDCLL------EGL---DVGPALINT-GI-GKLVLLPAGKAVKNPMELLSSNSMR
H8YYB9      L-PGVSDYLL------EQR---ELAEILVNP-GI-ERLVLLPGHSSFTNSSEMLSTPRMV
I5AV01      QIKGLAHALS------GQC---DGVDVVYAT-DI-PNFFMIYSGPFPPNPTELLGGKIFH
B0GAL3      V-KGLSQYLS------GQA---PVRDILYGT-NY-ENMDVIFAGPMAPNPSELLNGKVFA
G1WUK2      V-KGLSQYLS------GQA---PVRDILYGT-NY-ENVDMIFAGPMAPNPSELLNGRVFA
E0RZL3      R-LGLTHCLV------GRER---LSSVICET-DT-PNLYVIFSGPVPPNPSELLGGRIFS
D8FLF8      S-NGLTTLLT------SRAKEMGANSVIRES-GV-ENLSILTAGPIPPNPSELLSSKHML
F0K0J7      S-NGLTTLLT------SRSMEMDANSVIRES-GV-ENLSILTAGPIPPNPSELLSSKHML
Q1G8E4      S-NGLTTLLT------SRSMEMDANSVIRES-GV-ENLSILTAGPIPPNPSELLSSKHML
C4VP08      R-RGLTTILT------SNNNKFNLDDFAQES-GI-ENLSILTAGPIPPNPAELMGSKRMK
D6S4X4      R-RGLTSILT------SDSNELNLDEFTQDS-GI-ENLSILTAGPIPPNPAELVGSKRMK
D0DJH0      N-TGLTTVLT------SEADEINLNDVVEES-GI-DNLSILTSGPIPPNPAELIGSRRME
C7XKF3      N-TGLTTVLT------SEADAINLNDVVEES-GI-DNLSILTSGPIPPNPAELIGSRRME
E3R264      N-TGLTTVLT------SEADAINLNDVVEES-GI-DNLSILTSGPIPPNPAELIGSRRME
D5GZJ8      N-TGLTTVLT------SEADEINLNDVVEES-GI-ENLSILTSGPIPPNPAELIGSRRME
C2EPK5      H-VGLSTVIS------SSAKEVDLDKVIQDS-GV-KNLSVLTAGPMPPNPSELISSKRMH
A4ZGZ8      H-VGLSTVIS------STAKEVDLDEVVQES-GI-DDLAILTAGPTPPNPSELIGSKRMQ
A8YX89      H-VGLSTVIS------STAKEVDLDEVVQES-GI-DDLAILTAGPTPPNPSELIGSKRMQ
F0NWJ7      H-AGLSTVIS------STAKEVDLDEVVQES-GI-DDLAILTAGPTPPNPSELIGSKRMQ
E4SMV5      H-VGLSTVIS------STAKEVDLDSVVQES-GV-DNLYVLTAGPMPPNPAELIGSKRMR
F0TGY2      H-VGLSTVIS------STAKEVDLDSVVQES-GV-DNLYVLTAGPMPPNPAELIGSKRMR
Q5FIC7      H-VGLSTVIS------STAKEVDLDSVVQES-GV-DNLYVLTAGPMPPNPAELIGSKRMR
F2M2M6      H-VGLSTVIS------STAKEVDLDSVVQES-GV-DNLYVLTAGPMPPNPAELIGSKRMR
G7M0Q3      L-VGISEVLL------GKV---PIEEAVQGY-N--EKLFVLTSGKIPPNPSEMLASLAMT
G7M1R9      L-KGLSEVLI------GKE---ELDNVVLKR-N--DNLDILTSGKIPPNPSEMLSSSSMT
A6M2L9      L-IGLSEVLL------GKA---AIEEAVQKR-N--DNFYFLTSGKIPPNPSEMLSSSAMS
G7M566      L-VGISEILI------GKV---SIEEAVQKR-N--DNLYFLTSGKIPPNPSEMLASSAMS
G2KUP1      Q-NGLSTYLS------GNS---NLDESILKT-DV-DNLDVMVGGPVPPNPAELIGSDRFK
G8PE06      A-KGLSTLLS------GNV---DMDTAIHET-PI-KDLSIMTSGPIPPNPSELLGSERMG
Q03GL8      A-VGLSNLLA------ETG---SLENAIHET-II-NNLSVMPSGPIPPNPSELLGSGKMA
E0NHP4      A-IGLSNLLA------GTG---SLDDAIHST-VV-ENLSVMPSGPIPPNPSELLGSPKMV
F4FXQ7      T-NGLSTALS------TDI---DFNSVVQKT-EI-DNLSVITSGPIPPNPSDLLASNRMK
C0WV35      T-NGLSTALS------TDI---DFNSVVQKT-EI-DNLSVITSGPIPPNPSDLLASNRMK
H1LCW3      T-NGLSTALS------TDI---DFNSVVQKT-EI-DNLSVITSGPIPPNPSDLLASNRMK
C2JZS1      L-DGVTTVLT------GKT---KPDEVVEDT-FV-DNLSVITSGPIPPNPSELLNSKRMG
Q58Z10      L-DGVTTVLT------GKE---KPDDVVEET-FV-DNMSIITSGPVPPNPSELLNSKRMA
E9SAU1      E-VGISSLIG------GLN---SFKEVVHAD-VI-ENLDVVTCGPIPPNPSELMGSDNMK
Q38VG5      K-KGLTSLLT------ED--EFDFNTTIQKT-PV-EHLFVLPCGVVPPNPSELLNTKKMD
F0HVF1      S-NGLTTLLT------SRSKEMDANSVIRKS-GV-ENLSILTAGPIPPNPSELLSSKHML
G6F8G9      S-NGLTTLLT------SRSMEMDANSVIRES-GV-ENLSILTAGPIPPNPSELLSSKHML
C2EWM3      R-EGLTTILT------SDALEMDITNMIKET-EI-DNLSILTSGPIPPNPAELLNSQRMQ
F8DRU2      Q-HGLTTILT------SGTNSVDLHEIIQPS-GV-NNLDILTAGPIPPNPAELLNSQRMK
B3XL23      Q-HGLTTILT------SGTNSVDLREIIQPS-GV-DNLDILTAGPIPPNPAELLNSQRMR
F8KGP1      Q-HGLTTILT------SGTNSVDLREIIQPS-GV-DNLDILTAGPIPPNPAELLNSQRMK
H4GK03      R-QGLTTLLM------DQEHVINSQDVIQAT-EV-PNLDVLTVGPVPPNATGLLNSQRMR
B2GF33      Q-KGLTTVLT------GDSNEVDLSNVVQKS-GV-ENLEVLTAGPVPPNPSELLGSQRMK
C0WW26      Q-KGLTTVLT------GDSNEVDLSNVVQKS-GV-ENLEVLTAGPVPPNPSELLGSQRMQ
D0DSJ4      Q-KGLTTVLT------GDSNEVDLSNVVQKS-GV-ENLEVLTAGPVPPNPSELLSSQRMQ
C0ZHV8      L-YGISSYFS------DMC---QIPDIIQPS-GV-SELSIITAGPIPHNPAEMLGTPRLL
H1BJT1      Q-VGLSDLLVFIDKQPDLS---TYIQEVTVT-DCENAISVLTSGSKVPNPQELLGSSKFK
F8FCE2      R-VGLSNLLA------GQY---TVQELVTET-HI-PHLEMLSAGVIPHNPSELLSSERWV
H6NE43      R-VGLSNLLA------GQY---TVQELVTET-HI-PHLEMLSAGVIPHNPSELLSSERWV
I0BSG4      R-VGLSNLLA------GQY---TVQELVTET-HI-PHLEMLSAGVIPHNPSELLSSERWV
Q83VF9      R-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
G8P3D7      R-VGLTNILM------HQS---SIEDAIQGT-RISENLTIITSGPIPPNPSELLASSAMK
O06030      R-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
G9M880      R-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
G6FD42      K-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
F9VC44      R-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
A9QSJ4      R-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
Q3ZK50      R-VGLTNILM------HQS---SIEDAIQGT-RLSENLTIITSGPIPPNPSELLASSAMK
E3GPC6      K-RGLTNILL------REC---EPTEAIQTT-DV-ENLFMISSGPIPPNPSEILASKRLI
G0V447      Q-KGLTNLFV------EDI---TFEETVQRI-N--DNLYVLTSGILPPNPAEMLSSSKFK
H7F1R7      N-IGLSNLLA------SSDL--AAEEVCSQT-AI-ENLDILTSGTLPPNPNELLASKKMG
E3H7M5      N-YGLEEVLR------GKK---NLEDVILHN-VE-RNLDLLPATSFGENVTELFLGKKIV
E6UHY4      D-LGLSTLIS------GTN---TFKEIVHHN-VI-DNLDIVTCGPIPPNPSEMLGSDNMK
D9QTC6      F-GGLSDLLT------GEL---NFAEGLQKT-NI-EGISLISGGNVPPNPAELLGSQKME
D9SR41      Q-LGLTNVLT------EQC---EIFSAIQKS-EV-RNLYILASGPIPPNPSELLGSKKMQ
E3HB18      R-HGLSEVLM------GER---NVEELIVKE-VE-KNLDLLPTKPMEQNVTELLQSKKME
P95696      N-NGLSSLII------GRT---TMSEAITST-EI-ENLDLLTAGPVPPNPSELIGSERFK
Q2G1K7      N-NGLSSLII------GRT---TMSEAITST-EI-ENLDLLTAGPVPPNPSELIGSERFK
A8YPQ5      N-EGLSSLLL------NWS---TYQDSIIST-EI-EDLDVLTSGPIPPNPSELITSRAFA
Q2FUV2      N-EGLSSLLL------NWS---TYQDSIIST-EI-QDLDVLTSGPIPPNPSELITSRAFA
P39851      N-SGLSNLII------NKT---TYSDSIKET-RV-ENLNVLTAGPTPPNPSELIASSKFA
C5QNG4      Y-DGLSNLII------GKS---DYDKAIRST-RV-PNLDLLTSGPIPPNPSELIDSDRFY
Q4L9H7      Y-DGLSNLIV------GKS---DFETAIRST-RV-ENLDLLTSGPIPPNPSELIASEKFE
A7NQ71      D-VGLTTMIL------AQD---DAPPPLQDT-GV-PGLSLLASGPLPPRPADILGSRRME
E4Q5T5      K-VGLTNLLV------ENK---KFEEIVQKD-GV-EGLDLITSGPIPPNPAELLGSKKFE
E4SDX4      K-VGLTNLLV------ENK---NFEEIVQKD-GV-EGLDLITSGPIPPNPAELLGSKKFE
E4S7Y6      R-FGLTNILA------ENK---LFEEVVQKD-GI-ENLDLLTSGPIPPNPAELLGSKKFE
C6CS80      R-TGLSHVLS------GQA---DLSEVIKET-RI-KGLDVLPSGPVPPNPSELLGSSRME
E6LD64      N-VGFSNLLS------TKE---TMSNVIQAS-VV-PNLSLLTSGPKPPNPSELLSTARMD
F0EKB9      A-SGLSTVLS------TST---SVLEAAQKT-VI-DNLSVLTSGPKPPNPSELLGSARMN
H7F571      N-IGLSNLLT------GDV---EYDEVFRET-EI-DNLFVLTSGTIPPNPNELLASKKMG
F5LE48      R-SGLTNLLL------GEA---PVREVAIPS-HL-PNLYLIPSGPSTPNPAEMLASKRMT
E7RDR3      T-IGLSSVLT------RQS---SIQEVIRAT-AV-ERLDLMTCGPIPPNPAELLASKSMD
E7RG08      S-KGLSNVLV------RRF---SLKMAIQAS-GI-ENLDLLPSGPIPPNPAELLGSSNMD
F6CNF5      H-RGLTNCLL------QNL---DPAEVSKNG-LV-ENLTLVTSGPIPPNPAELLGSGRVR
G2FWX4      G-KGLSVALT------QDQ---DISQYIQET-SV-PGVMVLTAGPVPLNPAELIGTVRMK
G2FM59      G-TGLSVSLV------QDQ---DYCNYIRET-DV-PGVMVLPAGPVPPNPAELVGSKRMK
G7WJV1      R-VGLSIYLV------EDG---DYGGYIRDT-AV-PSVRVLPAGPVPPNPAELLGSKGME
H5XZD4      R-AGLSVYLV------EDQ---DYRKYIWET-VV-PGVRVLPAGPVPPNPAELVGSKRMK
H5XZG7      M-EGLSVSLV------QDQ---GSHAFIKET-EV-PGVSVLPGGPIPPNPAELVGSKRMK
G7W773      F-EGLSNFLV------QDD---QDKDFIRET-AV-PRVKVLTGGPIPPNPAELVGSQRMK
G2FWT8      G-QGLSVALV------QDQ---DYRQYVQET-AV-PGVMVLTGGPIPPNPAELVGSKRMK
I4DBG8      V-EGLSVALV------QDQ---DYINYARET-SV-SGLRVITGGPIPPNPAELVGSKRMK
C0EBA6      G-NGLSSLLG------GFT---KPENTIVED-VR-ENLDLITSGPIPPNPTELLSSSKMR
Q9K6R0      T-RGLTRVLM------RQE---TLEEAIQET-KV-ENLSLLTSGPIPPNPAELLNSKMME
I2HVL2      V-QGLTNVLV------GNA---SLGETVQKT-LI-DNLYVLTSGPTPPNPAELLSSKAMG
D4G1R2      V-TGLTNVLV------GNA---SLSETVQKT-PI-DNLYVLTSGPTPPNPAELLSSKAMG
G4EQZ7      V-TGLTNVLV------GNA---SLSETVQKT-PI-DNLYVLTSGPTPPNPAELLSSKAMG
P71051      V-TGLTNVLV------GNA---SLSETVQKT-PI-DNLYVLTSGPTPPNPAELLSSKAMG
E0U2Z3      V-TGLTNVLV------GNA---SLSETVQKT-PI-DNLYVLTSGPTPPNPAELLSSKAMG
G4P114      V-TGLTNVLV------GNA---SLSETVQKT-PI-DNLYVLTSGPTPPNPAELLSSKAMG
A9VRC3      I-FGLTNVLT------HSE---RLEKCVQTT-LV-DNLHFLACGPIPPNPAELLGSKSMK
C2QJY5      I-FGLTNVLT------HSE---RLEKCVQMT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C2RG49      I-FGLTNVLT------HSE---RLEKCVQTT-SI-DNLSFLACGPIPPNPAELLGSKSMK
C2T8T6      I-FGLTNVLT------HSE---RLEKCVQTT-SI-DNLSFLACGPIPPNPAELLGSKSMK
C2MTG3      I-FGLTNVLT------HSE---RLEKCVQTT-SV-ENLHFLACGPIPPNPAELLGSKSMQ
C2SSX8      I-VGLTNVLT------HSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C2YZB2      I-FGLTNVLT------HSE---RLEKCVQAT-LV-DNLHFLACGPIPPNPAELLGSKSMQ
C3GBJ8      I-FGLTNVLT------YSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C2SBU4      I-FGLTNVLT------YSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C2NQN6      I-FGLTNVLT------HSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C3GRR0      I-FGLTNVLT------HSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C2PN22      I-FGLTNVLT------HSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMQ
C2Y452      I-FGLTNVLS------LSE---RLEKCVQTT-LV-DNLHFLACGPIPPNPAELLGSKSMK
C2WVG6      I-FGLTNVLT------HSE---RLEKCVQTT-LV-DNLHFLACGPIPPNPAELLGSKSMK
C3EBC0      I-FGLTNVLT------HSE---RLEKCVQTT-LV-DNLHFLACGPIPPNPAELLGSKSMK
C2XJH9      I-FGLTNVLT------HSE---RLEKCVQTT-LV-DNLHFLACGPIPPNPAELLGSKSMK
C2P8H3      I-LGLTNVLT------NSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMK
C2ULR6      I-FGLTNVLT------NSE---RLEKCVQTT-SV-DNLHFLACGPIPPNPAELLGSKSMK
C2V4M2      I-FGLTNVLT------HSE---RLEKCVQTT-SV-DNLSFLACGPIPPNPAELLGSKSMK
C3H979      I-FGLTNVLT------HSE---RLEKCVQTT-SI-DNLSFLACGPIPPNPAELLGSKSMK
G2TR25      T-FGLTTVLT------KQG---TLEETAVKT-DV-DHLHVLTSGPIPPNPAELLSSKAMK
P96716      T-VGLTSVLL------KKS---SMEQAVQAS-NE-KHLDVLTSGPIPPNPAELLSSKWMK
G4EQF3      T-VGLTSVLL------KKS---SMEQAVQAS-NE-KHLDVLTSGPIPPNPAELLSSKWMK
D4G2E1      T-VGLTSVLL------KKS---SMEQAVQAS-NE-KHLDVLTSGPIPPNPAELLSSKWMK
I0F9R6      T-VGLTSVLL------KKS---SMEQAVQAS-NE-KHLDVLTSGPIPPNPAELLSSKWMK
E0TTZ6      M-IGLTTVLL------KKS---SLEQAVQAS-NE-KYLDVLTSGPIPPNPAELLSSKWMK
G4P1M7      M-IGLTTVLL------KKS---SLEQAVQAS-NA-THLDVLTSGPIPPNPAELLSSKWMN
A8FHL9      H-TGLTNVLL------NNC---SLEEAILPT-PI-EHLELLPSGTIPPNPAELLSSSVMK
Q5KUM5      Y-KGLTNVLT------GSA---PLLSTCQAT-EI-DHLSILTSGPIPPNPAELLSSNAMA
D3FZP4      T-FGLTNVLT------KQH---TLSEAVKET-KV-EELHVLTCGPIPPNPSELLSSKAMA
I0JRK4      T-SGLSNYLV------RNR---SLKELAKES-RV-ENLDLLPSGPIPPNPSELLGSTMME
I3EBB3      T-IGLTNVLT------RQM---DLMEAVVQT-DE-KKLYVLPSGPIPPNPAELLGSKAMD
E3CP62      PYKGLSNFLS-GNADLNETI------CQTNI----SGLDVIASGPVPPNPTSLLQNDNFR
C2KHF1      NSAGLTNCLGDSHKEISDVV------HRTAM----DNLDVITSGPIPPNPAELLGSGRMT
I0UTA5      KVG-LTQVLA-GQVDIAEAV------YQLEE----SNLFVLTAGRIPPNPSELLGSDKMR
B7BDT8      KG--LSDYLG-KRENNCEDLIV----EKENY----PGLFVLPVGTIPPNPTELLAEPRLA
G9WIQ9      DRG-LTTVLA-MNDQPAEII------NTSEQ----SNLFIMTSGPMPPNPSELLASDKMV
A0NKF6      EHG-LTTVLA-MHEQPASAI------HSTEI----PSLYVMTSGPMPPNPSELLASDKML
Q04DV8      EHG-LTTVLA-MHEQPASVI------HSTEI----PNLYVMTSGPMPPNPSELLASDKML
E7T801      EHG-LSEYLA-GKDELNKVI------QHFGK----GGFDVITRGQVPPNPSELLMRDRMR
F4SM97      ENG-LSDVLS-GKIAFEKAI------KQIDT----CGFDYISRGSVPPNPAELLMHRRLN
G5Q4J0      VDG-LSDILA-GKGEIASCA------KPTAI----ANFDLIPRGQVPPNPSELLMSERFG
G5LQM6      VDG-LSDILA-GKGEIASCA------KPTAI----ANFDLIPRGQVPPNPSELLMSERFG
G5SDT8      VDG-LSDILA-GKGEIASCA------KPTAI----ANFDLIPRGQVPPNPSELLMSERFG
F3CAY9      KHG-LSDTLA-ARLRCTEVI------HQTRV----RHLDFMSCGFAAPNPSELLMHDNFN
A3K8W7      PGP-IGDVLR-GKLAPEDHLIRLGENDFNAG----HNIAFGLNTVTEAYASELLQDPRTR
G7EJX6      FHPGLSNLIV-GTEELTECV------HIDEQ----SGVAIMPSGQIPGNPLELLSNIRFS
B7B947      MG--VTNYLS-GRIDNVDEIIQKGE----LY----DKLDIIHAGPVPPNPAELLLSDRLE
D3LB10      ERG-LTTVLA-MHDQPASLIHSTEVPNLYVM----AS------GPMPPNPSELLSSDKML
S9QRP1      PGA-MGDMLR-GVVPPEQHMLRMGPNTIHAG----HNIAFGFNTESEPYASELLQDPRTA
G8AU96      HGS-VADLLD-GRVGIDDLIHQETTNLGVLG----NAVG-------TPDAHDRISSQAMS
D0D9W0      PGF-MGDMLR-GLLPPERHLVRMGENAIHAG----HNIACGFNGAVEPYASELLQTPRTA
Q0FMP0      PGS-MGDVLR-GLVPPEDHLIRMGENEIHAG----RNIAFGFNGTVEPYASELLQSPQSR
A3W0H7      PGR-MAGFLS-GDLPLERFLACPEDNPLHIG----QTLAMGLNDRAEPYAAEILHAPETG
I1AYC5      PGS-MGDVLR-GRLSAEEHFQRMGDNDIHAG----PNVAFGFNGVVEPYASELLQSPETA
                .   .                                            .      

E9TE88      ELVNWASKNY--D--LVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
B8D0N2      RLLKDLSNNR--D--LVIVDSPPL-VISDSLSMAASVDGVILVVSIGESNKRGFRDGLKM
C2CI44      KFIEDLSEVY--D--YVFIDTPPVGLFTDASIVSTLCDGVIFVIKSSDTKKEDITLALDN
C7RGH6      DFVEDLSKQY--D--YVFIDTPPVGLFTDASLVSTISDGVIFVIKSSDTKKEDISLAIEN
C0CK73      SLMETLRDAY--D--YIIVDAPPMGDLVDGAIISRQVDGTLLVVRNDFVKTKAVKKVKQQ
Q1WTC8      HLIETVKEKF--D--IVIIDTPPMGSVIDAAVIAKNCDGGIIVINSGQASYRQIRKTKEQ
E8JWI5      TMMSVLRRHY--D--YIIVDTPPIGMVVDATLIAKVCDASLLVVSTNEVKRKMVQKSKTQ
F3AHH0      DLLVSLRKVY--D--YILIDTPPLGSVIDSAIVAEECDGAILVIEAGVISHRFAQEVKGQ
F7K0U1      NLISSGRKVY--D--YIIIDAPPLGSVIDSAIIARVCDASVLVISANAISHKFARVVKEQ
C4Z672      ELIESARETF--D--MIIVDTPPIGSVIDAAVMSKFCDGGILVIGAGDISYKFARKSKEQ
P0C0T9      KMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIASACDGFVLVTQAGRIKRNYVEKAKEQ
Q04663      KMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIANACDGFILVTQAGRIKRNYVEKAKEQ
Q67AY4      KMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIANACDGFILVTQAGRIKRNYVEKAKEQ
Q3K0T0      KMIEAIKNIF--D--YIIIDTPPIGLVVDAAIIANACDGFILVTQAGRIKRNYVEKAKEQ
C5NWJ8      IMIEVFREYY--D--YVIIDTPPIGQVIDAAIIAPKTDGVVLLVEANRVKKKSIEKAKEQ
F3A499      IMIEVFREYY--D--YVIIDTPPIGQVIDAAIVAPKTDGVILLVEANRVKKKSIEKAKEQ
Q4JZ55      TLIDSMKKYF--D--YIIVDTPPIGQVIDAAIIAQQCDGIFLVTEMRKTTRRQIFSSLQQ
G5JTD5      RMIEAVREHY--D--YVLLDTPPIGKVVDAAIIAQDCDASVLITEAGVIRSRFVKKAIEQ
G3G7C1      NLLATLRRYF--D--YVVVDCPPLGMVIDAAIIAQKCDAMVLVAGAGHVKRSAVKKVKEQ
G3G7J9      NLLATLRRYF--D--YVVVDCPPLGMVIDAAIIAQKCDAMVLVAGAGHVKRSAVKKVKEQ
G3G7G6      NLIATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGNVRRSAVKKVKEQ
G8DUB0      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQ
G3G7I8      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGYVKRSSLKKVKEQ
G3G7J4      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGNVKRSSLKKVKEQ
G7SG34      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQ
G8DTZ0      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQ
G8DU07      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVLVAEAGNVKRSSLKKVKEQ
A4VTU3      NLLATLRRYY--D--YVIVDCPPLGLVVDAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQ
G7SNU6      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQ
G8DU31      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGSVKCSSLKKVKEQ
D5AGQ5      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQ
Q9X4U7      NLLATLRRYY--D--YVIVDCPPLGLVIDAAIIAQKCDAMVAVVEAGNVKCSSLKKVKEQ
A3CQY2      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
E8KLY9      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F0FHA8      ALLADLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F0I4H5      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F0IAY3      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F0IJI2      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F0IS53      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F2C9N0      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F2CH53      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F3SM32      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F3UDW7      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F3UNJ4      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
F0FQQ5      ALLTDLRVRY--D--YIIVDTSPIGLVIDAAIIAQKCDASFLVTQAGHIKRKAVMKAKEQ
D6R2T8      ILLEALRTRY--D--YIIIDTSPIGLVIDAAIIAQKCDASLLVTEAGAVKRKAVAKAKEQ
F3UUQ2      ILLEALRTRY--D--YIIIDTSPIGLVIDAAIIAQKCDASLLVTEAGAVKRKAVAKAKEQ
E6IZC2      IMIDILRNHY--D--YIVVDTPPIGLVIDAAIIAQKCDASVLVVESGNVKRKTLQKAKEQ
G6A745      MMVDILRNHY--D--YIIIDTPPIGIVIDAAIIAQKCDASALVVESGNVKRKALQKAKEQ
A8AZR3      EMMNILRRHY--D--YIIVDTPPIGLVIDAAIISQKCDASILVAEAGSVKRKALQKSKEQ
F9HJP6      IMMNILRRYY--D--YVIVDTPPVGLVIDAAIISQKCDASILVAESGSVKRKALQKAKEQ
Q4JYT9      TMIDTMRKYF--D--YVIVDTAPIGMVIDAAIITQKCDASILVTAARETKRRDILKAKEQ
Q4JZY1      TMIDTMRKYF--D--YVIVDTAPIGMVIDAAIITQKCDASILVTAARETKRRDILKAKEQ
E1LQJ7      TMIDTLRKYF--D--YVIVDTAPIGMVIDAAIITQKCDASILVTATGETKRRDVLKAKEQ
F9HC65      TMIDTLRKYF--D--YVIVDTAPIGMVIDAAIITQKCDASILVTAAGETKRRDILKAKEQ
E1LPE7      IVIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCDASILVVESGAAKRREVQKAKSQ
F9MJW5      IMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCDASILVVESGAAKRREVQKAKSQ
E8KDN2      TMIDTLRKYF--D--YIIVDTAPIGVVIDAAIIAQKCDASILVTEASVTKRREVQKAKTQ
E8K322      AMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCDASILVTEASATKRREVQKAKDQ
F9PEU4      AMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCDASILVTEASATKRREVQKAKDQ
F9PZP7      AMIETLRKYF--D--YIIVDTAPIGVVIDAAIIVQKCDASILVTEASATKRREVQKAKDQ
C1CBD1      DMIETLRKYF--D--YIIVDTAPIGVVIDSAIITQKCDASILVTATGEVNKRDVPKAKQQ
Q7WVX0      DMIETLRKYF--D--YIIVDTAPIGVVIDSAIITQKCDASILVTATGEVNKRDVPKAKQQ
P96475      DMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCDASILITATGEANKRDVQKAKQQ
Q9AHD2      DMIETLRKYF--D--YIIIDTPPIGIVIDAAIITQKCDASILVTATGEANKRDIQKAKQQ
Q4K2Q7      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4K0T5      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4K0E1      DMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCDASILITATGEANKRDVQKAKQQ
Q9AH95      DMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCDASILITATGEVNKRDVQKAKQQ
Q4K1M4      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4JZ18      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDAQKAKQQ
Q54520      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4JYH5      DMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCDAFILVTATGDVNKRDVQKAKQQ
Q4K0V2      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
A5M4L1      DMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCDASILVTATGEANKRDVQKAKQQ
B2ILP5      DMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCDASILVTATGEANKRDVQKAKQQ
C1CCB9      DMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCDASILVTATGEANKRDVQKAKQQ
Q4K1S7      DMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCDASILVTATGEANKRDVQKAKQQ
P72512      DMIETLRKYF--D--YIIVDTPPVGIVIDAVIITQKCDASILVTATGEANKRDVQKAKQQ
Q4JZ84      DMIETLRKYF--A--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4K0X5      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4K0Z6      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEVNKRDVQKAKQQ
Q4K195      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGETNKRDVQKAKQQ
Q4K0A0      DMIETLRKYF--D--YIIVDTPPIGIVIDAAIITQKCDASILVTATGEANKRDVQKVKQQ
Q4K0K2      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEANKRDVQKAKQQ
Q4K1F9      DMIETLRKYF--D--YIIVDTAPIGIVIDAAIITQKCDASILVTATGEANKRDVQKAQQQ
Q4K045      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGGVNRRDIQKAKEQ
G6C7Z1      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITQKCDASILVTAAGETNRRDIQKAKEQ
D2ERX8      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTAAGETNRRDIQKAKEQ
F9LZC4      TMLETLRKYF--D--YIIVDTAPVGAVIDAAIITRKCDASILVTAAGETNRRDIQKAKEQ
F9P1W8      TMLETLRKYF--D--YIIVDTAPVGAVIDAAIITRKCDASILVTAAGETNRRDIQKAKEQ
I0J9C9      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITQKCDASILVTEVGEINRRDIQKAKEQ
A6YIA8      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDAFYFMDEAGEINRRDIQKAKEQ
Q4K005      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEVNRRDIQKAKEQ
Q4JZL7      TMLETLRKYF--D--YIIVDTAPIGVVIDAAIITRNCDASILVTEAGEINRRDIQKAKEQ
E5F5C5      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCDASILVTEAGEINRRDIQKAKEQ
Q4JZG7      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCDASILVTEAGEINRRDIQKAKEQ
Q4JZK1      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCDASILVTEAGEINRRDIQKAKEQ
A5LJS0      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q9AHB7      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4K1B7      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRNCDASILVTEAGEINRRDIQKAKEQ
Q4JYK8      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4K0M3      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEVDEVNRRDIQKAKEQ
Q9AHA4      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q9X9A1      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q9ZII6      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q8KWQ0      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4JZW7      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4JYX9      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEITRRDIQKAKEQ
Q4K0R7      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4K1K6      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4JZS3      TMLETLRKYF--D--YIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQ
Q4K0I2      TMLGTLRKYF--D--YIVVDTAPIGIVIDAAIIMQKCDASILVTKAGETKRRELQKAKEQ
Q4K254      TMLGTLRKYF--D--YIVVDTAPIGIVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
Q4K237      TMLGTLRKYF--D--YIVVDTAPIGIVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
B1I967      TMLETLRKYF--D--YIVVDTAPVGVVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
G6J8A4      TMLETLRKYF--D--YIVVDTPPVGVVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
G6LKG5      TMLETLRKYF--D--YIVVDTPPVGVVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
Q9ZFT8      TMLETLRKYF--D--YIVVDTAPVGVVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
D6ZQI8      TMLETLRKYF--D--YIVVDTPPVGVVIDAAIIMQKCDASILVTKAGETKRRDLQKAKEQ
Q4K2A8      TMLETLRKYF--D--YIVVDTAPVGVVIDAAIIMQKCDASILVTKAGETKRRDIQKAKEQ
Q8VU31      TMLETVRKYF--D--YIVVDTAPVGVVIDAAIITQKCDASILVTKAGETKRRDIQKAKEQ
Q4K2E1      TMIDTLRKYF--D--YIIVDTAPIGIVIDAVIVTQKCDASVLITAVGEVHRRDVQKAKEH
Q4K2F7      TMIDTLRKYF--D--YIIVDTAPIGIVIDAVIVTQKCDASVLITAVGEVHRRDVQKAKEH
A5YTV7      TMLDTLRKYF--D--YIIVDTAPIGVVIDAAIITQQCDASVLITAAGETNRRDVQKAKEQ
F9Q345      TMLDTLRKYF--D--YIIVDTAPIGVVIDAAIITQKCDASILVTAAGETNRRDIQKAKEQ
Q6L5R0      TMLDTLRKYF--D--YIIVDTAPIGVVIDAAIITQKCDASILVTAAGETNRRDIQKAKEQ
A5YTT9      TMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQQCDASVLVTAAGETNRRDVQKAKEQ
E6KKS0      TMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQQCDASVLVTAAGETNRRDVQKAKEQ
F2QF90      TMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQQCDASVLVTAAGETNRRDVQKAKEQ
E0Q2S8      TMLDALRKYF--D--YIIVDTAPIGVVIDAAIITQKCDASILVTAVGETNRRDVQKAKGQ
A1ILY1      TMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQKCDASVLVTAAGETNRRDVQKAKEQ
Q6L5T0      TMIDTLRKYF--D--YIVVDTAPIGVVIDAAIITQKCDASVLVTAAGETNRRDVQKAKEQ
E9FEC5      TMLDTLRKYF--D--YIIVDTAPIGVVIDAAIVTQKCDASVLVTAAGETNRRDVQKAKEQ
E0PPH9      TMLDTLRKYF--D--YIIVDTAPIGVVIDAAIVTQKCDASVLVTAVGEANRRDVQKAKGQ
F5VSG9      TMLDTLRKYF--D--YIIVDTAPIGVVIDVAIVTQKCDASVLVTAVGETNRRDVQKAKGQ
E3CBS0      VMMDALREHF--D--YIIVDTPPIGIVIDAAIIAQRCDGTVLITESGANGRKAVQKAKEQ
F9M366      VMMDALREHF--D--YIIVDTPPIGIVIDAAIIAQRCDGTVLITESGANGRKAVQKAKEQ
E8K786      VMMDALREHF--D--YIIVDTPPIGVVIDAAIIAQRCDGTVLITESGANGRKAVQKAKEQ
F8DFF4      MMMEALRRHY--D--YIIVDTPPIGVVIDAAIIAQRCDGTVLVVESGTNRRKMVQKAKEQ
I1ZPH7      MMMEALRRHY--D--YIIVDTPPIGVVIDAAIIAQRCDGTVLVVESGTNRRKMVQKAKEQ
E7S8W3      VIIEALRNHY--D--YIIVDTPPIGMVIDAAIIAQRCDGSLIVTAAGAVSRKAVQKAKEQ
D0RXH2      VIMGVLREHY--D--YIVVDTPPIGMVIDAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQ
Q83YR5      VIMGVLREHY--D--YIVVDTPPIGMVIDAAIIAQRCDGSFLVSASGAVSRKAVQKAKEQ
Q8GP54      HLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQADASLLVTEAGKIKRRFVTKTVEQ
F8HDC3      QLLEIVRAQY--D--YVIIDTPPIGLVIDAVIIAHQADASLLVTAAGRIKRRFVTKAVEQ
F8LJ75      QLLEIVRAQY--D--YVIIDTPPIGLVIDAVIIAHQADASLLVTAAGRIKRRFVTKAVEQ
E9DM17      HLMDVARSQY--D--YVIIDTPPIGLVIDAVIVAHQADASLLVTAAGKIKRRFVTKAVEQ
I0QIK6      HLLDVARSQY--D--YVIIDTPPIGLVIDAVIVAHQADASLLVTAAGKIKRRFVTKAVEQ
E8KUY8      HLMDVARSRY--D--YVIIDTPPIGLVIDAAIIAHQADASILVTAAGKIKRRFVAKAVEQ
Q7X553      HLMEVARSRY--D--YVIIDTPPIGMFIDAAIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q8GP92      HLMEVARSRY--D--YVIIDTPPIGRVIDAVIIAHQADASLLVTEAGKIRRRLVTKAVEQ
Q7X561      HLMEVARSRY--D--YVIIDTPPVGLVILAVIIAHQADASLLVTAAGKITRRFVTKAVEQ
Q7X549      HLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQADASLLVTEAGKIKRRFVTKAVEQ
G6ERT1      HLMEVARSRY--D--YVIIDTPPIGMFIDAAIIAHQADASLLVTAAGKIKRRFVTKAVEQ
O87931      HLMEVARSRY--D--YVIIDTPPIGMFIDAAIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q8GPF6      HLMEVARSRY--D--YVIIDTPPIGRVIDAVIIAHQADASLLVTEAGKIKRRFVTKAVEQ
Q7X555      HLMEVARSRY--D--YVIIDTPPIGLVIDAGIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q7X557      HLMEVARSRY--D--YVIIDTPPIGLVIDAGIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q7X563      HLMEVARSRY--D--YVIIDTPPIGRVIDAVIIAHQADASLLVIAAGKIKRRFVTKAVEQ
Q8GMA5      HLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q8GPA8      HLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q55205      HLMEVARSRY--D--YVIIDTPPVGMVIDAVIISHQADASLLVTEAGKIKRRFVTKAVEQ
C2LSE6      HLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQADASLLVTAAGKIKRRFVAKAVEQ
Q7X559      HLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQADAKFLVTAAGKIKRRFVTKAVEQ
F8LXJ4      HLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q1WCR1      HLMEVARSRY--D--YVIIDTPPVGLVIDAVIIAHQADASLLVTAAGKIKRRFVTKAVEQ
Q8GPC3      HLMEVARSRY--D--YVIIDTPPIGLVIDAVIIAHQADASFLVTAAGKIKRRFVTKAVEQ
E8JMT9      AMIEIVRGLY--D--YVIIDTPPLGLVIDAAILAHHSDASLLVTKAGADKRRTITKLKEQ
F5X0J9      AMIETVRGLY--D--YVIIDTPPLGLVIDAAILAHHSDASLLVTKAGEDRRRTVTKLKEQ
H2A602      AMIEIVRGLY--D--YVIIDTPPLGLVIDAAILAHYSDASLLVVKAGADKRRTVTKLKEQ
E0PD83      AMIETVRGLY--D--YVIIDTPPLGLVIDAAILAHYSDASLVVAKAGVDKRRTITKLKEQ
F5X652      VMIETVRGLY--D--YVIIDTPPLGLVIDAAILAHYSDASLVVAKAGVDKRRTITKLKEQ
G5KD11      QMIETLRGIF--D--YIIIDTPPIGLVIDSAIVAQKADASILVTQEGVIKKRFIQKAKDQ
B9DUJ4      YMIDTLKEVF--D--YIIIDSPPIGLVIDAAIIGQKADGSIIVTQAGAIKRRFIQKAKDQ
G5KAJ2      YMIDTLREVF--D--YIIIDTPPIGLVIDSAIVAQKADASVLVTEAGVIKRRFVQKAKEQ
F1Z124      FMIDTVKELF--D--YVIIDTPPIGLVIDSAIISQKADANILVTEAGAIKRRFIQKAKEQ
Q2KM74      FMIDTVKELF--D--YIIIDTPPIGLLIDSAIIAQKADATILVTEAGSIKRRFVQKAKEQ
C6LDI8      ALLDGAREVY--D--YIFVDSPPIGSVIDAAVVAKQCDGVVYVVESGVTSYHLAKRGKEQ
D4J4T6      AAIEAMKKSF--N--YIIVDCAPIGAVIDAAVVAKSVDGMVMVIEQKKVSRRMAQKMKEQ
D4LTH2      ELLDKLATEY--R--FVIIDTPPLGSVSDGALIASMCDGALLVIRAGSVPKTIIRQSLHE
D4LG06      ELLDRLAGEY--R--FVIVDTPPLGSVSDGALIASLCDGAILVVRAGQTPKAMIKQSLYE
A7VF42      ELLDKLAEQY--R--YVIIDSPPLGSVADAAQVASLCDGAVLVVRSGETSRNVIRQSMQQ
A8SQS8      EILDKLAETY--R--YVIIDSPPLGSVADAAQIASLCDGAVLVVRAGETSRNLIKQSFQQ
D5HFS4      ELLDKLAETY--R--YVIIDSPPLGSVADAAQIASLCDGAALVVRAGETSKSLIKQSFQQ
C9LAS1      ELLAEVRGYY--D--YIIIDTPPVGSVIDAAIIAKESDGAVLVIESERVSYKVAQKSMEQ
F3AH92      DFLKEKKEQY--D--YIFVDTPPIGSMIDAAVVAEKSDGAILIVESDAVSYKVAQKAKQQ
I5ASF8      RLLAASAESF--D--YVFIDTPPLGQIIDAAQIGRFCDGCIIVIESGAVSYRAAQKVKRQ
E7GL81      KLIDHAREEY--A--YVIIDTPPMSTIIDGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQ
G5F9E2      KLIDHAREEY--A--YVIIDTPPMSTIIDGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQ
E7GL57      KLVAWARENF--D--YVIIDTPPMGNLIDGAIISRNCDGAILVIESGNISHRLLQKVKGQ
G5F9A9      KLVAWARENF--D--YVIIDTPPMGNLIDGAIISRNCDGAILVIESGNISHRLLQKVKGQ
E7GL40      KLIAWARECY--D--YILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQ
G5F9H2      KLIAWARECY--D--YILIDSPPMGSVIDGAVISRHCDGAILVIESGAISYRLLQKVKNQ
A8RK85      TMIESVKEIY--D--YIIIDTPPMANVIDGAIIASQCDGAVIVIESGAISYRLVQKVRSQ
G5HTB2      ELLEKAKERY--D--YIIIDTPPMANLIDGAIIANQCDGAVIVIESGTISYHLVQKVKGQ
G5HNC5      ELLDRARLKY--D--YIIIDTPPMANLIDGAIIASLCDGAVIVINSGTISYHLVQKVKSQ
C0CZV9      ALIRQMRQEY--D--YLIIDTPPMGNLIDGAIVARQCDGAVMVVESGAVSYRLEQRVKNQ
A8RSK9      DMISKLKEKY--D--YVIIDTPPMANLIDGAIVARQCDGAVMVIESGSISYRLEQRVKGQ
C5EN03      KMIDTLKKEY--D--YVIIDTPPMANLIDGAIVARQCDGAVMVVESGCISYRLEQRVKSQ
G5HG45      QMVQELKKTY--D--YVIIDTPPMANLIDGAIVARQCDGAVMVVESGCISYRLEQRVKGQ
D9ST44      NLIEDLKETY--D--YIIIDTPPVTIATDAQLLSTYADGCVLVVASSQVEKAAALKAKAL
G2Z8Q3      KLLKEAKDYY--D--YILVDSPPVI-VADTTIISQQMDGIIMVAEESKTQKQKFHKALTT
C8W5K2      EFISDLAEMF--D--IVLIDTPPVAPLTDAALMASNMDGVLLVVAQSKSKIAMVQKSKEL
A5V0I3      AIIQRLRGMA--D--MVLFDTPPVIAVTDAAVLATRVDGVLLVLEAGRTRRDRARRAREI
F5LM71      DLLERLKQEF--D--VILVDTPPVLAVSDAQVVATQCDGVVLVVNAGGVKRELVQKARDS
D7VBW4      EFLTVATRKL--D--LVIVDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSA
F9UQ54      EFLTVATRKL--D--LVIVDAPPILPVTDARILAGQVDGTVLVVRQNFVEKVAVRQAVSA
H6LKR8      QLIIACRKEY--D--IILIDTPPVLNFADASIVSKVADGSLLVVAANETKKAMIVEAKKT
E0I7B5      QLLAELKNQY--D--MILIDTPPNLAVPDGMIISANCDGVVLVVQAGKVKRDMVRKAKTN
D7UYE4      LIFEELQKEY--D--FIVVDTPPVNTVTDAQLFAELAKHVVYVVDAKKSHRDDVKKGKEL
Q4A120      DLFEELKQRY--D--FILIDTPPVNTVTDAQLFGELTKNAVYIIDVETNNKESVKKGKNL
D9SVC7      KLIDLVENNF--D--MVIIDGPPILLVTDSQLLANQVDGVLLVTCYGKTEKKALVKAKKT
D9S1J9      NFLDEVASLY--D--MVLIDAPPVNSVADAAILSTLVDGVILVVEEGSTEREAAVAAKQQ
C0GGR5      DFITSLEEHF--D--IILVDAPPALAVTDASVLASYLDGVILIAASGQAPLEQVVAAKEQ
C6CSC8      ALLDELRTMY--D--IVLVDTPPLLAVTDAQIAATKSDGVVLVVDQGRVKRQFAQKAIQN
A3ICA3      FLLHEVKEQY--D--IVMIDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSI
B1HR41      LLLHEVKERY--D--IVMIDAPPLLFLSDAQILSNKCDGTLLVVNTGTVGKAAVVKSKSI
D6Y034      TVLQEAEEMY--D--YIIIDSPPILAVTDAQLLAAKVEGVVLVTSSGKTEREAAKKSKEL
Q8EME8      FFIEEAKQSY--D--IVIFDMPPVLAVTDAQVMSNFVDGTILVVRSKQTENDAANRAMEA
F3Y922      RLIEEWKNNY--D--LIIFDTPPILAVTDAQILASKVDGTILVAREKIAEKSALLKAKEL
G4L594      QIMEEARNIF--D--IVIFDMSPVVAVTDAQIMSSKADGTLLVVRENWTRKDALSKAKEL
C9B454      QILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKTKEL
Q3XYS6      QILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLNKAKGL
C9ALZ9      QILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLTKAKEL
C9BUG7      QILSEARQLF--D--VVIFDMPPVVAVTDAQIMSLKTDGTLLVVRENMSRKESLTKAKEL
D4RJF4      QILAEARQLF--D--VVIFDMPPVVAVTDAQIMSSKTDGTLLVVRENTSRKESLSKAKEL
C8ZXT9      QVMAEAKKLY--D--IVIFDMPPVVAVTDAQIMASKADGTILVVRENVSRKEPLTKAKEL
G5IRQ6      QVMAEAKKLY--D--IVIFDMPPVVAVTDAQIMASKADGTILVVRENVSRKEPLTKAKEL
C9A6V5      QVMEEAKNLY--D--VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDL
C9CHY8      QVMEEAKNLY--D--VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDL
Q814Z0      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
B9IRQ6      ELLAQAYSMY--D--LIIFDLPPILAVTDAQIMANVCDASILVVRSELTEKETAVKAKAL
B7HXB4      ELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
Q72XH8      ELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTDKETAVKAKGL
A0RL70      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGL
Q6HB09      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKESAVKAKGL
F0PU64      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
B7HFH1      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
B7IQS8      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
B3ZRD6      ELLAQAYSLY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
B5UQ73      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
G9QCG3      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
Q3EV64      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
Q5WBB4      LVLQEAREKF--D--MVILDTPPVMAVADAQILANKVDGTIIVTSSGKTDREQLQKTKEN
B1YMM5      TLILKLRDEY--D--IIVLDAPPLLQVADSRITSKLTDGVVLVVGCTTSDRQRVLKAKEQ
D7WMM8      SVMEELKKEF--D--IIIFDAPPLLSVTDAQILSNKCDGTLLIVNSGVAENENVLKAKSY
A7Z921      ELIQEMYSRY--S--LVIFDSPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDA
I2CAF2      ELIQEMYSRY--S--LVIFDSPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDA
A7Z9K0      DLLSEAAEVY--D--KVILDTPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEA
I2CB16      DLLSEAAAVY--D--KVILDTPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEA
I2HW53      DLLSEAAAVY--D--KVILDTPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEA
G9QKR4      QMLAEAYKQY--D--LVIFDSPPVLAVTDAQVLANQCQGTVLVVKSGVTELESALKAKEL
D5DBK3      ELLKEMKQEF--D--MVIFDTPPILAVADAQILASQVDGSILVVSSGKTDKEAALKAKEL
D5DY81      EVLGEMTERF--D--MVIFDTPPILAVADAQILANQVDASLLIVSSSKTEKEAALKAKDL
Q2BFS5      EFLVNVQKEF--D--VVLFDTPPILAVADAQILANKVEGTMLVISSGYTEMEQAEKATEL
A4ITF3      RLLRELNEMY--D--LVIFDTPPVLAVTDAQILANKCDCTVLVVSSGNTETDAAVKAKEL
C5D961      QCIQQLYNEF--D--LLIFDTPPVLAVTDAQILANQCDGTILVIESGGTEIEAAVKAKEL
G8MZ93      QCLEQLYETF--D--LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKEL
F0G6H5      ELIERLSSQY--R--MIVIDGSPLLPVTDGLALGRLAGIVFLVARSGVTTLTEIDESVRR
F2I4B7      ELMDQLRNVF--D--IIVLDCPPVLAATDAQVVSARVDGTVVVVPYGQCTKDEVKESQAL
Q74BQ8      DLLDEIRHRY--PDRYVIIDAPPALPFAEVRSLSNLVDSIVFVVREGQSSLANIDEAISA
F0JCB8      ESLAEMKNRY--ADRYIIIDSPPVLPFAESRNLSRLADGVVLVIKEGQASQADLRDTIEA
Q314L3      DLLLQMKHRY--TDRYLIIDTPPVLPFSETRSLSRVVDGVVMVVRENVATMEDLRESLEA
B5EA81      ALLTELKLRY--PDRYIILDTPPVLPFAEARSLAHLVDGVLFVVMERLVSQANLKDALES
C6DZX5      ALLTELKLRY--PDRYIILDTPPVLPFAEARSLAHLVDGVLFVVMERLVSQANLKDALES
A1ARV8      TFVEEIKHRY--TDRYIIFDTPPLLPFAETRSLAHLVDGVVFVVKEQTATKDNVSDAIEA
C6CW37      VILEELRARY--D--LILFDTPPVLPVTDSLIMSSYCDGVLLVIHAGKVKKAYVRKAKER
G9RSY9      NLIDELDKHY--E--YIIFDTPPVSVVTDAAVLSQYADGVILVVRQNYATFDEVGLAKKN
B9Y884      EFIEERKKEY--D--LILLDCPPVGLVTDGIVAASYCDGTILVCASNRNDRKELLRVKDQ
A5Z5P9      NMLNQLAEDY--R--YVFVDAPPLGLVSDAEKIGSMCDGAILVIRSGETSKSEVKSSIKQ
Q1AUN8      ALVEEARQGF--D--YVLIDSPPVEPVADPLILATHADGVLLVLDAQRTRKGALRKALHD
F2I6Z7      DLLEDVTAVF--D--LVIIDAPPLLPVTDAQIIASRTDASVFVLREGVASYQDIQKSKRL
D4YHG7      ELIGELEEMF--D--LVIFDTPPILAVTDAQVVATRVDGVIVVVRSGIANKNEVRKTKDL
C1J9I3      NLLNWARENY--D--IIVLDTPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLRRTVEV
B1MZT1      TLITQLRDHY--D--LVIFDVPPFLMVTDAQVLMSRMDGVAIVVSGGRTTKGALQRTSEI
H1WR06      TLITQLRDHY--D--LVIFDVPPFLMVTDAQVLMSRMDGVAIVVSGGKVTKGALQRTSEI
H1X4N2      ELVTQLKSQY--D--LIIFDVPPFLMVTDAQVLMSKVDGVAIVINGGKTNKGALQRTNEI
Q03W95      NLITQLKTHY--D--MIIFDVPPFLMVTDAQVLMSKMDGVAIVVNGGKTNRGAIQRTHEI
F0SX22      LLLEQLAKKY--D--YIFLDSPPINLVTDAVILSKWLTGILFVVRAGLSEKGSVINAVNH
B6W7H4      ELIEELSQRF--D--YVFLDTPPVGLFTDASIVSTYCDGVIFAIKSNDTKKDEVSHALEN
F0GT81      KLIEKLSSMY--D--YVLIDTPPVGLFTDASIVSTLSDAVIFAIKSSDTKRDEISQALDN
B1R3X6      NLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCDGTILVVRAESTSKESIIKAYKE
Q8XN76      NLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCDGTILVVRAESTSKESIIKAYKE
B1BNK1      NLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCDGTILVVRAESTSKESIIKAYKE
B1V0N7      NLLKALSVCY--D--YVILDTPPLTAVTDAQILAGKCDGTILVVRAESTSKESIIKAYKE
Q0SVR8      HLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVDGTILVVKYGYTKKDGVIEAVKG
B1BNH3      HLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVDGTILVVKYGYTKKDAVIEAVKG
Q8XN46      HLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVDGTILVVKYGYTKKDAVIEAVKG
B1V1Z4      HLLTQLEEKY--D--YIILDTPPVNAVADSKILSTKVDGTILVVKYGYTKKDAVIEAVKG
G5GFW0      QLIDRASKEY--D--YIIIDTPPMANVIDSAVIAKSCDGAVIVIESGKISYKTAQKVKLQ
C2EFR6      HLIETVKEKF--D--IVIIDTPPMGSVIDAAVIAKNCDGGIIVINSGQASYRQIRKTKEQ
F3ATF5      TLLGAVREHY--D--YIIVDTPPIGSIIDAAIVAKQCDGAVLVFESELVSSKEAARVKEQ
D4M2S0      RLIEETRKVY--D--YILIDTPPIISMSDAAIAAKQCDGAILVIESEAVSRRDAMKAKEQ
F4BS19      QFIETVKQEY--D--LIVFDLPPVNVVTDAQVMGNKSDGTVFVIRKEVADLSEILKAKEL
D4CG08      ELILKKREEY--D--YILIDTPPMAGITDGAIISTVCDGAVLVIAAGTVSRRIERRIKEQ
D4MP30      ELILKKREEY--D--YILIDTPPMAGITDGAIISTVCDGAVLVIAAGTVSRRIERRIKEQ
C6LCS5      DMLGHMRENY--D--YVIIDTPPLGNVIDSAVIAKECDGAAIVIAADAVSYKFVRKVKEQ
B0P2G2      QFIENVRDMF--D--YVIIDAPPLGVVIDAVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQ
D4MW29      QFIENVRDMF--D--YVIIDAPPLGVVIDAVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQ
E5VMX8      QFIEKVRDMF--D--YVIIDTPPLGIVIDAVIIGKYTDGAVIVIEQGVIKRKIVQDVIKQ
D4JMC2      ELIEFGEKNF--D--YVLVDTPPTGAAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRT
D6E0V4      ELIEFGEKNF--D--YVLVDTPPTGAAIDAAVVGKNVDGAVIVAAQNVTSSRAIINTKRT
D6E330      ELLNFGKEHF--N--YIIIDCAPIGAAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQ
C4Z8M5      ELLNFGKEHF--N--YIIIDCAPIGAAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQ
D4JI67      EILNFGKEHF--N--YIIIDCAPIGAAIDAAVVAKYCDGAIIVIGQGMASARMIQSVKKQ
D3AC80      ELIQKAREEY--D--YVIIDAPPLGSVIDAALIARHVDGTIIVVESGAISYKMVQHVKEQ
G5IFS3      QLLQSERDNY--D--YIIVDAPPLGSVIDAAIIAKHIDGAIIVVESGAISYKLAQNVKSQ
D4RX67      EMITRLKKVY--D--YIIIDTPPLGNVVDSAIISSQCDGTALVMASGVISARFAEEIVEQ
A6BIG7      ALLASARKLY--D--YVIIDAPPLGSVIDAAVIAKYCDASVLVVASKTVGHKFAKDVKEQ
C0C0F8      SFITSARKIY--D--YIIIDAPPLGSVIDSAIAAAVCDAAVLVIAANAISYKFARVVKEQ
Q97EP8      AFLNEAKGVF--K--YIILDAPPVIAVTDPQILSTMVDGVVLVVSSGVADIEAAKRAKEL
Q97ER5      AFLAEARGVF--K--YIILDAPPVIAVTDPQILSTMVDGVILVVTSGVADIEAAKRAKEL
D2RIR2      QLLDRAGNAY--D--YVLIDLPPVLAVTDAALLGNLADGVVLVVHSGMVAPEEVQEAKKR
G0VNK6      ALLQEAAETY--D--YVFLDMPPVLAVTDAALMSSRVDGTVIILGSGDIGPDEGKQAKSL
I0GRR2      NLLKTVGENY--D--YVFIDMPPILAVTDATIIGTKMDGVVFVVRSGKVTPDEAKEAKQR
A0PZ02      KFLESLKENF--D--YIVIDTPPVIAVTDAQILSTIVDGVLLVAASGQAEKEAAIRAKEL
B1B736      NFLESLKETF--D--YIVLDTPPVIAVTDAQILSTVVDGVLLVTASGQAEKEAAIRAKEL
F6BI62      VFLDRLKEDY--D--YVLLDAPPVLLVTDPTVLAPVVDGVILVIQANKTEIEATKRAKEI
Q8RBS5      KLISLIRENY--D--YLFIDSPPVVTVTDAVVLAPVVDGVILVVHAGKTEIEAASRAKEI
G2MWC2      KLLSNIQKDY--D--YVFIDSPPVVTVTDAVVLAPVVDGVILVIQAGKTEIEAISRAKEI
B0K4N1      KLLSSIQENY--D--YVFIDSPPVVTVTDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEI
B0KAR5      KLLSSIQENY--D--YVFIDSPPVVTVTDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEI
E8UV29      KLLSSIQENY--D--YVFIDSPPVVTVTDAVVLAPVVDGVILVIQAGKTEIGAVSRAKEI
C7ISF7      KLLSSIQENY--D--YVFIDSPPVVTVTDAVILAPVVDGVILVIQAGKTEIGAVSRAKEI
F7K9V1      LLLEYLRKEY--D--YVIVDTPPLGSVIDGAVAAQHCDGTVIVVESGAISYKFAQKVKEQ
F7K8E9      LLLEYLRKEY--D--YVIVDTPPLGSVIDGAVAARYCDGTLIVIESGAISYKFAQKVTEQ
F7KL96      LLLEYLKKEY--D--YVVVDTPPLGSVIDGAVAAQHCDGTLIVIESGAISYKFAQKVTEQ
C9AAE5      AALQEVKQRY--D--VIIIDTPPVNVVSDALILAKKVDGVLLVVHAEKTNKQSAKNAVKK
H7F6C8      ELIEALRDSF--D--KIIIDTPPVTIVSDALVLADSADGTVLVCRYHKTLKEKAKHAVNQ
H7F5T6      QLIEQLKEIF--D--MIIIDTPPVMMVKDALLVSKWAEASVLIARGGYSNKIDIKKSLKN
E6PYQ3      ELLVWARDHY--D--YVLIDTPPILLVTDALIIANYCDTLLVVARIGVAQRKGLFRIRHD
B1R3V1      HLLTQLEEKY--D--YIILDTPPVNAVTDSKILSTKVDGTILVVKYGYTKKDAVIEAVKG
I5B296      RLLHEVKLRY--NDRYIIIDTSPPYITSETNAIARFVDGIILVIRHGKTRIKEVLDILDI
D4YF13      VLLDQITELF--D--LVIFDTPPLHSVTDGQIISGKVDGTILVVRQNYVRRDQVVEAKVS
E6U7N4      HLIRRLEEKF--D--YILIDTPPVSVVTDAALASRLVHGVIFVLRQKYTTTEIAQQAQNN
C8VYQ6      NFIAELYEVF--D--IILVDTPPVVPVTDAALMAANVDGVLLVVASGQAKIEMTLKAKEL
C0QCJ2      RLLQEVKGRY--EDRYIIIDSPPPYLTAEANALARQVDGIIIVVKAGKTKRSDVQDLIDT
C2MBF8      ELLQYADEAF--D--YIVMDTIPVLNLADTRVISHLTDITIMVVRENHLPRRLLHELEAL
D3AE78      EMLRGAREHY--D--YVLIDSPPLGSVIDAAIIARNVDGAVIVVESGVISYKMVQKVKGQ
Q39U17      SFIAEIKNRY--PDRYIIIDTPPLLSFAETYSLANMVDGVVFVVKEGGATMSNVKDALGH
B9M2X6      SLIAEIKSRY--PDRYIIIDTPPVLLFAETRTISTIVDGIVFVVKEGAASVKEVNDALTA
A5G424      ELVKELKHRY--PDRYIIIDTPPVLPFAETRSISTLIDGIVFVVKEGAASLNDVSDAIAA
E8WSZ5      ALVDELKRRY--PDRYLIFDTPPVLPFAESRALANIVDGTIFVVRERLATQAEIKEAYDH
C7LPS3      SLFREMKIRY--GDRYIIVDTPPVLPFAETRSIASIVDGVILVVKEGMPSLEQIEEAIDA
C3WFM9      EVISSLENEY--N--TIILDMPPLAVASDAAILSKYVDGVVVVVAYDQVAKRELEFTKEM
A4J8V0      ALLTSFREHA--D--IIIIDSPPIIAVTDAALLAPQADGVVLVVASGQAKIETAQKAKQM
A8U9F4      KLITEFEELF--D--LIIFDMPPVIAVTDAQVMSSKADGTIFVITKNGTDKEMVTKSKEL
F4BSD9      QLMSEFEELF--D--LIIFDMPPVIAVTDAQVMSSKTDGTIFVVNKDGADKEMVTKSKNL
F7V792      SLLDELTKTH--R--YVFVDTPPLELASDGQLLGTLCDGVILVVRADSTSKRLVQKSIHQ
F6IR93      EFLTVATRKL--D--LVIVDAPPVLPVTDARILAGQVDGTMLVVRQNGVEKTAVRQAVGA
G0M0F9      EFLTVATRKL--D--LVIVDAPPVLPVTDARILAGQVDGTMLVVRQNGVEKTAVRQAVGA
F6ITB4      EFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKVAVRDAVHS
G0M1X9      EFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVRS
G0LYN9      EFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNS
D7VC13      EFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNS
F9UMZ6      EFLTSATRKL--D--LVIVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNS
G7QCG1      RLMTEIKQRY--RDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLTL
I2Q341      RLMTEIKQRY--RDRIILVDTPPVLLFAETRSLADVADGAVLVVREGKTSLEDVQESLTL
H8YYB9      RLVTELKTRY--PDRIVLFDMPPLLAGDDVLAFSPYIDAIMLVVEAGGTTRDDLRRAWNL
I5AV01      SMLDSLRKVF--D--YIIIDTPPLGSVIDSAVIAGHCDGSILVIAAEEVSRRFAMDVKDQ
B0GAL3      KLMIELKQRY--D--YVLIDTPPMANVVDAAIVGKVCDGAILLIESGFVGYRAAQKAIKQ
G1WUK2      KLMGELKQRY--D--YVLIDTPPMASVVDAAIVGKVCDGAILVIESGFVGYRAAQKAIKQ
E0RZL3      KALENMKQVF--D--YIIVDTPPLGSVIDAAVVAKQCDGTVMVIESNAISYRFAQRVKDQ
D8FLF8      DLIEDLKQEY--D--MVVIDLAPILDAAETQQLTSSLDGTILVVRQAHSQKSAVKRAVEL
F0K0J7      DLIEDLKQEY--D--MVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVEL
Q1G8E4      DLIEDLKQEY--D--MVVLDLAPILDAGETQQLTSFLNGTILVVRQAYSQKSAVKRAVEL
C4VP08      TFIDFIKSYY--E--MVIIDLAPILEVSDTQELARELDGVVLVVRQAKTQKQAVKRAVEM
D6S4X4      TFIDLVRNYY--E--MVIIDLAPILEVSDTQELARKLDGVVLVVRQGKTQKQAVKRAVEM
D0DJH0      TFIELVKSHY--D--MVIIDLPPVLEVSDTQELASHLDGVVLVVRQSVTQKAGITRAVQM
C7XKF3      TFIELVKSHY--D--MVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQM
E3R264      TFIELVKSHY--D--MVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQM
D5GZJ8      TFIELVKSHY--D--MVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQM
C2EPK5      DFIDLTEEHY--D--LVIIDLAPVLEVSDTQSLARHLDGIILVVRQGHTQKLAIKRSVEM
A4ZGZ8      DFISLVEDHY--D--MVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEM
A8YX89      DFISLVEDHY--D--MVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEM
F0NWJ7      DFISLVEDHY--D--MVIIDMAPVLEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEI
E4SMV5      DFVKLTEERY--D--LVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEM
F0TGY2      DFVKLTEERY--D--LVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEM
Q5FIC7      DFVKLTEEHY--D--LVIIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEM
F2M2M6      DFVKLTEERY--D--LVVIDLAPVLEVSDTQELASHLDGVVLVVRQGKTQKMAIKRAVEM
G7M0Q3      YLIEKLKQDY--D--MIILDTAPLNLVTDAQILSAKVDGTILVVRAAKTKKDVVIEAKSL
G7M1R9      KLIEALRERY--D--IVILDSAPLQAVTDAQILSTKADGTILVVRAKRTSRESVIDAKRL
A6M2L9      NLIERLKVEF--N--IVVLDTAPLKAVTDAQILSTKVDGTILVIRAGETKRDIVMDAKNL
G7M566      NLIEELKKRY--D--FVVLDTAPIKAVTDAQILSTKVEGTILVVRAAVTKRDAVIEAKNL
G2KUP1      NLLNTLSKDY--E--WVLIDTPPVNSATDASLIAAASNGTIIVVPQGIADKSSVKVAVEQ
G8PE06      EIMKSLSEKF--D--VVIIDAPPVNTVTDAQVLAARADGTILVVPQGYADKAGVRHAKQL
Q03GL8      ALLDQLTDHY--D--LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQL
E0NHP4      NLLGVLTTKF--D--LVIIDAPPVNTVTDAQVLAARADGTVLVVPQGIADKAGVRHAKQM
F4FXQ7      ELISYFKKIY--D--VIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIEL
C0WV35      ELISYFKKIY--D--VIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTEL
H1LCW3      ELISYFKKIY--D--VIILDVPPLLSVTDTQIIAAQVDGVVLVVRQGLAQKLAIKRSTEL
C2JZS1      QLLDWTREKF--D--IIVLDAPPVLAVSDVQVLVPRSDGVVVVANMGKTLKGDLKRTVEV
Q58Z10      GLLEWAREKY--D--IIVLDAPPVLAVSDVQVLVPKTDGVVVVANMGKTLKGDLKRTVEV
E9SAU1      MLLEQLAAHY--D--YIIIDTPPINIVTDALTLLDTIAGVLLVAKHGQSTYDALEEAIEA
Q38VG5      KLIVELTKHF--D--LVIFDAPPVISVTDAQILASKVDGTILVAPQGIADKRSVIKSKEL
F0HVF1      DLIEDLKQEY--D--MVVLDLAPILDAAETQQLTSSLDGTILVVRQAYSQKSAVKRAVEL
G6F8G9      DLIEDLKQEY--D--MVVLDLAPILDAGETQQLTSSLDGTILVVRQAHSQKLAVKRAVEL
C2EWM3      ALIASVEQSY--D--VVILDVPPILAVSDTQALVSHLDGVVLVVKMGQTEKAGLKRSVEL
F8DRU2      TLLDTVKGIY--D--MVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVEL
B3XL23      TLLDTVKGIY--D--MVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVEL
F8KGP1      TLLDTVKGIY--D--MVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVEL
H4GK03      DLVATFEQMY--D--VVIIDVPPILEVNDTQVLSSMLDGVVLVVRSGVTQKVAIKRAVEM
B2GF33      SLINGVRDAY--D--LVVLDVPPMLQVTDTQVLSGSLDGVVVVVRQGVTQKAAVRRAVEM
C0WW26      SFINGVREAY--D--IVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEM
D0DSJ4      SLIKGVREAY--D--LVVLDVPPMLQVTDTQVLSSNLDGVILVVRQGVTQKAAIRRAVEM
C0ZHV8      ELMDYLRHSY--D--FVIVDSPPLI-VSDAMVLAREMDGCVMVVDASKTKRDSAVKAVEQ
H1BJT1      KLLQALSKQY--D--FIILDCPPISMISDTFYVSNVSDGTIFVISMKDTKKDIALSSIRQ
F8FCE2      QFIEFAKNKY--D--VVIIDTPPALSLPDAQLVAGHSCGVVIVIDVGKVKREAVKKMKSN
H6NE43      QFIEFAKNKY--D--VVIIDTPPALSLPDAQLVAGHSCGVVIVIDVGKVKREAVKKMKSN
I0BSG4      QFIEFAKNKY--D--VVIIDTPPALSLPDAQLVAGHSCGVVIVIDVGKVKREAVKKMKSN
Q83VF9      NLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVGGVVLVASAYETKKESLAKTKKM
G8P3D7      DLIDSVSDFF--D--VVLIDTPPLSAVADAQILSSYVGGVVLVVRAYETKKESLAKTKKF
O06030      NLIDSVSDFF--D--VVLIDIPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKK
G9M880      NLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVGGVVIVVRAYETKKESLAKTKKM
G6FD42      NLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVGGVVIVVRAYETKKESLAKTKKM
F9VC44      NLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVGGAVIVVRAYETKKESLAKTKKM
A9QSJ4      NLIDSVSDFF--D--VVLIDTPPLSAVTDAQILSSYVGGVVLVVRAYETKKESLAKTKKI
Q3ZK50      NLIDSVSDSF--D--VVLIDAPPLYAVTDAQILSVYVGGVVLVVRAYETKKESLAKAKKI
E3GPC6      ELINQFKLAF--D--YILIDAPPVGVVTDAAVLSHVTDGYIVVAAISVTNKEGVRMALET
G0V447      SFIENLRQSF--D--VIILDTPPVIAVTDAQVLSTISDGVILVVSSGQADKEAAKRAKEL
H7F1R7      QILEELASCY--D--QIIIDTPPILASSDALVLTSYVNGVILVLRSDKTLKERAKIAVEQ
E3H7M5      EILDGLKEKY--N--LIVLDTPPLTVATDAALLSTYADGVVYVVGYDMVFKKELLSGKKL
E6UHY4      QLLDQLSAHY--D--YIIIDTPPINIVTDCLTLLDSIAGVLLIAKFAQSTYDALQEAIEA
D9QTC6      EVIKQAENKA--D--IVLIDSPPVIAVTDSRLLANKVDGVMLVVAAQETDEEALAKSQQM
D9SR41      NLLDLLKSKF--D--MVIIDTPPVLAVTDSQILSTEVDGVILVAVYGKTDKKALIKAKER
E3HB18      SLVEEVQEKY--D--LVVIDTAPLMVATDAAILSKISDGVIFVNGYDMVSKKELLYAKEI
P95696      ELVDLFNKRY--D--IIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKAL
Q2G1K7      ELVDLFNKRY--D--IIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKAL
A8YPQ5      NLYDTLLMNY--N--FVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNKDEVKKGKEL
Q2FUV2      NLYDTLLMNY--N--FVIIDTPPVNTVTDAQLFSKFTGNVVYVVNSENNNRDEVKKGKEL
P39851      TIFNELLNHY--D--FIVIDTPPINTVTDAQVYARIVKNCVLVIDAEKNNKSEVKKAKGL
C5QNG4      EIYNELLRRY--D--FVLIDTPPVNTVTDAQVFLQYVKDAIIVIDAEKNNKYEVKKAKSL
Q4L9H7      NILNDLFKYY--D--FILIDTPPVNTVTDAQVFMQYVKECVLIIDVENNNKDELKKAKSL
A7NQ71      TVIQRLRTMA--D--IVLFDTPPVIAVTDAAVLATRVDGVLLVIEAGRTRRDRARRAREI
E4Q5T5      NFLNTISQSY--D--YIIIDTPPCGSLTDAAIIGRIVDGVILVAAAGEVQIEAIQQAKEN
E4SDX4      NFLNTISQSY--D--YIIIDTPPCGSLTDAAIIGRIVDGVILVAAAGEVQIEAIQQAKEN
E4S7Y6      NFLSYVRERY--D--YVIIDTPPCGSITDAAIVGRIVDGVILVASAGEVEIEAIQHAKEN
C6CS80      ELLGKLREQY--D--MVLIDTPPVLAVADAQVVANKCDGVLLVVNARTGKKQHAIKAKNA
E6LD64      QLIRELRGAF--D--LVIFDMPPIVQVTDAQIMASKVDGTMLVVREDVSSKDAVVKAQKL
F0EKB9      QVMEEAKNLY--D--VVIFDMPPVVAVTDAQIMASKADGTILVVRENVARKESLTKARDL
H7F571      KFMQQFIQDF--D--QVIVDTPPILASSDALVITPYVDGTVVVLRSEKTLKDRAKIAIDQ
F5LE48      QFIEQAKAEY--D--IVLIDSPPILAVTDAQILATKCEGVILVLNHGKVKREVAKRAVDR
E7RDR3      TLIAQLKNTY--D--LIIFDAPPVLSVTDGQILANKCEGTILVVSSGNTEKDKALKAKEA
E7RG08      LLFESALDTY--D--MIIFDSPPVLSVTDSVILANKCEGTILVLNSGKTERAHALKAKDA
F6CNF5      ALWPALLERF--D--YLIIDSPPVLAVTDAALLAAQVDGVILVIRAATTRVEIAQEARDQ
G2FWX4      QLVKEVSELY--D--MVLFDTPPIIAVTDGSILAQEVDWVVLVMDLGEENKNYVQHAKEL
G2FM59      LLIEEVSEQF--D--MILIDTPPVIAVTDAAILAQEVDGVILVLAAGEVNKGYAQKAKEQ
G7WJV1      HLLEGAGGEF--D--MVLIDTPPVIAVTDALILAQEVDGVILVLASGEVDKGYAQKAKGL
H5XZD4      CLIEEVSGEF--D--MVLMDTPPVIAVTDAAILALEVDGVILVLASGEVDKGHAQKAKGL
H5XZG7      HLIEELSGQF--D--VVIIDTPPIIAVTDAAIIAQKVDGVILVLASGEVNKDFALRAKDQ
G7W773      RLIEEVSELY--D--VVLIDTPPIIAVTDAAVLAQEVDGVILVLASGEVNKEYAQRAKDQ
G2FWT8      RLIEEFSEQF--D--TVLIDTPPIIAVTDAAIIAQEVDGVILVLASGEVNKEFAQRAKEQ
I4DBG8      RLIEEASEQF--D--MVLIDTPPVVAVTDASILAQEVDGVILILASGEVNKDYAQRAKEQ
C0EBA6      ELLEELNKTY--E--YIILDTPPINIVSDALALADICAGVVLVIRQNQTKHETLQKAIKS
Q9K6R0      LIIKEVRDQF--D--IVIIDSPPLNAVTDAQILSSKCDGTVLVISSGKTQKEEALKAKDL
I2HVL2      ELIQEMYSRY--S--LVIFDSPPLLAVADGQILANQTDGSVLVVLSGKTKMDTVQKARDA
D4G1R2      DLISEIYEQF--S--LVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDA
G4EQZ7      DLISEIYEQF--S--LVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDA
P71051      DLISEIYEQF--S--LVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDA
E0U2Z3      DLISDIYEQF--S--LVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDA
G4P114      DLISDIYEQF--S--LVIFDSPPLLAVADAQILANQTDGSVLVVLSGKTKTDTVLKAKDA
A9VRC3      ELLGQAYSMY--D--LVVFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2QJY5      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKEAAVKAKGL
C2RG49      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2T8T6      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2MTG3      ELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETALKAKGL
C2SSX8      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2YZB2      ELLAQAYSLY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C3GBJ8      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANLCDASILVVRSESTEKETAVKAKGL
C2SBU4      ELLAQAYSTY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2NQN6      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANQCDASILVVRSESTEKESAVKAKGL
C3GRR0      ELLAQAYSLY--D--LVIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGL
C2PN22      ELLAQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKVL
C2Y452      ELLGQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2WVG6      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C3EBC0      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2XJH9      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2P8H3      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2ULR6      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
C2V4M2      ELLGQAYSMY--D--LVIFDLPPILAVTDAQIMANVCDASILVVRSEATEKETAVKAKGL
C3H979      ELLGQAYSMY--D--LVIFDMPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGL
G2TR25      EFFKEAKEQY--D--IILLDTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVEAVKKAKEL
P96716      ELAYEACAAY--D--MVIFDTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEA
G4EQF3      ELAYEACAAY--D--MVIFDTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEA
D4G2E1      ELAYEACAAY--D--MVIFDTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEA
I0F9R6      ELADEASVAY--D--MVIFDTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEA
E0TTZ6      ELADEACAAY--D--MVIFDTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEA
G4P1M7      ELADEVCAAY--D--MVIFDTPPILAVADAQILGNVADGSVLVISSGKTEKEQAAKAKEA
A8FHL9      QLFYEIEQQY--E--MVIVDSAPLLPVADAKILANRTDGSILVVLSGKTKIAAVKKSKEV
Q5KUM5      QCLEQLYETF--D--LVIFDTPPVLAVTDAQILANQCDGTVLVIESGGTEIEAAVKAKEL
D3FZP4      DLLEDAFQYY--D--YVLLDTPPTLAVTDAQILANLTDGSILVVSSGKTNRDGAKKATEQ
I0JRK4      KLIEEAKEHY--D--MIIFDTPPVLAVADSQVLSKFVDGALLVVRSKQTEQEAAGKAKEQ
I3EBB3      EFLERVYEEF--D--VVLFDTPPILAVTDAQIMANRCDGTILVVSSGKTEIEQAIKAKEM
E3CP62      HLMDVARSRY--D--YVIIDTPPIGLVIDAAIIAHQADASILVTAAGKIKRRFVAKAVEQ
C2KHF1      ELVTQLKSQY--D--LIIFDVPPFLMVTDAQVLMSKVDGVAIVVNGGKINKGALKRTNEI
I0UTA5      QLVRELSEEF-----VVVLDAPPLLPVTDASLLSYAVDGVIMVGSIGKSHREQMTEATNN
B7BDT8      ELIEKMRCRF--D--YILIDCPPVDIVADTQIIEKLADRTVFIVRAGLLERDMLPKLQSD
G9WIQ9      QIIDWMRRNF--D--LVVIDSTPLLLVPDAQSLIPRSDGVVLVATLGKTKKKSLLEAAHI
A0NKF6      RVVSWMREQF--D--MVVIDSTPLLLVPDAQALIPRADGVVLVAMLNKTRRRSMATAANI
Q04DV8      RVVSWMREQF--D--MVVIDSTPLLLVTDAQALIPRADGVVLVAMLDKTKRRSMATAAHI
E7T801      QLLEWANDHY--D--LVIVDTPPMLAVSDAAVVGRSVGTSLLVARFGLNTAKEVSLSMQR
F4SM97      ELLIWANSQY--D--IVILDTPPILAVTDAAIIGQYVGTTLLVVRFEQNTVKEIEVSFKR
G5Q4J0      ELIAWASSRY--D--LVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
G5LQM6      ELIAWASSRY--D--LVLIDTPPILAVTDAAIVGRHVGTTLMVARYAVNTLKEVETSLSR
G5SDT8      ELIAWASSRY--D--LVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSR
F3CAY9      KMLAELSPLY--D--LILIDTPPILAVTDATLVGRQAGTCLLVARFGMTTAQEIEACKRR
A3K8W7      VTLDRIEEELRPD--VVLFDLPPALSYDDVIAFQPLFDGVLLVVGGGLTTEREVKE-VER
G7EJX6      ELLELLKAKY--D--HIIIDTPPTQAVSDALVIAQSADSVIYVVKSDVTRIKPIKAGIER
B7B947      ALIAELRERY--D--YIILDNVPAGVVADAVIVNRVADLTIYVVRAGRMD-RRALPEVEK
D3LB10      KVINWMKEQF--E--MVVIDSTPLLLVPDSQALIPRSDGIVLTAMLGKTK-RKSMASAAH
S9QRP1      ATLDDLQTRFAPD--VMLFDLPPALFYDDVIAFRPLFDGVLMVVGGGITT-EREVREVER
G8AU96      DLIQWARHNY--D--VVVIDSAPVMLFSDALALSFLADSVIYVVRWQHTPLDTVTAGFNK
D0D9W0      ETLRQVETMLQPD--VVLFDLPPALYFDDVMAFRPLFDGVLLVIGGGLTT-DKEVREVER
Q0FMP0      TALRHIEDEFAPD--VMLFDLPPALYYDDVMAFRGQFDGVILVIGGGITT-EKEIRETQR
A3W0H7      EVLQDMYRRLAPD--VVIFDMPPALYYDDVLGFRPQFDGVLIVVGGGRTT-ARHLRDLKA
I1AYC5      QTLETIERRLAPD--VILFDLPPALFSDDVIAFRPLFDGVLLVVGGGLTT-DKEIREVER
                            :..*  *                                     

E9TE88      F-EQNGIPVKGVILNS-I---FRRA---------------------SAYQDYGYYEYEYK
B8D0N2      L-ENAEANLLGIVANK-I---PHKQ-----------------------------------
C2CI44      L-KKVDAHILGAVLTY-V---PMKD--------KR-------------------------
C7RGH6      L-KKVDAHILGAVLTH-M---PMKE--------KK-------------------------
C0CK73      I-EQNGGRVLGVALNR-I---KKNQ-----------------------KGA---YPYGK-
Q1WTC8      L-ERADSKIIGCVLNK-V---DASN--------ND-------------Y-------Y---
E8JWI5      L-EQSSTPFLGVVLNK-Y---NVQA--------DK-------------YGF-----YGS-
F3AHH0      L-DKTNCPVLGVVLNK-V---DMSR--------QKY------------YGK-----YYG-
F7K0U1      L-ERSECPILGVVLNK-V---DMSQ--------NKY------------YGK-----YYG-
C4Z672      L-DLVGCKILGCVLNK-V---DMAG--------NSY------------YGR-----YYGK
P0C0T9      M-EQSGSKFLGIILNK-V---NESV--------AT---------------------YGD-
Q04663      M-EQSGSKFLGIILNK-V---NESV--------AT-------------YGD-----YGD-
Q67AY4      M-EQSGSKFLGIILNK-V---NESV--------AT-------------YGD-----YGD-
Q3K0T0      M-EQSGSKFLGIILNK-V---SESV--------AT-------------YGD-----YGD-
C5NWJ8      L-EKGGAEFLGVILNK-V---NSNE--------LG-------------YGG-----Y---
F3A499      L-EKGGAEFLGVILNK-V---NSNE--------LG-------------YGG-----Y---
Q4JZ55      L-EQTGVPVLGLVANK-A---IIKK--------DS-------------YGY-----YGK-
G5JTD5      M-EKSGAQFLGVILNK-V---DEKS--------EN-------------YGN-----YGS-
G3G7C1      L-EQTGTQFLGVILNK-Y---DIAT--------EK-------------YGD-----YGN-
G3G7J9      L-EQTGTQFLGVILNK-Y---DIAT--------EK-------------YGD-----YGN-
G3G7G6      L-EQTGTPFLGVILNK-Y---DVVT--------EK-------------YGE-----YGN-
G8DUB0      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YGE-----YGN-
G3G7I8      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YSE-----YGN-
G3G7J4      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YSE-----YGN-
G7SG34      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YGE-----YGN-
G8DTZ0      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YGE-----YGN-
G8DU07      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YGE-----YGN-
A4VTU3      L-EKTGTPFLGVILNK-Y---DIAT--------EK-------------YSE---------
G7SNU6      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YSG---------
G8DU31      L-DQTGTPFLGVILNK-Y---DIAT--------EK-------------YSG---------
D5AGQ5      L-EQTGTPFLGVILNK-Y---DIAT--------EK-------------YSE---------
Q9X4U7      L-EQTGTPFLGVILNK-Y---DIAT--------EK-------------YSE---------
A3CQY2      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----CGT-
E8KLY9      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F0FHA8      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F0I4H5      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F0IAY3      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F0IJI2      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F0IS53      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F2C9N0      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F2CH53      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F3SM32      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F3UDW7      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F3UNJ4      L-EQTGTPFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
F0FQQ5      L-EQTGTSFLGVVLNK-Y---NIDL--------ER-------------YGA-----YGT-
D6R2T8      L-AQTGTPFLGVVLNK-F---NVQL--------ER-------------YGS-----YGS-
F3UUQ2      L-AQTGTPFLGVVLNK-F---NVQL--------ER-------------YGS-----YGS-
E6IZC2      L-EQTGTPFLGVILNK-Y---DTQL--------EK-------------YGS-----YGN-
G6A745      L-EQTGTPFLGVILNK-Y---DTQL--------EK-------------YGS-----YGN-
A8AZR3      L-EQTGTPFLGVVLNK-Y---DVSG--------DR-------------YGV-----YGA-
F9HJP6      L-EQTSTPFLGVILNK-Y---DVSN--------DR-------------YGA-----YGA-
Q4JYT9      L-EQTGVPFLGVVLNK-F---NTEV--------EK-------------YGA-----YGG-
Q4JZY1      L-EQTGVPFLGVILNK-F---NTEV--------EK-------------YGA---------
E1LQJ7      L-EQTGTPFLGVVLNK-F---NIEV--------GK-------------YGA-----YGGY
F9HC65      L-EQTGTPFLGVVLNK-F---NTEV--------EK-------------YGA-----YGG-
E1LPE7      L-EQAGKPFLGVVLNK-F---DVQR--------EK-------------YGS-----YGG-
F9MJW5      L-EQAGKPFLGVVLNK-F---DVQR--------EK-------------YGS-----YGG-
E8KDN2      L-EQTGTPFLGVILNK-F---NIHL--------EK-------------YGS-----YGS-
E8K322      L-EQTGTPFLGVILNK-F---NIQL--------EK-------------YGS-----YGS-
F9PEU4      L-EQTGTPFLGVILNK-F---NIQL--------EK-------------YGS-----YGS-
F9PZP7      L-EQTGTPFLGVILNK-F---NIKL--------EK-------------YGT-----YGG-
C1CBD1      L-EQTGKLFLGVVLNK-F---NVQH--------EK-------------YG--------S-
Q7WVX0      L-EQTGKLFLGVVLNK-F---NVQH--------EK-------------YG--------S-
P96475      L-EQTGELFLGVVLNK-L---DISV--------DK-------------YGV---------
Q9AHD2      L-KQTGKLFLGVVLNK-L---DISV--------NK-------------YGV-----YGS-
Q4K2Q7      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q4K0T5      L-EQTEKLFLGVILNK-F---DVQH--------EK-------------YGS-----YGG-
Q4K0E1      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q9AH95      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGA-----YGS-
Q4K1M4      L-EQTGKLFLGVILNK-F---DVQH--------KK-------------YGS-----YGD-
Q4JZ18      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q54520      L-EQTGKLFLGVVFNK-L---DISV--------DK-------------YGV-----YGF-
Q4JYH5      L-EQAGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q4K0V2      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGF-
A5M4L1      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YAS-
B2ILP5      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YAS-
C1CCB9      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YAS-
Q4K1S7      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YAS-
P72512      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YAS-
Q4JZ84      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q4K0X5      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q4K0Z6      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGF-
Q4K195      L-KQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGF-
Q4K0A0      L-EQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGS-
Q4K0K2      L-KQTGKLFLGVVLNK-L---DISV--------DK-------------YGV-----YGF-
Q4K1F9      L-KQTGKLFLGVVFNK-L---DISV--------DK-------------YGV-----YGF-
Q4K045      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGK-
G6C7Z1      L-EHTGKPFLGVVLNK-F---DTSV--------YK-------------HSP-----YGN-
D2ERX8      L-EQTGKPFLGVVLNK-F---DTSV--------YK-------------HSP-----YGN-
F9LZC4      L-EQTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
F9P1W8      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
I0J9C9      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGG-
A6YIA8      L-EHTGKPFLGVVLNK-F---DTSI--------DK-------------YGS-----YGN-
Q4K005      L-EHTGKPFLGIVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4JZL7      L-EHTGKPFLGIVLNK-F---DTSV--------DK-------------YGS-----YGG-
E5F5C5      L-EHTGKPFLGIVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4JZG7      L-EHTGKPFLGIVLNK-F---DTSV--------DK-------------YGS-----YGD-
Q4JZK1      L-EHTGKPFLGIVLNK-F---DTSV--------DK-------------YGS-----YGN-
A5LJS0      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q9AHB7      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4K1B7      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4JYK8      L-EHTGKPFLGVVLNR-F---DTSV--------DK-------------YGS-----YGN-
Q4K0M3      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q9AHA4      L-EHTGKPFLGVVLNK-F---DTSV--------NK-------------YGS-----YGN-
Q9X9A1      L-EHTGKPFLGVVLNK-F---DTSV--------NK-------------YGS-----YGN-
Q9ZII6      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGD-
Q8KWQ0      L-EHTGKPFLGIVLNK-F---DTSV--------DQ-------------YGS-----YGN-
Q4JZW7      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4JYX9      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4K0R7      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4K1K6      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4JZS3      L-EHTGKPFLGVVLNK-F---DTSV--------DK-------------YGS-----YGN-
Q4K0I2      L-EQTGKSCLGVVLNK-F---DTSV--------DK-------------YGF-----YGS-
Q4K254      L-EQTGKSCLGVVLNK-F---DTSV--------EK-------------YGS-----YGN-
Q4K237      L-EQTGKSCLGVVLNK-F---DTSV--------EK-------------YGS-----YGS-
B1I967      L-EQTGKSCLGVVLNK-L---DTSV--------EK-------------YGS-----YGS-
G6J8A4      L-EQTGKSCLGVVLNK-L---DTSV--------EK-------------YGS-----YGS-
G6LKG5      L-EQTGKSCLGVVLNK-L---DTSV--------EK-------------YGS-----YGS-
Q9ZFT8      L-EQTGKSCLGVVLNK-L---DTSV--------EK-------------YGS-----YGS-
D6ZQI8      L-EQTGKSCLGVVLNK-L---DTSV--------EK-------------YGS-----YGS-
Q4K2A8      L-EQTGKPCLGVVLNK-F---DTSV--------DK-------------YGS-----YGS-
Q8VU31      I-EQTGKPCLGVVLNK-F---DTSV--------DE-------------YGS-----YGS-
Q4K2E1      L-EQTGKPFLGVVLSK-L---NTSI--------EK-------------YSS-----YGG-
Q4K2F7      L-EQTGKPFLGVVLSK-L---NTSI--------EK-------------YSS-----YGG-
A5YTV7      L-EQTGKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
F9Q345      L-EQTSKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
Q6L5R0      L-EQTSKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
A5YTT9      L-EQTSKPFLGVVLNK-F---NTSV--------EK-------------YGS-----YGA-
E6KKS0      L-EQTSKPFLGVVLNK-F---NTSV--------EK-------------YGS-----YGA-
F2QF90      L-EQTSKPFLGVVLNK-F---NTSV--------EK-------------YGS-----YGA-
E0Q2S8      L-EQTSKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
A1ILY1      L-EQTGKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
Q6L5T0      L-EQTGKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
E9FEC5      L-EQTGKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
E0PPH9      L-EQTSKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
F5VSG9      L-EQTSKPFLGIVLNK-L---NTSV--------EK-------------YGS-----YGA-
E3CBS0      L-EQTGTPFLGVVLNK-F---NIKA--------TE-------------YGS-----YGG-
F9M366      L-EQTGTPFLGVVLNK-F---NIKA--------TE-------------YGS-----YGG-
E8K786      L-EQTGTPFLGVVLNK-F---NIKA--------AE-------------YGS-----YGG-
F8DFF4      L-EQTGTPFLGVILNK-F---NIKA--------AE-------------YGS-----YGG-
I1ZPH7      L-EQTGTPFLGVILNK-F---NIKA--------AE-------------YGS-----YGG-
E7S8W3      L-EQTGTPFLGVVLNK-F---DIQL--------EK-------------YGS-----YGN-
D0RXH2      L-EQTGTPFLGVVLNK-F---DVKS--------EK-------------YGS-----YGN-
Q83YR5      L-EQTGTPFLGVVLNK-F---DVKS--------EK-------------YGS-----YGN-
Q8GP54      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
F8HDC3      L-QQSGSEFLGVVLNK-V---DLAI--------DK-------------YGS-----YGS-
F8LJ75      L-QQSGSEFLGVVLNK-V---DLAI--------DK-------------YGS-----YGS-
E9DM17      L-TQSGSQFLGVVLNK-V---DMTV--------DK-------------YGT-----YGS-
I0QIK6      L-TQSGSQFLGVVLNK-V---DMTV--------DK-------------YGT-----YGS-
E8KUY8      L-EQSSSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q7X553      L-EQSGSQFLGVVLIK-V---DMTV--------DK-------------YGS-----YGS-
Q8GP92      L-AESGSQFLGVVLNK-V---DMTV--------DK-------------YGF-----YGS-
Q7X561      L-EQSGSQFLGVVLNK-V---DMTV--------DR-------------YGS-----YGS-
Q7X549      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----Y---
G6ERT1      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
O87931      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q8GPF6      L-AESGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q7X555      L-KQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q7X557      L-KQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q7X563      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q8GMA5      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q8GPA8      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q55205      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
C2LSE6      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q7X559      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
F8LXJ4      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q1WCR1      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
Q8GPC3      L-EQSGSQFLGVVLNK-V---DMTV--------DK-------------YGS-----YGS-
E8JMT9      L-EQSGSVFLGVILNK-Y---DIHL--------DK-------------YGS-----YGS-
F5X0J9      L-EQSGSVFLGVILNK-Y---DIHL--------DK-------------YGS-----YGS-
H2A602      L-EQSGSAFLGVILNK-Y---DIHL--------DK-------------YGS-----YGS-
E0PD83      L-EQSGSIFLGVILNK-Y---DIHL--------DN-------------YGA-----YGS-
F5X652      L-EQSGSIFLGVILNK-Y---DIHL--------DN-------------YGA-----YGS-
G5KD11      M-EQSGATFLGIILNK-V---ENTV--------DSYGGY-------GAYGG-----YGA-
B9DUJ4      M-EQSGALFLGVILNK-V---EEVI--------DS-------------YGG-----YGA-
G5KAJ2      M-EQSGAQFLGVILNK-V---EHTV--------DS-------------YGS---------
F1Z124      M-EQSGALFLGVILNK-V---EETL--------DS-------------YGG---------
Q2KM74      M-EQSGAQFLGVILNK-V---DQQL--------GS-------------YGA---------
C6LDI8      I-EKSGCRILGAVLNK-V---E-RK--------SKG------------Y-G-----YGR-
D4J4T6      L-EASGCPLLGVVLNK-V---KISE--------NKG------------YGG-----YGQ-
D4LTH2      I-DQAGCKLLGTVLNC-V---EGA--GGRYGKYGH-------------YGK-----YGKY
D4LG06      I-EQSGCKLLGTVLNR-A---EVST-RGYG---K--------------YGK-----YG--
A7VF42      L-EQVNCRLLGVILNR-V---EASG-RAYK---SY-------------YGK-----YGK-
A8SQS8      L-SQVGCTLLGVILNR-V---ETAG-RAYK---KY-------------YGK-----YGKY
D5HFS4      L-DQVGCTLLGVILNR-A---QTTG-RAYK---KY-------------YGK-----YGKY
C9LAS1      L-EKTGCKILGAVLNK-V---NIEK-NKYYGKYDY-------------Y------YKSK-
F3AH92      L-ERSKCHILGAVLNK-A---DLKK-SKYYS--SY-------------YGKKYGGYRGR-
I5ASF8      L-EQADIHILGVALNK-V---DRTAAGAYG----H-------------YGK-----YGKY
E7GL81      L-ERSGCRILGTVLNR-V---NMQV-QGYY---RY-------------YGK-----YGRY
G5F9E2      L-ERSGCRILGTVLNR-V---NMQV-QGYY---RY-------------YGK-----YGRY
E7GL57      L-EKSGCRILGAVLNK-V---DVRQ-NSYY----Y-------------YGK-----YGKY
G5F9A9      L-EKSGCRILGAVLNK-V---DVRQ-NSYY----Y-------------YGK-----YGKY
E7GL40      L-EKSGCRILGTVLNK-V---DIKQ-GSYY----Y-------------YGK-----YGKY
G5F9H2      L-EKSGCRILGTVLNK-V---DIKQ-GSYY----Y-------------YGK-----YGKY
A8RK85      L-EKSGCRILGAVLNR-V---GGGYEHSYYE--KY-------------YGRRGGKYYGKY
G5HTB2      L-EKSGCRILGAVLNR-V---DKEYENGYYK--KY-------------YGK-----Y---
G5HNC5      L-EKSGCRILGAVLNR-V---GTDYDNGYYK--KY-------------YGK-----Y--Y
C0CZV9      L-EKSGCRILGVVLNK-I---DPEY-NSY----GY-------------YTR-----YGKY
A8RSK9      L-EKSGCRILGVVLNK-V---SMER-NGYYS--KY-------------YGK-----YG--
C5EN03      L-DKSGCRILGVVLNK-M---SMER-SGYYS--KY-------------YGR-----YGKY
G5HG45      L-EKSGCRILGVVLNK-V---SMER-NGYYS--KY-------------YSR-----YGKY
D9ST44      L-EKVKAKILGVVLNK-L---DVKQ------------------------NGYY-------
G2Z8Q3      L-RSTHTPIIGIILNK-T---KQDK------------------------SSKYYYYN---
C8W5K2      L-LNVNARIIATVLNM-T---DDPG------------------------EDYRYYNYG--
A5V0I3      L-EKVKANIIGVVLNS-------AR-----------------------FDGEYGYYA---
F5LM71      L-QFVHARILGVVLNKVA---RKDA------------------------KMNTYYDYSS-
D7VBW4      L-KNARAQLLGTILND-V---DIKT------------------------HGYGYGYYGTE
F9UQ54      L-KNARAQLLGTILND-V---DIKT------------------------HGYGYGYYGTE
H6LKR8      I-DKVGGVLLGVILTK-V---KFKK-----------------------SSDYYGYGEDKG
E0I7B5      L-DHVNARILGVVLNN-V---ERKQ-----------------------TEGYYYYYYGSK
D7UYE4      L-EKAGAKILGVVLNK-A---TPEK------------------------ASSYYYYYGDD
Q4A120      L-EKSGTKILGAVLNK-A---QLDK------------------------SSSSYYYYGEE
D9SVC7      L-DSVNANTLGVVITKVP---KPPK-----------------------IEENYSYYYSEE
D9S1J9      L-DKVNARILGVVLNKVK---QQKG------------------------GGYYYYYYYYG
C0GGR5      L-LKVKANILGVVLNKVP---QGNG------------------------SYYYHYHYGQ-
C6CSC8      L-QNVNARILGVVLNNVK---RRSN------------------------EEAYYYYYSAD
A3ICA3      L-TISKANILGVILNN-Y---KMKG------------------------STYE-QYYGKE
B1HR41      L-TIAKANILGVILNN-Y---KMKG------------------------STYE-QYYGKE
D6Y034      L-DNAHARILGVILNR-K---DKKE------------------------TTYY-YYYGND
Q8EME8      L-QSVNANVLGAVLND-R---DKKD------------------------ANYY-YYYGS-
F3Y922      L-IMVKATIIGAIYND-A---SSVK------------------------DQGY--YYGVK
G4L594      L-DLVQARVLGVIYNG-S---EQGK------------------------DKA-YYYYSD-
C9B454      L-EMVQARVLGVVYNG-A---EHSK------------------------DAG--YYYRN-
Q3XYS6      L-DMVQARVLGVVYNG-A---EHSK------------------------DVG--YYYGN-
C9ALZ9      L-DMVQARVLGVVYNG-A---EHSR------------------------DAG--YYYGN-
C9BUG7      L-EMVQARVLGVVYNG-A---EHSK------------------------DAG--YYYGN-
D4RJF4      L-EMVQARVLGVVYNG-A---EHSK------------------------DAG--YYYGN-
C8ZXT9      L-NMVQARVLGVVYNG-A---ENNK------------------------DSGYYYYYGN-
G5IRQ6      L-NMVQARVLGVVYNG-A---ENSK------------------------DSGYYYYYGN-
C9A6V5      L-NMVQARIIGVVYNG-A---EHTK------------------------DSGYYYYYGN-
C9CHY8      L-NMVQARIIGVVYNG-A---EHSK------------------------DSGYYYYYGN-
Q814Z0      L-ESANGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
B9IRQ6      L-ESAKGKLLGVVLND-R---EREQ------------------------SLYY--YYGTN
B7HXB4      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
Q72XH8      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
A0RL70      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
Q6HB09      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
F0PU64      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
B7HFH1      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
B7IQS8      L-ESAKGKLLGVVLND-R---EREE------------------------GLYY--YYGAN
B3ZRD6      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
B5UQ73      L-ESAKGKLLGVVLND-R---EREN------------------------GLYY--YYGAN
G9QCG3      L-ESAKGKLLGVVLND-R---EREQ------------------------GLYY--YYGAN
Q3EV64      L-ESAKGKLLGVVLND-R---EREE------------------------GLYY--YYGAN
Q5WBB4      L-VKANAHLLGVVLNN-K---PIDD------------------------TTYY-YYK---
B1YMM5      L-ELAEAKILGVVLNR-R---ELTD------------------------DSAYQYYYSYE
D7WMM8      L-EASKANILGVVLNN-Y---KMPL------------------------HQYY-EQYYR-
A7Z921      L-QQSKAKLLGALLNK-K---KIKK------------------------TEHY-SY----
I2CAF2      L-QQSKAKLLGALLNK-K---KIKK------------------------TEHY-SY----
A7Z9K0      L-DYCPCKLLGAVMNG-K---KQTK------------------------HSDY-AYYGQ-
I2CB16      L-DYCPCKLLGAVMNG-K---KQTK------------------------HSDY-AYYGQ-
I2HW53      L-DYCPCKLLGAVMNG-K---KQTK------------------------HSDY-AYYGQ-
G9QKR4      L-QAAKAKLLGAVLNN-K---ALKS------------------------SSYY-YYYGDK
D5DBK3      L-VNAKSKLLGAVLNN-R---KVYD------------------------ENYY-YYYGSN
D5DY81      L-TQAKSKLLGAVLNN-R---KMKE------------------------GNYY-YYYGSN
Q2BFS5      L-RTSKGKLLGAVLNQ-K---KLQD------------------------SHYY-YYYGGK
A4ITF3      L-EAANAKLVGVVLNQ-R---KQRE------------------------GSGY-YQYQYK
C5D961      L-EAANAKLLGVVLNK-R---KHRE------------------------GGYY-YYYRYK
G8MZ93      L-EAANAKLLGVVLNK-R---KHRD------------------------GGYY-YYYQYK
F0G6H5      L-QDVQVDVRGVILND-FARGPGHG---------------------YGYGNAETHQAASG
F2I4B7      L-DKVNTNVLGVIMNR-T---ERTEDYY------------------YYYE----------
Q74BQ8      L---NRKKILGIVFNE-ASAVGISS--------K------------YGYGYGYGGYGPSA
F0JCB8      L---QGSNILGAVYTQ-ASRMHRSLNADAYMKYK------------YYHYAS--------
Q314L3      L---EGATMLGVVYNN-ARSGGGRRG-------R------------YGYGYGYGGY--GS
B5EA81      L---KACPILGMVYNA-A-AVDDKDG-------R------------YSYYRS------AD
C6DZX5      L---KACPILGMVYNA-A-TVDHNDG-------R------------YSYYRS------AD
A1ARV8      L---KGADLLGIVYND-T-TITQNVE-------R------------YYSYRSYAAVSPGE
C6CW37      L-DFVQSRIIGAVFNQ-M---KRQDIAFV-----------------KYYGTSK-------
G9RSY9      L-DAVNANILGAVLNG-F---DTKSTEKKNG---------------YYYSYNYSYENADR
B9Y884      F-EQTQVNVIGIVMTM-M---PVQRKYYNSYGYRYS----------DSQKK-----TAQK
A5Z5P9      L-ERSGCKILGVVLNR-A---TDAKGKKNEKKYYNG----------K-------------
Q1AUN8      L-RGVKANVLGTVMNN-F---DGKRG-----GYAYH----------GYTR----------
F2I6Z7      L-ESVDANVIGAIYNG-A---DGQ-------GMNAY----------YGYG------YRDE
D4YHG7      L-DVVNANVIGAVYNG-E---DANKLGY---GYGYG----------YGYG------YGQS
C1J9I3      L-KLANAKILGSV--E-R---VKAKHGDR--GYGYG----------YGYG------YGTN
B1MZT1      L-KIAEAPVVGFIYND-Q---DQKKKAGS--GYGYG----------YGYG------YGDA
H1WR06      L-KIAGAPVVGFIYND-Q---NQKKKAGS--GYGYG----------YGYG------YGDA
H1X4N2      L-KIAEAPVLGFIYND-Q---SRRKKGSSVYGYGYG----------YGYG------YGET
Q03W95      L-KIAEAPVLGFIYND-Q---SRKKKGSA----GYG----------YGYG------YGET
F0SX22      L-TFVGGNILGFLLNG-I------KTKST--SSRYS----------KYYR----------
B6W7H4      L-NKVKGKVLGAILTF-A---DLSESSYK--GYY--------------------------
F0GT81      L-KKVDAHILGCVLTH-M---PRKDNQYG--SYY--------------------------
B1R3X6      L-EKVRANVLGSVLNG-I---KGNNKNYY--YAE--------------------------
Q8XN76      L-EKVRANVLGSVLNG-I---KGNNKNYY--YAE--------------------------
B1BNK1      L-EKVRANVLGSVLNG-I---KGNNKIYY--YAE--------------------------
B1V0N7      L-EKVRANVLGSVLNG-I---KGNNKIYY--YAE--------------------------
Q0SVR8      L-RAVKANIIGTVFNG-E---ENQRGKYY--HYY--------------------------
B1BNH3      L-RAVKANIIGTVFNG-E---ETQRGKYY--HYY--------------------------
Q8XN46      L-RAVKANIIGTVFNG-E---ENQRGKYY--HYY--------------------------
B1V1Z4      L-RAVKANIIGTVFNG-E---ESQRGKYY--HYY--------------------------
G5GFW0      L-EKSGCRILGAVLNK-T---AVQERG------YYA----------KYYGGRNKYKYSKD
C2EFR6      L-ERADSKIIGCVLNK-V---DASNN-----DYYYG----------YYHK----------
F3ATF5      L-LMTGCRLIGAVLNK-V---DVKKNKYY--HRYDY----------YYHG------YQEK
D4M2S0      L-TKSGCKILGAVLNK-V---DMKKEKYY--SKYSS----------YY--------YGKS
F4BS19      L-NLVQANVLGAVFNS-KERMKSLNNGY----------------------------YAKE
D4CG08      L-EKSGCRILGAVLNK-V---TSEHGGYY--GKRYR----------KYYG------YGAE
D4MP30      L-EKSGCRILGAVLNK-V---TSEHGGYY--GKRYR----------KYYG------YGAE
C6LCS5      I-ERSQCRLLGVILNK-V---SLNEKGYY--GKYYG----------NYYGKD--------
B0P2G2      L-KRGEVRILGAVLNK-V---DERIGAY---GNYEY----------KYSYSY----YGES
D4MW29      L-KRGEVRILGAVLNK-V---DERIGAY---GNYEY----------KYSYSY----YGES
E5VMX8      L-KRGEVRIFGAVLNK-V---DERIGAY---GNYEY----------KYSYSY----YGES
D4JMC2      L-EDSGVKILGAVLNK-CRFEESKYGHYY--GNYYG----------NYYGNY----YGRD
D6E0V4      L-EDSGVKILGAVLNK-CRFEESKYGHYY--GNYYG----------NYYGNY----YGRD
D6E330      L-EASGVRILGAVLNK-V---NNKKNSHV--SGYYG----------NYYGSY----YGQS
C4Z8M5      L-EASGVRILGAVLNK-V---NNKKNSHV--SGYYG----------NYYGSY----YGRS
D4JI67      L-EASGVRILGAVLNK-V---NNKKNSHV--SGYYG----------NYYGSY----YGRS
D3AC80      L-EKGECRILGVVLNK-V---DLDRDSYY--GNYYG----------KYYGKYYGKYYGNY
G5IFS3      L-EKSECRILGVVLNK-M---DLEKNGYY--GSYYG----------KYYGKNYGN-YGDY
D4RX67      I-KNTGTKFLGIILNK-V---SMSGNGYY--GKYYG----------KYYGR-----YGHG
A6BIG7      L-EKADCPILGVVLNK-V---SVSNSRYY--GKYYG----------KYTGY-----YGEY
C0C0F8      L-EKSNCPILGVVLNK-V---NMKQNKYY--GKYYG----------KYYGE-----YGKK
Q97EP8      L-ENVNANIIGSVLNR-V---DTESRR----GYYGG----------YYYY------YGDE
Q97ER5      L-ENVNANIIGSVLNR-V---DTESRK----GYYGS----------YYYY------GHEE
D2RIR2      L-QAGKANILGVVLNG-V---PQQHKG-Y--GYGYY----------YYDY------YDEN
G0VNK6      L-EKVHANILGVILNK-V---PQHHKS------GYY----------YYYY------YDEN
I0GRR2      L-VQSQVNIIGTVLNG-V---PKKNKAGY--GYGYG----------YYYY------YDEK
A0PZ02      L-LKVKANILGVVLTK-V---PLNEGK----GYGYS----------YYYY------YGDE
B1B736      L-LKVKANILGVVLTK-V---PLNEGK----GYGYS----------YYYY------YGNE
F6BI62      L-TNLKANILGAVLNK-V---KEQRS-----D--YY----------YYYY------YNND
Q8RBS5      L-ESVKANILGVVLNR-V---KESRN-----G-YYY----------YYYY------YGDH
G2MWC2      L-ESVKANILGVVLNR-V---KESHR-----GYYYY----------YYYY------YDDN
B0K4N1      L-ESVKANILGVVLNR-V---KESHG-----G--YY----------YYYY------YDDN
B0KAR5      L-ESVKANILGVVLNR-V---KESHG-----G--YY----------YYYY------YDDN
E8UV29      L-ESVKANILGVVLNR-V---KESHG-----G--YY----------YYYY------YDDN
C7ISF7      L-ESVKANILGVVLNR-V---KESHG-----G--YY----------YYYY------YDDN
F7K9V1      L-EKVDCRILGVILNK-V---NMSGKGYYG----------------AYYGKYYGKYYGKY
F7K8E9      L-EKVDCRILGVILNK-V---NMSGKGYYG----------------AYYGKYYGKYYGKY
F7KL96      L-KKVGCRILGVILNK-V---NMSGKGYYG----------------AYYGKYYGKYYGKY
C9AAE5      L-RLVNANILGVVANG-T---TDTAVN-------------------YYY-----------
H7F6C8      L-RLSKAKLIGVIFNG-T---KNAEN--------------------YYY-----------
H7F5T6      M-QDANANILGVIFNN-P---QMKQDH-------------------YYYPESEV------
E6PYQ3      L-AKYPSKQTGIVVNA-L---PFSD---------------TYYSGYGNYRKYYGTGYGKE
B1R3V1      L-RAVKANIIGTVFNG-E---ETQRGK-------------------------YYHYYKKD
I5B296      Y-G--REKVLGVVTNF-S---KKTI---------------GYGYGYHKSG--YGYGYHQQ
D4YF13      L-DNVKANLIGYILND-V---PINKNK-----------------G-YGYYEYYNV-----
E6U7N4      L-KNVGARIVGCVFNA-F---NAQKSR-------------KYAYGHYRYKRYYTEAYK--
C8VYQ6      L-LNVNARIIGTVLNM-L---NVQGEE-------------------YYYYYYYYSGEDGG
C0QCJ2      Y-G--KEKILGVVKNF-A---DARHGF-------------------------KKYEYK--
C2MBF8      Y-RDKRLKGLCVVLND-A---GIGASA----------------YG-YGYG---SYGYGSY
D3AE78      L-EKSGCRILGAVLNK-V---NQESKG-------YYGGYYSKYYG-KNYVKYSGYGSGGS
Q39U17      L-K--KEKVYGVVYNN-V---GINRFD------------ENYRYR-NYYAYYKDNGAQ--
B9M2X6      L-D--KSNLLGIVYNE-T---VNENLN------------GHY----HDYYQHKQYAW---
A5G424      L-K--GTNLLGIVYNE-A---SIDGFN------------DRY----NYYYRYDAEKW---
E8WSZ5      L-K--GSGVLGVVYNA-A---DAAAGD------------ESL----SYYKHYQKTPAA--
C7LPS3      L-D---QKVLGIVYNG-A---HLQSRS-----------------S-YYYAE---------
C3WFM9      L-SNAGANIYGFVVTK-V---DKGGLS-------------------YGNYGYYNNYYSYY
A4J8V0      L-LNGKAKILGTILNM-V---EEDSQD-------------------YYYY--YYYGEG--
A8U9F4      L-EKVKANVIGVVFNR-V---ELKGDN-------------------------YYYYYGEG
F4BSD9      L-EKVNANVIGVVLNR-V---ELKGDN-------------------------YYYYYGEE
F7V792      I-ERSGCQLLGIVLNR-A---GSKKNS-------------RYYYG-KEK---YGYGYYRK
F6IR93      L-KKAHTQLLGAVLND-V----DVKTH----------GY-----G-YGY---YGNDAN--
G0M0F9      L-KKAHTQLLGAVLND-V----DVKTH----------GY-----G-YGY---YGNDAN--
F6ITB4      L-KKSHANILGSVLND-V---RDSSHH----------GYYGYDNG-YGY---YSNEDK--
G0M1X9      L-KKSHANILGSVLND-V---RDSSHH----------GYYGYDNG-YGY---YSNEDK--
G0LYN9      L-KKVQANILGAVLND-V---RDGSHH----------GYYGYSSG-YGY---YSDEDK--
D7VC13      L-KKSQANILGAVLND-V---RDGSHH----------GYYGYNSG-YGY---YSDEDK--
F9UMZ6      L-KKSQANILGTVLND-V---RDSSHH----------GYYGYNSG-YGY---YSDEDK--
G7QCG1      L-N---NKVLGLVYNA-T---DYVKPC-----------------S-SYYSSYYAACND--
I2Q341      L-N---NKVLGLVYNA-T---DYVKPC-----------------S-SYYSSYYAACND--
H8YYB9      L---GGKRILGVVLNK-A---DGDS---------------------------SGDGYY--
I5AV01      L-ERANCPILGCVLNK-A---SQENER---------YGRYGRYGR-YGKYGRYGKYYGHY
B0GAL3      L-EKSGTHMLGAVLNK-V---DARKE--------------KYYSY-YSYGSKYGYGYG--
G1WUK2      L-EKSGTHMLGAVLNK-V---DTKKE--------------KYYSY-YSYGSK--YGYG--
E0RZL3      L-DKAGAKMLGVVLNK-V---DIAGKG--------YYGHYGNYYG-KYYGKYYGKYYGKY
D8FLF8      L-KLTKSPILGYVMND-V---DADGD-----------DGYGYGYG-YGYG--YGYGYG--
F0K0J7      L-KLTKSPILGYVMND-V---DADGD-----------D------G-YGYG--YGYGYG--
Q1G8E4      L-KLTKSPILGYVMND-V---DADGD-----------D----GYG-YGYG--YGYGYG--
C4VP08      L-EFAQAHVLGYIMND-V---KSEDA---------------------GYG--YGYGYG--
D6S4X4      L-EIAQAHVLGYIMND-V---KSEDA----------------GYG-YGYG--YGYGYG--
D0DJH0      L-KFAKARILGYVMND-I---RAENG----------------GYG-YGYG--YGYGYG--
C7XKF3      L-KFAKARILGYVMND-I---RAENG--------------GYGYG-YGYG--YGYGYG--
E3R264      L-KFAKARILGYVMND-I---RAENG--------------GYGYG-YGYG--YGYGYG--
D5GZJ8      L-RFAKARILGYVMND-I---RAENG--------------GYGYG-YGYG--YGYGYG--
C2EPK5      L-RFAKARILGYIMND-I---SSDNAG--------YGYGYGYGYG-YGYG--YGYGYGYG
A4ZGZ8      L-NFSKAKVLGFIMND-I---SSDNA------------GYGYGYG-YGYG--YGYGYG--
A8YX89      L-NFSKAKVLGFIMND-I---SSDNAG--------YGYGYGYGYG-YGYG--YGYGYG--
F0NWJ7      L-NFSKAKVLGFIMND-I---SSDNA------------GYGYGYG-YGYG--YGYGYG--
E4SMV5      L-EFAKARILGYIMND-V---SSDNA--------------GYGYG-YGYG--YGYGYG--
F0TGY2      L-EFAKARILGYIMND-V---SSDNA--------------GYGYG-YGYG--YGYGYG--
Q5FIC7      L-EFAKARILGYIMND-V---SSDNA--------------GYGYG-YGYG--YGYGYG--
F2M2M6      L-EFAKARILGYIMND-V---SSDNA--------------GYGYG-YGYG--YGYGYG--
G7M0Q3      L-DKVGANIIGTILYA-A---ENKYNK---------------------KY--CYYES---
G7M1R9      L-DKVGANILGTVLHA-V---ENTRGK---------------------YY--YYYGTK--
A6M2L9      L-DKVGANIIGTVLHA-V---ENTRGK---------------------YS--YYYGND--
G7M566      L-DKVGANIIGAVLHA-V---ENTRGK---------------------YS--NYYGNE--
G2KUP1      L-KKVNAKILGSVMNR-V---NAKESA-----------------G-YGGY--YGGGYY--
G8PE06      L-DVVHAKILGAIMNR-V---TAEKST-----------------G-YYGG--NYGGYY--
Q03GL8      L-EAVQANILGAILNR-A---TAEKST-----------------G-YYGG--YYGGYY--
E0NHP4      L-ETVQANILGAILNR-A---SAEKST-------------GYYGG-YYGG--YYGGYY--
F4FXQ7      L-KMVKANLLGYVLND-V---APKNGY-------------GYGYG-YGYG--YGYGYG--
C0WV35      L-KMVKANLLGYVLND-V---APKN-----------------GYG-YGYG--YGYGYG--
H1LCW3      L-KMVKANLLGYVLND-V---APKNGY-------------GYGYG-YGYG--YGYGYG--
C2JZS1      L-KLAKAKILGSVERV-K---ARRG-----------------DKG-YGYG--YGYGYT--
Q58Z10      L-KLANAKILGSVERV-K---AKHG-----------------DRG-YGYG--YGYGYG--
E9SAU1      V-RMADGSLLGVVINN-V---SVTGGKYGGKYSYKYKYGYKYGYG-YGYG--YSYGNN--
Q38VG5      L-DVVHARILGTIMNR-V---KPENTG-------------GY----YGGY--YGGYYG--
F0HVF1      L-KLTKSPILGYVMND-V---DADGDG-------------GYGYG-YGYG--YGYGYG--
G6F8G9      L-KLTKSPILGYVMND-V---DADGDD---------------GYG-YGYG--YGYGYG--
C2EWM3      L-KLAHANILGYVMND-V---GRNGDS-------------AYGYG-YGYG--YGYGYG--
F8DRU2      L-NLAHANLLGYVMND-V---NADGDA-------------AYGYG-YGYG--YG------
B3XL23      L-NLAHANLLGYVMND-V---NAEGDA-------------AYGYG-YGYG--YGYG----
F8KGP1      L-NLAHANLLGYVMND-V---NAEGDA-------------AYGYG-YGYG--YGYG----
H4GK03      L-NISKANLLGYVMND-V---ASGDDD-------------GYGYG-YGYG--YGYGTV--
B2GF33      L-RISKTNILGYVMND-V----YDADA-------------GYGYG-YGYG--YGY-----
C0WW26      L-KISQANVLGYVMND-V----YDDDA-------------GYGYG-YGYG--YED-----
D0DSJ4      L-KISQANVLGYVMND-V----YDDDA-------------GYGYG-YGYG--YEG-----
C0ZHV8      L-KAAGANLLGVVLNN-K---KVGK--REG----------------YYG-------YGYN
H1BJT1      L-ERSRSKILGIVLTK-T---QNLS--SYD----------------YYY------TYE--
F8FCE2      L-EHAKGRILGVVLNN-M---NKKEAGTYA----------------YQY-----------
H6NE43      L-EHAKGRILGVVLNN-M---NKKEAGTYA----------------YQY-----------
I0BSG4      L-EHAKGRILGVVLNN-M---SKKEAGTYA----------------YQY-----------
Q83VF9      L-EQVNANILGVVLNG-V---DSSD--SPS----------------YYY-------YGVE
G8P3D7      L-EQVNVNILGVVLHG-V---DSSD--SPS----------------YYY-------YGVE
O06030      L-EQVNANILGVVLHG-V---DSSD--SPS----------------YYY-------YGVE
G9M880      L-EQVNANILGVVLHG-V---DSSD--SPS----------------YYY-------YGVE
G6FD42      L-EQVNANILGVVLHG-V---DSSD--SPS----------------YYY-------YGVE
F9VC44      L-EQVNANILGVVLHG-V---DSSE--SPS----------------YYY-------YGVE
A9QSJ4      L-EQVNANILGVVLHG-V---DSSE--SPS----------------YYY-------YGVE
Q3ZK50      L-EQVNANILGVVLHG-V---DSSE--SPS----------------YYY-------YGVE
E3GPC6      L-RNVNGNIVGVVANN-A---PVSK-RSGY----------------YYY-------YSAY
G0V447      L-ESVRANIIGVVLNK-V---EINS--RNKYGY-------------YYY-------YGEA
H7F1R7      L-RNTHVHIIGTVLNY-V---KSDS--DNY----------------YYY-------YQ--
E3H7M5      L-EKAGANIYGVVVNK-V---SING--YSMGNYGHYSSN-------YKY-------YDEY
E6UHY4      I-KMADGSLLGVVVNN-V---SVMS--GKYGGKYGYRYR-------YGYRYGYGYGYGYS
D9QTC6      L-EKVQANVIGTVLTK-Y---PAEESNSYYSGY-------------YNY-------YG--
D9SR41      L-DKVDANLLGSILTR-V---PANSKNGSS----------------YYY-------YYYG
E3HB18      L-SSAGANIYGMVVNK-I---DNSGYGYGYKSHGYYNNN-------YRY-------YQDY
P95696      M-EKAGSNILGVILNK-T---KVDK-SSSY----------------YHY-------YGDE
Q2G1K7      M-EKAGSNILGVILNK-T---KVDK-SSSY----------------YHY-------YGDE
A8YPQ5      I-EATGAKLLGVVLNR-M---PKDK-SASY----------------YAY-------YGTD
Q2FUV2      I-EATGAKLLGVVLNR-M---PKDK-SASY----------------YAY-------YGTD
P39851      L-TKAGGKVLGAVLNK-M---PIDK-NSSY----------------YYY-------YGED
C5QNG4      I-EKADGKIIGAVLNK-T---PRDK-SSSY----------------YSY-------YGEE
Q4L9H7      I-EKAEGRLLGAVLNK-T---PVDK-SSSY----------------YYY-------YGED
A7NQ71      L-EKVKANIIGVVLNG-A---RF----DGE----------------YGY-------YA--
E4Q5T5      L-QKVNANIIGVVLNK-V---KRQT--SS-----------------YYY-------YYYY
E4SDX4      L-QKVNANIIGVVLNK-V---KRQT--SS-----------------YYY-------YYYY
E4S7Y6      L-QKVNANIIGVVLNK-V---NKQT--SGY----------------YYY-------YYYY
C6CS80      L-KFVQARIVGIALNQ-T---AHRE--AGP----------------YYE-------YVDR
E6LD64      L-QMVNANILGAIYHG-T---KNAV-DQG-----------------YYY-------YGS-
F0EKB9      L-NMVQARIIGVVYNG-A---EHSK-DSGY----------------YYY-------YGN-
H7F571      L-RKTKIPIIGTVLNC-V---KNRV--DNY----------------YDY-------S---
F5LE48      L-EHVGVKPLGVVINN-K---TNTKTSSSY----------------YSY-------YGES
E7RDR3      I-ESSNSRLIGAVLNN-F---ELPK--DSY----------------YYQ-------YYGN
E7RG08      ITASTKTRLLGTVLNN-V---QVEK--DFN----------------YAQ-------YYTR
F6CNF5      L-LKANARIIGVVLNQ-V---KMPA--RDY----------------HYY-------YYYH
G2FWX4      L-DKVDAKFLGAVLNK-V---DMKP--SE-----------------YYY-------YEYN
G2FM59      L-DKLGVKILGAVLNK-V---GMNT--KE-----------------YYY-------YYYY
G7WJV1      L-DKLEIKILGAVLNK-V---GMNS--HE-----------------YYY-------YNYY
H5XZD4      L-DKLGIKILGAVLNK-V---AMNT--KG-----------------YYC-------YNYY
H5XZG7      L-DKVGAKILGAVLNK-A---DIKT--SE-----------------YYY-------YYYY
G7W773      L-DKVGAKILGAVINK-A---DLKT--SE-----------------YYY-------YYYY
G2FWT8      L-DKVGAKILGAVLNK-A---DMKT--SE-----------------YYY-------YYYY
I4DBG8      L-DKVGAKILGAVLNK-A---DLKT--SE-----------------YYY-------YYYY
C0EBA6      L-EFAEMKILGAVVTH-A---GNER--KSR----------------YYR-------YMKY
Q9K6R0      L-DKSNANLLGVVLNN-K---ELRN--SNM----------------YYY-------YGES
I2HVL2      L-QQSKAKLLGALLNK-K---KIKK--TEH----------------YSY-----------
D4G1R2      L-EQSNAKLLGALLNK-K---KMKK--SEH----------------YSY-----------
G4EQZ7      L-EQSNAKLLGALLNK-K---KMKK--SEH----------------YSY-----------
P71051      L-EQSNAKLLGALLNK-K---KMKK--SEH----------------YSY-----------
E0U2Z3      L-EQSNAKLLGALLNK-K---KLKK--SEH----------------YSY-----------
G4P114      L-EQSNAKLLGALLNK-K---KMKK--SEH----------------YSY-----------
A9VRC3      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2QJY5      L-QSAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2RG49      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2T8T6      L-ESANGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2MTG3      L-ESAKGKLLGVVLND-R---E-RE--HGL----------------YYY-------YGAK
C2SSX8      L-ESAKGKLLGVVLND-R---E-RE--HGL----------------YYY-------YGAN
C2YZB2      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C3GBJ8      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2SBU4      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2NQN6      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C3GRR0      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2PN22      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2Y452      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2WVG6      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C3EBC0      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2XJH9      L-ESAKGKLLGVVLND-R---E-RE--QGL----------------YYY-------YGAN
C2P8H3      L-ESAKGKLLGVVLND-R---E-RE--EGL----------------YYY-------YGAN
C2ULR6      L-ESAKGKLLGVVLND-R---E-RE--EGL----------------YYY-------YGAN
C2V4M2      L-ESAKGKLLGVVLND-R---E-RE--EGL----------------YYY-------YGAN
C3H979      L-ESAKGKLLGVVLND-R---E-RE--EGL----------------YYY-------YGAN
G2TR25      L-ESANANLLGVVLNN-K---KTQN--THY----------------YYY-------YGKD
P96716      L-ATCKSKLLGAIMNG-K---KLSK--HSE----------------YGY-------YGTK
G4EQF3      L-ATCKSKLLGAIMNG-K---KLSK--HSE----------------YGY-------YGTK
D4G2E1      L-ETCKSKLLGAIMNG-K---KLSK--HSE----------------YGY-------YGNK
I0F9R6      L-ESCNSKLLGAIMNG-K---KLSK--HSE----------------YGY-------YGNK
E0TTZ6      L-ESCKSKLLGAIMNG-K---KLSK--HSE----------------YGY-------YGNK
G4P1M7      L-ESCKSKLLGAIMNG-K---KLSK--HSE----------------YGY-------YGNK
A8FHL9      L-DGTTGKLLGAMLNG-K---KEKK--GRL----------------YMY-----------
Q5KUM5      L-EAANAKLLGVVLNK-R---KHRD--GGY----------------YYY-------YQYK
D3FZP4      L-KQAQAKLIGAVLND-K---KKDN--TSY----------------YYY-------YGDK
I0JRK4      L-EQSRANILGVVLND-M---DAKD--SNY----------------YYY-------YGN-
I3EBB3      L-QAANARILGVVLNN-K---KVKG--NQY----------------YYY-------YGGK
E3CP62      L-EQSSPQFLGVVLNK-VDMTVDKY---------------------GSYGSYGSYGSYGE
C2KHF1      L-KIAEAPVLGFIYND-QSRRKKGS---------------------YGYGYGYG------
I0UTA5      L-NKVNANLFGLVLNR-APRKGLGN---------------------SYYGFGYANSYVGY
B7BDT8      Y-EAKRFKNMALVLNG-TIGGS-SR---------------------YGYRYGYRYGYK--
G9WIQ9      L-TLARAHLLGLVSRD-PERAE-KA---------------------YGYGYGYGYTTTNV
A0NKF6      L-KLAKANVLGVVSRD-QRRAD-K-------------------------GYGYGYTSTNV
Q04DV8      L-KLAKANVLGVVSRD-QRRAD-KG---------------------YGYGYGYGYTSTNV
E7T801      L-EQAGVNIKGAILNG-VIKR--AS---------------------TAYSYGY-------
F4SM97      F-EQSGVTVKGCILNG-VIKK--AS---------------------SYYGYGY-------
G5Q4J0      F-DQNGIQVKGVILNS-IFRR--AT---------------------GYQDYGY-------
G5LQM6      F-DQNGIQVKGVILNS-IFRR--AT---------------------GYQDYGY-------
G5SDT8      F-DQNGIQVKGVILNS-IFRR--AT---------------------GYQDYGY-------
F3CAY9      L-GQNGILIKGAIFNA-VVRKA-TT---------------------SDYDYAA-------
A3K8W7      R-LGTETPLLGMILNK-AE----GV---------------------DVERYAY-------
G7EJX6      L-FESKAHVAGIVLNQ-VDMSK-SN---------------------DEHSYGY-------
B7B947      L-YREGKLRNMSLILN-GTVYKHGT---------------------YGYHYGYGYGYGYG
D3LB10      I-LKLAKANVLGVVSR-DPHRADKG---------------------YGYNYRYDYASTNM
S9QRP1      R-LGDSTPLLGTVLNR-AEDTQIRK---------------------YSY-----------
G8AU96      L-KSVDSAVGGVVLSR-VVASKHVK---------------------YGHKDDAYYYALHA
D0D9W0      L-LGKNTPLLGMVLNK-AEGTSLDK---------------------YTY-----------
Q0FMP0      R-LGDDVPLLGTVLNK-AEGSKIRQ---------------------YTY-----------
A3W0H7      R-FGTDTPLLGVVMNR-AEGESIAK---------------------YGY-----------
I1AYC5      R-LGENTPLLGTVLNR-AEGTQLSK---------------------YSY-----------
                                                                        

E9TE88      SDAK--------------------------------------------------------
B8D0N2      -----KEYYYSYY-----------------------------------------------
C2CI44      --------YGNYY-----------------------------------------------
C7RGH6      --------YGNYY-----------------------------------------------
C0CK73      -------KYYSYE------YKKEK------------------------------------
Q1WTC8      --------YGYYH------K----------------------------------------
E8JWI5      --------YGHYG------DNLSKEE----------------------------------
F3AHH0      ------RHYGRYY------GKDE-------------------------------------
F7K0U1      ------KYYGKYG------EK---------------------------------------
C4Z672      YYGKYYGKYGEES-----------------------------------------------
P0C0T9      --------YGNYG------KRDRKRK----------------------------------
Q04663      --------YGNYG------KRDRKRK----------------------------------
Q67AY4      --------YGNYG------KRDRKR-----------------------------------
Q3K0T0      --------YGNYG------KRDRKRK----------------------------------
C5NWJ8      -----YGHYGSYGIKGNKDKK---------------------------------------
F3A499      -----YGHYGSYGLNGNKDKK---------------------------------------
Q4JZ55      --------NTASE------TERY-------------------------------------
G5JTD5      -----YGSYGDYG------KRTAVTRTNHASHTRRSK-----------------------
G3G7C1      --------YGNYG------KKA--------------------------------------
G3G7J9      --------YGNYG------KKA--------------------------------------
G3G7G6      --------YGNYG------RK---------------------------------------
G8DUB0      --------YGNYG------KKA--------------------------------------
G3G7I8      --------YGNYG------KKA--------------------------------------
G3G7J4      --------YGNYG------KKA--------------------------------------
G7SG34      --------YGNYG------KKA--------------------------------------
G8DTZ0      --------YGNYG------KKA--------------------------------------
G8DU07      --------YGNYG------KKA--------------------------------------
A4VTU3      --------YGNYG------KESLISQIT--------------------------------
G7SNU6      --------YGNYG------KKA--------------------------------------
G8DU31      --------YGNYG------KKA--------------------------------------
D5AGQ5      --------YGNYG------KKA--------------------------------------
Q9X4U7      --------YGNYG------KKA--------------------------------------
A3CQY2      --YGGYGSYGNYG------K----------------------------------------
E8KLY9      --YGGYGSYGNYG------K----------------------------------------
F0FHA8      --YGGYGSYGNYG------K----------------------------------------
F0I4H5      --YGGYGSYGNYG------K----------------------------------------
F0IAY3      --YGGYGSYGNYG------K----------------------------------------
F0IJI2      --YGGYGSYGNYG------K----------------------------------------
F0IS53      --YGGYGSYGNYG------K----------------------------------------
F2C9N0      --YGGYGSYGNYG------K----------------------------------------
F2CH53      --YGGYGSYGNYG------K----------------------------------------
F3SM32      --YGGYGSYGNYG------K----------------------------------------
F3UDW7      --YGGYGSYGNYG------K----------------------------------------
F3UNJ4      --YGGYGSYGNYG------K----------------------------------------
F0FQQ5      --YGGYGSYGNYG------K----------------------------------------
D6R2T8      --YGGYGDYGNYG------K----------------------------------------
F3UUQ2      --YGGYGDYGNYG------K----------------------------------------
E6IZC2      -----YGNYGNYG------KKK--------------------------------------
G6A745      -----YGDYGNYG------KK---------------------------------------
A8AZR3      -----YGNYGAYG------KKH--------------------------------------
F9HJP6      -----YGNYGNYG------KKH--------------------------------------
Q4JYT9      --YGTYGFYGNYR------KG---------------------------------------
Q4JZY1      -----YGVYGDYR------KG---------------------------------------
E1LQJ7      GAYGAYGSYGNYG------KKK--------------------------------------
F9HC65      --YGAYGSYGNYR------KKK--------------------------------------
E1LPE7      -----YGN---YG------KK---------------------------------------
F9MJW5      -----YGN---YG------KK---------------------------------------
E8KDN2      -----YGSYGAYG------KK---------------------------------------
E8K322      -----YGNYGSYG------KK---------------------------------------
F9PEU4      -----YGNYGSYG------KK---------------------------------------
F9PZP7      -----YGNYGAYG------KK---------------------------------------
C1CBD1      --------YGNYG------KR---------------------------------------
Q7WVX0      --------YGNYG------KR---------------------------------------
P96475      -----------YG------RK---------------------------------------
Q9AHD2      --------YGNYG------KK---------------------------------------
Q4K2Q7      --------YGSYG------KK---------------------------------------
Q4K0T5      --------YGNYG------KK---------------------------------------
Q4K0E1      --------YGNYG------KK---------------------------------------
Q9AH95      --------YGNYG------KK---------------------------------------
Q4K1M4      --------YGNYG------KK---------------------------------------
Q4JZ18      --------YGNYG------KK---------------------------------------
Q54520      --------YGNYG------KK---------------------------------------
Q4JYH5      --------YGNYG------KK---------------------------------------
Q4K0V2      --------YGNYG------KKII-------------------------------------
A5M4L1      --------YGNYG------KK---------------------------------------
B2ILP5      --------YGNYG------KK---------------------------------------
C1CCB9      --------YGNYG------KK---------------------------------------
Q4K1S7      --------YGNYG------KK---------------------------------------
P72512      --------YGNYG------KK---------------------------------------
Q4JZ84      --------YGNYG------KK---------------------------------------
Q4K0X5      --------YGNYG------KK---------------------------------------
Q4K0Z6      --------YGNYG------KK---------------------------------------
Q4K195      --------YGNYG------KK---------------------------------------
Q4K0A0      --------YGNYG------KK---------------------------------------
Q4K0K2      --------YGNYG------KK---------------------------------------
Q4K1F9      --------YGNYG------KK---------------------------------------
Q4K045      --------YGDYE------KNKKYVEG---------------------------------
G6C7Z1      --------YGDYG------KK---------------------------------------
D2ERX8      --------YGDYG------KK---------------------------------------
F9LZC4      --------YGDYG------KK---------------------------------------
F9P1W8      -----------YG------KK---------------------------------------
I0J9C9      --------YGNYG------NK---------------------------------------
A6YIA8      --------YGNYG------KNKK-------------------------------------
Q4K005      --------YGDYG------KNKK-------------------------------------
Q4JZL7      --------YGNYG------NK---------------------------------------
E5F5C5      --------YGNYG------KNKK-------------------------------------
Q4JZG7      --------YGDYG------KNKK-------------------------------------
Q4JZK1      --------YGDYG------KNKK-------------------------------------
A5LJS0      --------YGDYG------KNKK-------------------------------------
Q9AHB7      --------YGDYG------KNKK-------------------------------------
Q4K1B7      --------YGDYG------KNKK-------------------------------------
Q4JYK8      --------YGNYG------KE---------------------------------------
Q4K0M3      --------YGDYG------KNKK-------------------------------------
Q9AHA4      --------YGDYG------KNKK-------------------------------------
Q9X9A1      --------YGDYG------KNKK-------------------------------------
Q9ZII6      --------YG---------KNKK-------------------------------------
Q8KWQ0      --------YGDYG------KNKK-------------------------------------
Q4JZW7      --------YG-----------KK-------------------------------------
Q4JYX9      --------YGDYG------KNKK-------------------------------------
Q4K0R7      --------YGDYG------KNKK-------------------------------------
Q4K1K6      --------YGDYG------KNKK-------------------------------------
Q4JZS3      --------YGDYG------KNKK-------------------------------------
Q4K0I2      --------YGSYR------KQKK-------------------------------------
Q4K254      --------YGNYR------KQKK-------------------------------------
Q4K237      --------YGNYR------KQKK-------------------------------------
B1I967      --------YGNYR------KQKK-------------------------------------
G6J8A4      --------YGNYR------KQKK-------------------------------------
G6LKG5      --------YGNYR------KQKK-------------------------------------
Q9ZFT8      --------YGNYR------KQKK-------------------------------------
D6ZQI8      --------YGNYR------KQKK-------------------------------------
Q4K2A8      --------YGNDR------KK---------------------------------------
Q8VU31      --------YGKKK------K----------------------------------------
Q4K2E1      --------YGNYG------NK---------------------------------------
Q4K2F7      --------YGNYG------NK---------------------------------------
A5YTV7      -----YGSYGNYG------RK---------------------------------------
F9Q345      --------YGSYG------KK---------------------------------------
Q6L5R0      --------YGSYG------KK---------------------------------------
A5YTT9      --------YGNYG------KK---------------------------------------
E6KKS0      --------YGNYG------KK---------------------------------------
F2QF90      --------YGNYG------KK---------------------------------------
E0Q2S8      --------YGNYG------KK---------------------------------------
A1ILY1      -----YGNYGNYG------KK---------------------------------------
Q6L5T0      -----YGNYGNYG------KK---------------------------------------
E9FEC5      -----YGNYGNYG------KK---------------------------------------
E0PPH9      -----YGSYGNYG------KK---------------------------------------
F5VSG9      --------YGNYG------KK---------------------------------------
E3CBS0      --------YGSYG------EYG---KK---------------------------------
F9M366      --------YGSYG------EYG---KK---------------------------------
E8K786      --------YGSYG------EYG---KK---------------------------------
F8DFF4      --------YGSYG------EYG---KK---------------------------------
I1ZPH7      --------YGSYG------EYG---KK---------------------------------
E7S8W3      --------YGNYG------NYGK--KR---------------------------------
D0RXH2      --------YGNYG------NYGNYGKK---------------------------------
Q83YR5      --------YGNYG------NYGNYGKK---------------------------------
Q8GP54      -----YGSYGEYG------KKSDQKEGHSRAHRRRKG-----------------------
F8HDC3      -----YGSYGSYGEY----GGDKHTENKSRKHRRKRG-----------------------
F8LJ75      -----YGSYGSYGEY----GGDKHTENKSRKHRRKRG-----------------------
E9DM17      -----YGSYGDYG------KKSEQKSSHSRSQRRRKG-----------------------
I0QIK6      -----YGAYGDYG------KKSEQKSSHSRSQRRRKG-----------------------
E8KUY8      -----YGSYGSYGEYG---KKGKQKESHSRAHRRRKG-----------------------
Q7X553      -----YGSYGEYG-----------------------------------------------
Q8GP92      -----YGLYGEYG------KKSDQKEGHSRAYRRRKGKH---------------------
Q7X561      -----YGSYGSNGSYGSQ------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      -----YGSYGEYG------KKSNQKEGHSRAHRRRKVGWN--------------------
O87931      -----YGSYGEYG------KKSNQKEGHSRAHRRRKVGWN--------------------
Q8GPF6      -----YGSYGEYG------KKSDQKEGHSRAYRRRK------------------------
Q7X555      -----YGSYGEYG------KKTDQ------------------------------------
Q7X557      -----YGSYGEYG------KKTDQ------------------------------------
Q7X563      -----YGSYGSYGSYGEY------------------------------------------
Q8GMA5      -----YGSYGSYGSYGEYRKKTDQTEGHSRAHRRRKG-----------------------
Q8GPA8      -----YGSYGSYGSYGEYRKKTDQTEGHSRAHRRRKG-----------------------
Q55205      -----YGSYGEYG------KKSNQKEGHSRAHRRRKG-----------------------
C2LSE6      -----YGSYGEYG------KKSDQKEGHSRAHRRRKG-----------------------
Q7X559      -----YGSYGEYE------KKTDQ------------------------------------
F8LXJ4      -----YGSYGEYG------KKYDQKEGHSRAHRRRKG-----------------------
Q1WCR1      -----YGSYGEYG------KKYDQKEGHSRAHRRRKG-----------------------
Q8GPC3      -----YGSYGEYE------KKTDQTEGHSRAHRRRKG-----------------------
E8JMT9      -----YGGYGEYG------EKN--------------------------------------
F5X0J9      -----YGGYGSYG------NYGKSEEKTKIGRGKRKK-----------------------
H2A602      -----YGGYGSYG------NYGKSEEKTKIGRGKRKK-----------------------
E0PD83      -----YGGYGAYG------NYGKGKEKTKTGRVKRKK-----------------------
F5X652      -----YGGYGTYG------A---KEEKSKKGKGRRRK-----------------------
G5KD11      -----YGAYGSYG------SYGKENEKSRKASRRRK------------------------
B9DUJ4      -----YGAYGNYG------NYGKEDSKSKKKNRRRK------------------------
G5KAJ2      -----YGSYGNYG------KKEKPRKHVRKSSRKRK------------------------
F1Z124      -----YGSYGAYG------NYGKPAK---KKSRKRR------------------------
Q2KM74      -----YGSYGDYG------KTKKSSK---SKKHSRK------------------------
C6LDI8      -------YYGDYY------KK---------------------------------------
D4J4T6      -------YYGHYG------KYGEY------------------------------------
D4LTH2      GHYGQYGYGPQAE------EENKKSKK---------------------------------
D4LG06      --NYGYG-YGY---------EPDTKHKKHSEK----------------------------
A7VF42      --DYGYG-YGYGE------KKYSGKKEK--------------------------------
A8SQS8      YKQYGYGEYGRYG------QEAASSKDK--------------------------------
D5HFS4      YSQYGYG-YGTYG------KEAAAASDSTPSK----------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      GKYGKYGRYGYDK------SAQTQ------------------------------------
E7GL81      HYVYGYGYGRENK------K----------------------------------------
G5F9E2      HYVYGYGYGRENK------K----------------------------------------
E7GL57      -----YGKEYSSE------H----------------------------------------
G5F9A9      -----YGKEYSSE------H----------------------------------------
E7GL40      -----YGYGHENA------KQGKEVKTASV------------------------------
G5F9H2      -----YGYGHENA------KQGKEAKVL--------------------------------
A8RK85      GRHYGRYEEGKAP------PVNEVSGARIKNDTTAQSQDT--------------------
G5HTB2      --------YGKYG------EA---------------------------------------
G5HNC5      GRYYGKTYGGGGE------KYQILDEAR--------------------------------
C0CZV9      G---KYSRYEKYA------KYDKSEITEG-------------------------------
A8RSK9      ----KYSKYGHYG------KYDRYEKAEA-------------------------------
C5EN03      GKYSKYGKYGKYG------KYEKYEKANA-------------------------------
G5HG45      GKYSKYGKYGKYG------KYEKYEKAEA-------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      TN----------------------------------------------------------
F9UQ54      TN----------------------------------------------------------
H6LKR8      HSKKEKKLKKKK------------------------------------------------
E0I7B5      E-----------------------------------------------------------
D7UYE4      KK----------------------------------------------------------
Q4A120      S-----------------------------------------------------------
D9SVC7      DDDE--------------------------------------------------------
D9S1J9      EGDHKRKKKKIT------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      VK----------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      YAGMMAHRPAGAGGKGDR------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      EPAEARSTAEKTGKLSRILGKRGSK-----------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      GA----------------------------------------------------------
B5EA81      NA----------------------------------------------------------
C6DZX5      NA----------------------------------------------------------
A1ARV8      SA----------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      KKKNSIMSSITKKGDKKK------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      DIDSEDLQS---------------------------------------------------
D4YHG7      ETSK--------------------------------------------------------
C1J9I3      TGKK--------------------------------------------------------
B1MZT1      K-----------------------------------------------------------
H1WR06      KS----------------------------------------------------------
H1X4N2      KTK---------------------------------------------------------
Q03W95      KA----------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      -------DNKKKKLKVRS------------------------------------------
Q8XN76      -------DNKKKKLKVRS------------------------------------------
B1BNK1      -------DNKKKKLKVRS------------------------------------------
B1V0N7      -------DNKKKKLKVRS------------------------------------------
Q0SVR8      -------KKD--------------------------------------------------
B1BNH3      -------KKD--------------------------------------------------
Q8XN46      -------KKD--------------------------------------------------
B1V1Z4      -------KKD--------------------------------------------------
G5GFW0      TEQAGRSKWIQRDKAER-------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      KEV----TKKNKEK----------------------------------------------
D4M2S0      KQE---------------------------------------------------------
F4BS19      KELDSVG-----------------------------------------------------
D4CG08      K-----------------------------------------------------------
D4MP30      K-----------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      DTE----KNHPNT-----------------------------------------------
D4MW29      DTE----KNHPNT-----------------------------------------------
E5VMX8      DTE----KNHQNT-----------------------------------------------
D4JMC2      DDE----K----------------------------------------------------
D6E0V4      DDE----K----------------------------------------------------
D6E330      DKA---------------------------------------------------------
C4Z8M5      DKA---------------------------------------------------------
D4JI67      DKA---------------------------------------------------------
D3AC80      GEE----TKKQDKK----------------------------------------------
G5IFS3      GN----------------------------------------------------------
D4RX67      GDS----TDSQKG-----------------------------------------------
A6BIG7      KY----------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      GEK----VKKHKDR----------------------------------------------
Q97ER5      EN----------------------------------------------------------
D2RIR2      HVK----HHKKKGKREE-------------------------------------------
G0VNK6      HNK----KRKRR------------------------------------------------
I0GRR2      HEK----HKGRHKSKQKD------------------------------------------
A0PZ02      DEK---SKKRRKSKK---------------------------------------------
B1B736      EEKSKTSKKRRKNEK---------------------------------------------
F6BI62      GSK----HKRKRRKK---------------------------------------------
Q8RBS5      KSQ----SKKRRKR----------------------------------------------
G2MWC2      KPQ----HKKRRKR----------------------------------------------
B0K4N1      KPQ----HRKRRKR----------------------------------------------
B0KAR5      KPQ----HRKRRKR----------------------------------------------
E8UV29      KPQ----HRKRRKR----------------------------------------------
C7ISF7      KPQ----HRKRRKR----------------------------------------------
F7K9V1      YGNSEEGGLHAAVVQKGTKGAKAVKGEGNLHSHDNKSTRESGKEKAAEEDVIAEDDMIQL
F7K8E9      YGNNEEGGLHAAVVQKGLKSGKAAKGEENTHSHEIKNGSDPVKEKIPEESQIPEDDMIQL
F7KL96      YGNNEEGGLHAAVVQKGLKSGKTAKGEENTHSHENKNGPELVKEKNPEESLVPEEDMIQL
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      SGDYYSSGYISPAKKKKQQ-----------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      R-----------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      KKPKNKGHRKKNLPAATM------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      GSYGSEKE----------------------------------------------------
D3AE78      SGKAEKSEEKTEMKTAAAGGEENQVKRSRRRK----------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      QEYYSDSNGNRKKHTVKKPKSKFGKFIHDIKEQYKRQFSGDLKGKK--------------
A4J8V0      ------SGDKKKGKKRGHKAACL-------------------------------------
A8U9F4      E-----------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      SDYYGKHAAENAKS----------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      GYYAASDDSKDSGKTKGEKAKKRKKK----------------------------------
B0GAL3      ------QNHENA------------------------------------------------
G1WUK2      ------QNHENE------------------------------------------------
E0RZL3      GEDNIDVPTKPNATVTDPEPDEDDLDELNYLAGVMRKD----------------------
D8FLF8      ------EEKEKKGLFGRKK-----------------------------------------
F0K0J7      ------EEDEKKGLFGRKK-----------------------------------------
Q1G8E4      ------EEKEKKGLFGRKK-----------------------------------------
C4VP08      -----KENKEKKSLFLWLKK----------------------------------------
D6S4X4      -----EPEKEKKSIFSWMNK----------------------------------------
D0DJH0      -------AEKKKGLFGRKKSDDQ-------------------------------------
C7XKF3      -------AEKKKGLFGRKKSDDQ-------------------------------------
E3R264      -------AEKKKGLFGRKKSDDQ-------------------------------------
D5GZJ8      -------AEKKKGLFGRKKSDGQ-------------------------------------
C2EPK5      YGYGYGEEKKKKSWFSRLKK----------------------------------------
A4ZGZ8      -----EEDKKKKGFFSRRKK----------------------------------------
A8YX89      -----EEDKKKKGFFSRRKK----------------------------------------
F0NWJ7      -----EEDKKKKGFFSRRKK----------------------------------------
E4SMV5      -----EEDTKKKGLFSKFRK----------------------------------------
F0TGY2      -----EEDTKKKGLFSKFRK----------------------------------------
Q5FIC7      -----EEDTKKKGLFSKFRK----------------------------------------
F2M2M6      -----EEDTKKKGLFSKFRK----------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------DDEKKN------------------------------------------------
A6M2L9      ------EDKDNL------------------------------------------------
G7M566      ------EDKE--------------------------------------------------
G2KUP1      ------GVDDK-------------------------------------------------
G8PE06      ------GTGGK-------------------------------------------------
Q03GL8      ------GTDNK-------------------------------------------------
E0NHP4      ------GTDDK-------------------------------------------------
F4FXQ7      ------YDNEGK------------------------------------------------
C0WV35      ------YDNEGK------------------------------------------------
H1LCW3      ------YDNEGK------------------------------------------------
C2JZS1      ------TENQR-------------------------------------------------
Q58Z10      ------NESNK-------------------------------------------------
E9SAU1      ------ASVGSGKSNDNDE-----------------------------------------
Q38VG5      ------AEESKK------------------------------------------------
F0HVF1      ------EEKEKKGLFGRKK-----------------------------------------
G6F8G9      ------EEKEKKGLFGRKK-----------------------------------------
C2EWM3      ------YSSDNK------------------------------------------------
F8DRU2      --------ENTK------------------------------------------------
B3XL23      -------EDAGK------------------------------------------------
F8KGP1      -------EDTNK------------------------------------------------
H4GK03      ------EPED--------------------------------------------------
B2GF33      ------EDER--------------------------------------------------
C0WW26      ------ER----------------------------------------------------
D0DSJ4      ------DEE---------------------------------------------------
C0ZHV8      A-----------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      EEDQHQSKKEKKHRKIKEKRGK--------------------------------------
G0V447      EGKK--------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      KKR---------------------------------------------------------
E6UHY4      YSRKPSDEGENDE-----------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      EKKAK-------------------------------------------------------
E3HB18      IKEDK-------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ES----------------------------------------------------------
Q2FUV2      ES----------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      E-----------------------------------------------------------
Q4L9H7      E-----------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      YYYYTDESGETVKKKKVGRRRKKDDRYTLPSDGRR-------------------------
E4SDX4      YYYYQDENGEVVKKKKTGRRRKKDDRYTLPSDGGR-------------------------
E4S7Y6      YYYYQDDSGEIIKKKKGERRKKRKERYTAPVESKN-------------------------
C6CS80      T-----------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      K-----------------------------------------------------------
E7RDR3      AE----------------------------------------------------------
E7RG08      APNEK-------------------------------------------------------
F6CNF5      RREKEEEVRL--------------------------------------------------
G2FWX4      ESKH----PKKRHRRHKAG-----------------------------------------
G2FM59      NASDD---TKKKHNRRSL------------------------------------------
G7WJV1      NSAKD---M---------------------------------------------------
H5XZD4      NAADD---TKKKQSKMAYL-----------------------------------------
H5XZG7      HGSDD---PGKKRKSRGNP-----------------------------------------
G7W773      HGSDD---PKKKRTRKNRS-----------------------------------------
G2FWT8      HGSDD---SAKKPKRHKAR-----------------------------------------
I4DBG8      HGSEDPNESKRKHKRQRAH-----------------------------------------
C0EBA6      KSYKE-------------------------------------------------------
Q9K6R0      DR----------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      DNFMQK------------------------------------------------------
G4EQF3      DNFMQK------------------------------------------------------
D4G2E1      DNFMQNK-----------------------------------------------------
I0F9R6      DNFMQNK-----------------------------------------------------
E0TTZ6      ENFIQNK-----------------------------------------------------
G4P1M7      ENFIQNK-----------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      YGKKENKKKVIQEHIVVEKDSVNGDNAAPYALIFKEELRVKEKQEIRRIEIGVVQLVVVV
C2KHF1      ------------------------------------------------------------
I0UTA5      A-----------------------------------------------------------
B7BDT8      ------------------------------------------------------------
G9WIQ9      MSSDAMKRASNAQVHQNTHHHRPEKKSETVQNQAKSTEVTPTKAVVEPTKVWSSF-----
A0NKF6      MKTNDASKASSSKTAPAKPKVPKASVTDTDASKVEQQVPSDVKKEAAHSTAVAEKKTVTA
Q04DV8      MKTNDASKASSRKTAPAKPKVLKASV--TDASKVEQQVPSDTKKEASRPNAAASK-----
E7T801      ------------------------------------------------------------
F4SM97      ------------------------------------------------------------
G5Q4J0      ------------------------------------------------------------
G5LQM6      ------------------------------------------------------------
G5SDT8      ------------------------------------------------------------
F3CAY9      ------------------------------------------------------------
A3K8W7      ------------------------------------------------------------
G7EJX6      ------------------------------------------------------------
B7B947      YGYGYGQRKKK-------------------------------------------------
D3LB10      MKTDDVSKDASRHSTPVKAETQSTSLKNTEQLKHAAAKESSPSPKAQAPKSGRFFNKETV
S9QRP1      ------------------------------------------------------------
G8AU96      PARH--------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9      ------------------------------------------------------------
H2A602      ------------------------------------------------------------
E0PD83      ------------------------------------------------------------
F5X652      ------------------------------------------------------------
G5KD11      ------------------------------------------------------------
B9DUJ4      ------------------------------------------------------------
G5KAJ2      ------------------------------------------------------------
F1Z124      ------------------------------------------------------------
Q2KM74      ------------------------------------------------------------
C6LDI8      ------------------------------------------------------------
D4J4T6      ------------------------------------------------------------
D4LTH2      ------------------------------------------------------------
D4LG06      ------------------------------------------------------------
A7VF42      ------------------------------------------------------------
A8SQS8      ------------------------------------------------------------
D5HFS4      ------------------------------------------------------------
C9LAS1      ------------------------------------------------------------
F3AH92      ------------------------------------------------------------
I5ASF8      ------------------------------------------------------------
E7GL81      ------------------------------------------------------------
G5F9E2      ------------------------------------------------------------
E7GL57      ------------------------------------------------------------
G5F9A9      ------------------------------------------------------------
E7GL40      ------------------------------------------------------------
G5F9H2      ------------------------------------------------------------
A8RK85      ------------------------------------------------------------
G5HTB2      ------------------------------------------------------------
G5HNC5      ------------------------------------------------------------
C0CZV9      ------------------------------------------------------------
A8RSK9      ------------------------------------------------------------
C5EN03      ------------------------------------------------------------
G5HG45      ------------------------------------------------------------
D9ST44      ------------------------------------------------------------
G2Z8Q3      ------------------------------------------------------------
C8W5K2      ------------------------------------------------------------
A5V0I3      ------------------------------------------------------------
F5LM71      ------------------------------------------------------------
D7VBW4      ------------------------------------------------------------
F9UQ54      ------------------------------------------------------------
H6LKR8      ------------------------------------------------------------
E0I7B5      ------------------------------------------------------------
D7UYE4      ------------------------------------------------------------
Q4A120      ------------------------------------------------------------
D9SVC7      ------------------------------------------------------------
D9S1J9      ------------------------------------------------------------
C0GGR5      ------------------------------------------------------------
C6CSC8      ------------------------------------------------------------
A3ICA3      ------------------------------------------------------------
B1HR41      ------------------------------------------------------------
D6Y034      ------------------------------------------------------------
Q8EME8      ------------------------------------------------------------
F3Y922      ------------------------------------------------------------
G4L594      ------------------------------------------------------------
C9B454      ------------------------------------------------------------
Q3XYS6      ------------------------------------------------------------
C9ALZ9      ------------------------------------------------------------
C9BUG7      ------------------------------------------------------------
D4RJF4      ------------------------------------------------------------
C8ZXT9      ------------------------------------------------------------
G5IRQ6      ------------------------------------------------------------
C9A6V5      ------------------------------------------------------------
C9CHY8      ------------------------------------------------------------
Q814Z0      ------------------------------------------------------------
B9IRQ6      ------------------------------------------------------------
B7HXB4      ------------------------------------------------------------
Q72XH8      ------------------------------------------------------------
A0RL70      ------------------------------------------------------------
Q6HB09      ------------------------------------------------------------
F0PU64      ------------------------------------------------------------
B7HFH1      ------------------------------------------------------------
B7IQS8      ------------------------------------------------------------
B3ZRD6      ------------------------------------------------------------
B5UQ73      ------------------------------------------------------------
G9QCG3      ------------------------------------------------------------
Q3EV64      ------------------------------------------------------------
Q5WBB4      ------------------------------------------------------------
B1YMM5      ------------------------------------------------------------
D7WMM8      ------------------------------------------------------------
A7Z921      ------------------------------------------------------------
I2CAF2      ------------------------------------------------------------
A7Z9K0      ------------------------------------------------------------
I2CB16      ------------------------------------------------------------
I2HW53      ------------------------------------------------------------
G9QKR4      ------------------------------------------------------------
D5DBK3      ------------------------------------------------------------
D5DY81      ------------------------------------------------------------
Q2BFS5      ------------------------------------------------------------
A4ITF3      ------------------------------------------------------------
C5D961      ------------------------------------------------------------
G8MZ93      ------------------------------------------------------------
F0G6H5      ------------------------------------------------------------
F2I4B7      ------------------------------------------------------------
Q74BQ8      ------------------------------------------------------------
F0JCB8      ------------------------------------------------------------
Q314L3      ------------------------------------------------------------
B5EA81      ------------------------------------------------------------
C6DZX5      ------------------------------------------------------------
A1ARV8      ------------------------------------------------------------
C6CW37      ------------------------------------------------------------
G9RSY9      ------------------------------------------------------------
B9Y884      ------------------------------------------------------------
A5Z5P9      ------------------------------------------------------------
Q1AUN8      ------------------------------------------------------------
F2I6Z7      ------------------------------------------------------------
D4YHG7      ------------------------------------------------------------
C1J9I3      ------------------------------------------------------------
B1MZT1      ------------------------------------------------------------
H1WR06      ------------------------------------------------------------
H1X4N2      ------------------------------------------------------------
Q03W95      ------------------------------------------------------------
F0SX22      ------------------------------------------------------------
B6W7H4      ------------------------------------------------------------
F0GT81      ------------------------------------------------------------
B1R3X6      ------------------------------------------------------------
Q8XN76      ------------------------------------------------------------
B1BNK1      ------------------------------------------------------------
B1V0N7      ------------------------------------------------------------
Q0SVR8      ------------------------------------------------------------
B1BNH3      ------------------------------------------------------------
Q8XN46      ------------------------------------------------------------
B1V1Z4      ------------------------------------------------------------
G5GFW0      ------------------------------------------------------------
C2EFR6      ------------------------------------------------------------
F3ATF5      ------------------------------------------------------------
D4M2S0      ------------------------------------------------------------
F4BS19      ------------------------------------------------------------
D4CG08      ------------------------------------------------------------
D4MP30      ------------------------------------------------------------
C6LCS5      ------------------------------------------------------------
B0P2G2      ------------------------------------------------------------
D4MW29      ------------------------------------------------------------
E5VMX8      ------------------------------------------------------------
D4JMC2      ------------------------------------------------------------
D6E0V4      ------------------------------------------------------------
D6E330      ------------------------------------------------------------
C4Z8M5      ------------------------------------------------------------
D4JI67      ------------------------------------------------------------
D3AC80      ------------------------------------------------------------
G5IFS3      ------------------------------------------------------------
D4RX67      ------------------------------------------------------------
A6BIG7      ------------------------------------------------------------
C0C0F8      ------------------------------------------------------------
Q97EP8      ------------------------------------------------------------
Q97ER5      ------------------------------------------------------------
D2RIR2      ------------------------------------------------------------
G0VNK6      ------------------------------------------------------------
I0GRR2      ------------------------------------------------------------
A0PZ02      ------------------------------------------------------------
B1B736      ------------------------------------------------------------
F6BI62      ------------------------------------------------------------
Q8RBS5      ------------------------------------------------------------
G2MWC2      ------------------------------------------------------------
B0K4N1      ------------------------------------------------------------
B0KAR5      ------------------------------------------------------------
E8UV29      ------------------------------------------------------------
C7ISF7      ------------------------------------------------------------
F7K9V1      DMDMVELVEDTELIEELK------------------------------------------
F7K8E9      DIDMVELTEDTEPIEELR------------------------------------------
F7KL96      DIDMVELVEDTEPIEELK------------------------------------------
C9AAE5      ------------------------------------------------------------
H7F6C8      ------------------------------------------------------------
H7F5T6      ------------------------------------------------------------
E6PYQ3      ------------------------------------------------------------
B1R3V1      ------------------------------------------------------------
I5B296      ------------------------------------------------------------
D4YF13      ------------------------------------------------------------
E6U7N4      ------------------------------------------------------------
C8VYQ6      ------------------------------------------------------------
C0QCJ2      ------------------------------------------------------------
C2MBF8      ------------------------------------------------------------
D3AE78      ------------------------------------------------------------
Q39U17      ------------------------------------------------------------
B9M2X6      ------------------------------------------------------------
A5G424      ------------------------------------------------------------
E8WSZ5      ------------------------------------------------------------
C7LPS3      ------------------------------------------------------------
C3WFM9      ------------------------------------------------------------
A4J8V0      ------------------------------------------------------------
A8U9F4      ------------------------------------------------------------
F4BSD9      ------------------------------------------------------------
F7V792      ------------------------------------------------------------
F6IR93      ------------------------------------------------------------
G0M0F9      ------------------------------------------------------------
F6ITB4      ------------------------------------------------------------
G0M1X9      ------------------------------------------------------------
G0LYN9      ------------------------------------------------------------
D7VC13      ------------------------------------------------------------
F9UMZ6      ------------------------------------------------------------
G7QCG1      ------------------------------------------------------------
I2Q341      ------------------------------------------------------------
H8YYB9      ------------------------------------------------------------
I5AV01      ------------------------------------------------------------
B0GAL3      ------------------------------------------------------------
G1WUK2      ------------------------------------------------------------
E0RZL3      ------------------------------------------------------------
D8FLF8      ------------------------------------------------------------
F0K0J7      ------------------------------------------------------------
Q1G8E4      ------------------------------------------------------------
C4VP08      ------------------------------------------------------------
D6S4X4      ------------------------------------------------------------
D0DJH0      ------------------------------------------------------------
C7XKF3      ------------------------------------------------------------
E3R264      ------------------------------------------------------------
D5GZJ8      ------------------------------------------------------------
C2EPK5      ------------------------------------------------------------
A4ZGZ8      ------------------------------------------------------------
A8YX89      ------------------------------------------------------------
F0NWJ7      ------------------------------------------------------------
E4SMV5      ------------------------------------------------------------
F0TGY2      ------------------------------------------------------------
Q5FIC7      ------------------------------------------------------------
F2M2M6      ------------------------------------------------------------
G7M0Q3      ------------------------------------------------------------
G7M1R9      ------------------------------------------------------------
A6M2L9      ------------------------------------------------------------
G7M566      ------------------------------------------------------------
G2KUP1      ------------------------------------------------------------
G8PE06      ------------------------------------------------------------
Q03GL8      ------------------------------------------------------------
E0NHP4      ------------------------------------------------------------
F4FXQ7      ------------------------------------------------------------
C0WV35      ------------------------------------------------------------
H1LCW3      ------------------------------------------------------------
C2JZS1      ------------------------------------------------------------
Q58Z10      ------------------------------------------------------------
E9SAU1      ------------------------------------------------------------
Q38VG5      ------------------------------------------------------------
F0HVF1      ------------------------------------------------------------
G6F8G9      ------------------------------------------------------------
C2EWM3      ------------------------------------------------------------
F8DRU2      ------------------------------------------------------------
B3XL23      ------------------------------------------------------------
F8KGP1      ------------------------------------------------------------
H4GK03      ------------------------------------------------------------
B2GF33      ------------------------------------------------------------
C0WW26      ------------------------------------------------------------
D0DSJ4      ------------------------------------------------------------
C0ZHV8      ------------------------------------------------------------
H1BJT1      ------------------------------------------------------------
F8FCE2      ------------------------------------------------------------
H6NE43      ------------------------------------------------------------
I0BSG4      ------------------------------------------------------------
Q83VF9      ------------------------------------------------------------
G8P3D7      ------------------------------------------------------------
O06030      ------------------------------------------------------------
G9M880      ------------------------------------------------------------
G6FD42      ------------------------------------------------------------
F9VC44      ------------------------------------------------------------
A9QSJ4      ------------------------------------------------------------
Q3ZK50      ------------------------------------------------------------
E3GPC6      ------------------------------------------------------------
G0V447      ------------------------------------------------------------
H7F1R7      ------------------------------------------------------------
E3H7M5      ------------------------------------------------------------
E6UHY4      ------------------------------------------------------------
D9QTC6      ------------------------------------------------------------
D9SR41      ------------------------------------------------------------
E3HB18      ------------------------------------------------------------
P95696      ------------------------------------------------------------
Q2G1K7      ------------------------------------------------------------
A8YPQ5      ------------------------------------------------------------
Q2FUV2      ------------------------------------------------------------
P39851      ------------------------------------------------------------
C5QNG4      ------------------------------------------------------------
Q4L9H7      ------------------------------------------------------------
A7NQ71      ------------------------------------------------------------
E4Q5T5      ------------------------------------------------------------
E4SDX4      ------------------------------------------------------------
E4S7Y6      ------------------------------------------------------------
C6CS80      ------------------------------------------------------------
E6LD64      ------------------------------------------------------------
F0EKB9      ------------------------------------------------------------
H7F571      ------------------------------------------------------------
F5LE48      ------------------------------------------------------------
E7RDR3      ------------------------------------------------------------
E7RG08      ------------------------------------------------------------
F6CNF5      ------------------------------------------------------------
G2FWX4      ------------------------------------------------------------
G2FM59      ------------------------------------------------------------
G7WJV1      ------------------------------------------------------------
H5XZD4      ------------------------------------------------------------
H5XZG7      ------------------------------------------------------------
G7W773      ------------------------------------------------------------
G2FWT8      ------------------------------------------------------------
I4DBG8      ------------------------------------------------------------
C0EBA6      ------------------------------------------------------------
Q9K6R0      ------------------------------------------------------------
I2HVL2      ------------------------------------------------------------
D4G1R2      ------------------------------------------------------------
G4EQZ7      ------------------------------------------------------------
P71051      ------------------------------------------------------------
E0U2Z3      ------------------------------------------------------------
G4P114      ------------------------------------------------------------
A9VRC3      ------------------------------------------------------------
C2QJY5      ------------------------------------------------------------
C2RG49      ------------------------------------------------------------
C2T8T6      ------------------------------------------------------------
C2MTG3      ------------------------------------------------------------
C2SSX8      ------------------------------------------------------------
C2YZB2      ------------------------------------------------------------
C3GBJ8      ------------------------------------------------------------
C2SBU4      ------------------------------------------------------------
C2NQN6      ------------------------------------------------------------
C3GRR0      ------------------------------------------------------------
C2PN22      ------------------------------------------------------------
C2Y452      ------------------------------------------------------------
C2WVG6      ------------------------------------------------------------
C3EBC0      ------------------------------------------------------------
C2XJH9      ------------------------------------------------------------
C2P8H3      ------------------------------------------------------------
C2ULR6      ------------------------------------------------------------
C2V4M2      ------------------------------------------------------------
C3H979      ------------------------------------------------------------
G2TR25      ------------------------------------------------------------
P96716      ------------------------------------------------------------
G4EQF3      ------------------------------------------------------------
D4G2E1      ------------------------------------------------------------
I0F9R6      ------------------------------------------------------------
E0TTZ6      ------------------------------------------------------------
G4P1M7      ------------------------------------------------------------
A8FHL9      ------------------------------------------------------------
Q5KUM5      ------------------------------------------------------------
D3FZP4      ------------------------------------------------------------
I0JRK4      ------------------------------------------------------------
I3EBB3      ------------------------------------------------------------
E3CP62      FAAWLASKLPYTEITKGSMVILGVVHVVTYYISSYYENLKYRGYLDELIATVKYGFIFAL
C2KHF1      -------------------------YGYGYGDTKSKWLINRHDRERRKRLMVYRRFLKRF
I0UTA5      -------------------------TYYGYSKDGTKKKVKSRKKAKK-------------
B7BDT8      -------------------------YGYAYGYGSKSYYNN--------------------
G9WIQ9      -------------------------EATNRIASRQTKTPPAPSAAANEETTAKVLPMVDI
A0NKF6      ASKTAPTSAPKSSW-----------SSFSYTSTGSEKSEASSKAKEPGPNNAQEISLVDI
Q04DV8      -------TAPKSSW-----------SSFSYTSTGSEKSEASSKAKEPGPSNVQEISLVDI
E7T801      -------------------------NYYGYSYSEKE------------------------
F4SM97      -------------------------NHYGYNYGEDK------------------------
G5Q4J0      -------------------------YEYEYQSDSK-------------------------
G5LQM6      -------------------------YEYEYQSDSK-------------------------
G5SDT8      -------------------------YEYEYQSDSK-------------------------
F3CAY9      -------------------------YGYNYHPAPR-------------------------
A3K8W7      ------------------------------------------------------------
G7EJX6      -------------------------YDYHDYSQKPEQPTA--------------------
B7B947      ------------------------------------------------------------
D3LB10      QETPRAPRVKKPQA-----------SWSSFSYTSSGSEKSEIPKETEKPGPSGA------
S9QRP1      ------------------------------------------------------------
G8AU96      ------------------------------------------------------------
D0D9W0      ------------------------------------------------------------
Q0FMP0      ------------------------------------------------------------
A3W0H7      ------------------------------------------------------------
I1AYC5      ------------------------------------------------------------
                                                                        

E9TE88      ------------------------------------------------------------
B8D0N2      ------------------------------------------------------------
C2CI44      ------------------------------------------------------------
C7RGH6      ------------------------------------------------------------
C0CK73      ------------------------------------------------------------
Q1WTC8      ------------------------------------------------------------
E8JWI5      ------------------------------------------------------------
F3AHH0      ------------------------------------------------------------
F7K0U1      ------------------------------------------------------------
C4Z672      ------------------------------------------------------------
P0C0T9      ------------------------------------------------------------
Q04663      ------------------------------------------------------------
Q67AY4      ------------------------------------------------------------
Q3K0T0      ------------------------------------------------------------
C5NWJ8      ------------------------------------------------------------
F3A499      ------------------------------------------------------------
Q4JZ55      ------------------------------------------------------------
G5JTD5      ------------------------------------------------------------
G3G7C1      ------------------------------------------------------------
G3G7J9      ------------------------------------------------------------
G3G7G6      ------------------------------------------------------------
G8DUB0      ------------------------------------------------------------
G3G7I8      ------------------------------------------------------------
G3G7J4      ------------------------------------------------------------
G7SG34      ------------------------------------------------------------
G8DTZ0      ------------------------------------------------------------
G8DU07      ------------------------------------------------------------
A4VTU3      ------------------------------------------------------------
G7SNU6      ------------------------------------------------------------
G8DU31      ------------------------------------------------------------
D5AGQ5      ------------------------------------------------------------
Q9X4U7      ------------------------------------------------------------
A3CQY2      ------------------------------------------------------------
E8KLY9      ------------------------------------------------------------
F0FHA8      ------------------------------------------------------------
F0I4H5      ------------------------------------------------------------
F0IAY3      ------------------------------------------------------------
F0IJI2      ------------------------------------------------------------
F0IS53      ------------------------------------------------------------
F2C9N0      ------------------------------------------------------------
F2CH53      ------------------------------------------------------------
F3SM32      ------------------------------------------------------------
F3UDW7      ------------------------------------------------------------
F3UNJ4      ------------------------------------------------------------
F0FQQ5      ------------------------------------------------------------
D6R2T8      ------------------------------------------------------------
F3UUQ2      ------------------------------------------------------------
E6IZC2      ------------------------------------------------------------
G6A745      ------------------------------------------------------------
A8AZR3      ------------------------------------------------------------
F9HJP6      ------------------------------------------------------------
Q4JYT9      ------------------------------------------------------------
Q4JZY1      ------------------------------------------------------------
E1LQJ7      ------------------------------------------------------------
F9HC65      ------------------------------------------------------------
E1LPE7      ------------------------------------------------------------
F9MJW5      ------------------------------------------------------------
E8KDN2      ------------------------------------------------------------
E8K322      ------------------------------------------------------------
F9PEU4      ------------------------------------------------------------
F9PZP7      ------------------------------------------------------------
C1CBD1      ------------------------------------------------------------
Q7WVX0      ------------------------------------------------------------
P96475      ------------------------------------------------------------
Q9AHD2      ------------------------------------------------------------
Q4K2Q7      ------------------------------------------------------------
Q4K0T5      ------------------------------------------------------------
Q4K0E1      ------------------------------------------------------------
Q9AH95      ------------------------------------------------------------
Q4K1M4      ------------------------------------------------------------
Q4JZ18      ------------------------------------------------------------
Q54520      ------------------------------------------------------------
Q4JYH5      ------------------------------------------------------------
Q4K0V2      ------------------------------------------------------------
A5M4L1      ------------------------------------------------------------
B2ILP5      ------------------------------------------------------------
C1CCB9      ------------------------------------------------------------
Q4K1S7      ------------------------------------------------------------
P72512      ------------------------------------------------------------
Q4JZ84      ------------------------------------------------------------
Q4K0X5      ------------------------------------------------------------
Q4K0Z6      ------------------------------------------------------------
Q4K195      ------------------------------------------------------------
Q4K0A0      ------------------------------------------------------------
Q4K0K2      ------------------------------------------------------------
Q4K1F9      ------------------------------------------------------------
Q4K045      ------------------------------------------------------------
G6C7Z1      ------------------------------------------------------------
D2ERX8      ------------------------------------------------------------
F9LZC4      ------------------------------------------------------------
F9P1W8      ------------------------------------------------------------
I0J9C9      ------------------------------------------------------------
A6YIA8      ------------------------------------------------------------
Q4K005      ------------------------------------------------------------
Q4JZL7      ------------------------------------------------------------
E5F5C5      ------------------------------------------------------------
Q4JZG7      ------------------------------------------------------------
Q4JZK1      ------------------------------------------------------------
A5LJS0      ------------------------------------------------------------
Q9AHB7      ------------------------------------------------------------
Q4K1B7      ------------------------------------------------------------
Q4JYK8      ------------------------------------------------------------
Q4K0M3      ------------------------------------------------------------
Q9AHA4      ------------------------------------------------------------
Q9X9A1      ------------------------------------------------------------
Q9ZII6      ------------------------------------------------------------
Q8KWQ0      ------------------------------------------------------------
Q4JZW7      ------------------------------------------------------------
Q4JYX9      ------------------------------------------------------------
Q4K0R7      ------------------------------------------------------------
Q4K1K6      ------------------------------------------------------------
Q4JZS3      ------------------------------------------------------------
Q4K0I2      ------------------------------------------------------------
Q4K254      ------------------------------------------------------------
Q4K237      ------------------------------------------------------------
B1I967      ------------------------------------------------------------
G6J8A4      ------------------------------------------------------------
G6LKG5      ------------------------------------------------------------
Q9ZFT8      ------------------------------------------------------------
D6ZQI8      ------------------------------------------------------------
Q4K2A8      ------------------------------------------------------------
Q8VU31      ------------------------------------------------------------
Q4K2E1      ------------------------------------------------------------
Q4K2F7      ------------------------------------------------------------
A5YTV7      ------------------------------------------------------------
F9Q345      ------------------------------------------------------------
Q6L5R0      ------------------------------------------------------------
A5YTT9      ------------------------------------------------------------
E6KKS0      ------------------------------------------------------------
F2QF90      ------------------------------------------------------------
E0Q2S8      ------------------------------------------------------------
A1ILY1      ------------------------------------------------------------
Q6L5T0      ------------------------------------------------------------
E9FEC5      ------------------------------------------------------------
E0PPH9      ------------------------------------------------------------
F5VSG9      ------------------------------------------------------------
E3CBS0      ------------------------------------------------------------
F9M366      ------------------------------------------------------------
E8K786      ------------------------------------------------------------
F8DFF4      ------------------------------------------------------------
I1ZPH7      ------------------------------------------------------------
E7S8W3      ------------------------------------------------------------
D0RXH2      ------------------------------------------------------------
Q83YR5      ------------------------------------------------------------
Q8GP54      ------------------------------------------------------------
F8HDC3      ------------------------------------------------------------
F8LJ75      ------------------------------------------------------------
E9DM17      ------------------------------------------------------------
I0QIK6      ------------------------------------------------------------
E8KUY8      ------------------------------------------------------------
Q7X553      ------------------------------------------------------------
Q8GP92      ------------------------------------------------------------
Q7X561      ------------------------------------------------------------
Q7X549      ------------------------------------------------------------
G6ERT1      ------------------------------------------------------------
O87931      ------------------------------------------------------------
Q8GPF6      ------------------------------------------------------------
Q7X555      ------------------------------------------------------------
Q7X557      ------------------------------------------------------------
Q7X563      ------------------------------------------------------------
Q8GMA5      ------------------------------------------------------------
Q8GPA8      ------------------------------------------------------------
Q55205      ------------------------------------------------------------
C2LSE6      ------------------------------------------------------------
Q7X559      ------------------------------------------------------------
F8LXJ4      ------------------------------------------------------------
Q1WCR1      ------------------------------------------------------------
Q8GPC3      ------------------------------------------------------------
E8JMT9      ------------------------------------------------------------
F5X0J9 &nb