BYKdb

Dataset for cluster tad of phylum all

[Download (right click)] [Edit] [Sequences] [Repertoires]

517 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      MYGAAIAFGTTLVVSNGIGPAGAGEFFRLMALFAIATSTAVFGADTGLVRTISAQNALGR
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      YSAIPRLIRYAVLPPLALSLGITAVACIYSVAVPMPHEYAVALRMSALFVIVAAVMSVYF
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      GALRGLNHVVTFTVMQNVLLPTLRFGAIALVVFASGHLLDLVFAWTLPVAATALLTLWVV
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ESYMPRSKDRPQSEAAATTPQESAHSFWTFSSARGVATIVETILEWIDVLTVTTVLGPAA
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      GGVYGAVNRCVRVGTMVEHTGRIVTGPSISAALATQNIDRARQIFLATTRVLTAISWPFY
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      LTLAAFGPTLLGFFGKGFEEGAGILWVICPAAMLSMSAGGVQSILLMSGKSRWQLLNKLS
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      SLAVAIILNVALVPLWGLYGAVTAWASALLIDTFLASYQVFRLVGIRTSLTEMAPALTLG
B7B948      ------------------------------------------------------------
G8AU95      ------------------------------------------------------------
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ALVPLGCSFVVLTVVGQGLLGLVLYVILLAPSYVALLYYFRTQLGIERFLASRKGGGKGA
B7B948      ------------------------------------------------------------
G8AU95      ---------------------------------------------MNSSIGKGGTLPGHE
G5IFS2      ------------------------------------------------------------
F0G6H6      ------------------------------------------------------------
F6CNF6      ------------------------------------------------------------
A3W0H6      ------------------------------------------------------------
A3K8W6      ------------------------------------------------------------
Q0FMP1      ------------------------------------------------------------
S9QRP2      ------------------------------------------------------------
D0D9W1      ------------------------------------------------------------
I1AYC4      ------------------------------------------------------------
E9TE87      ------------------------------------------------------------
E6PYQ4      ------------------------------------------------------------
C0QCJ1      ------------------------------------------------------------
I5B297      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
C7LPS4      ------------------------------------------------------------
Q314L4      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
Q39U16      ------------------------------------------------------------
F0JCB9      ------------------------------------------------------------
G7QCG0      ------------------------------------------------------------
I2Q342      ------------------------------------------------------------
Q74BQ7      ------------------------------------------------------------
B5EA80      ------------------------------------------------------------
C6DZX6      ------------------------------------------------------------
A1ARV9      ------------------------------------------------------------
E8WSZ4      ------------------------------------------------------------
A5G425      ------------------------------------------------------------
B9M2X7      ------------------------------------------------------------
C2MBF7      ------------------------------------------------------------
H8YYB8      ------------------------------------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------MNSNRV
D5HFS3      ------------------------------------------------------MNSNKK
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      --------------------------------------------------------MSTE
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------MELINN
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------MNFRKG
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      -------------MNQTNQN--LKSDDEVIELGIYINVIKRAKWRILSFAIVVTLLA-I-
G9RSY8      ----------------------MKEEYETIDLLEILRLLKKNLLVILAVTILLAVAGYL-
F3CAY8      -------------MTVMNRPSLDFHQDSRIDLAAVLRMLFDHKALILWTVSLFFLIG-L-
I0UTA4      GTRSALAHQLSIQGENTMSKLSATTDAPAVSLREQLHRVWRHKMIVIITIVVCTLIAVA-
B7B948      -----------MNTEQETNTRVEESE---LNLGDILQTVLANWYWFVLSVVVCAGAA-F-
G8AU95      AHASVLPDSLLQSGAAESSDVRSRQE---ATVFATLAVLWRRKLLLLTIILLGTATI-T-
G5IFS2      ----------------MGTNQDDEIE---IDLKELFFVMRRKLWVLILTGMLGAAVSGI-
F0G6H6      -----MSHLTMPESRGGPTARPPHPF---RRYWGMLYGGRRTIVASALICVAAGAL----
F6CNF6      ---------MAEPNQNPEFAEEVIDL---RQYLKVLGKWRKVIALGTLLSVLTSAIL-S-
A3W0H6      ----------------------MSAI---QSFPDLIRLLHRKLWLIVLVAVVGAILS-I-
A3K8W6      ----------------------MSQF---QSVGEVFAALRRRAWVILGIFLVGCVIS-V-
Q0FMP1      ----------------------MNQF---QSIGEVLSALKRRALLILLVTVLGSAAS-V-
S9QRP2      ----------------------MTQF---QSIESVFAALRRRAWIIILVTVVGCALS-V-
D0D9W1      ----------------------MNQF---QSVGELWAALRRRAALIALVALIGCAIS-L-
I1AYC4      ----------------------MNQF---QSVGEVLAALRRRVLLMIAVILLGSALS-L-
E9TE87      ---------MTEKVKQHAAPVTGSDE---IDIGRLVGTVIEARWWVIGITAVFALCA-V-
E6PYQ4      ----------MTKFPSSNTNQFADNP---IRVADVARLIRKYGIYVLGSTMLGAILF-A-
C0QCJ1      ----------------MQQIQQNQLP---ITPAQIIDILIRRRWIIVIPLCITLTVG-L-
I5B297      ----------------MADPFQSQTQ---IKPDYIIDVLIRGRWFLIVPLCISLTLG-L-
B8D0N1      ---------------MDNIPHNYEYE---IDLTEYLGILNKRKWLILAITILAGVMG-Y-
D9QTC7      -------MDNLERQTTDSDITEDMVE---IDLREYFTILWKRKMIIIGLLIVAIIGS-L-
C7LPS4      --------------------MNHELY---QQFERYARILLQRKRVVVVVALLVMTLG-V-
Q314L4      -------------MNTMLDDVEAGGG---LDILRYIRLLWEHALAFWLMAAVVMLAA-L-
G0VNK5      ---------------------MEEIT---IDLKDLFQVVMDHKKKIAAITAAFMIAG-G-
D2RIR1      -------------------MNEQE-----IDLRELWQIVRTNQKTIAKITGGFLGLA-V-
I0GRR3      -------------------MDDKEVT---IDLREVWDLMVTGRMKIAKITALFLVAA-G-
Q39U16      ---------------------MVSKT---EELNKYLKMLMKRRYLFIVVSLVVMSVI-A-
F0JCB9      ------------MTDNKLETPGAEAS---FDVMHYVQLVGNHRGLFVFIVLLAMFIA-I-
G7QCG0      ---------------------MSAFL---KEFHHYKQLIYLYKELFLAVSLLIMTGA-I-
I2Q342      ---------------------MSAFL---KEFHHYKRLIYLYKELFLAVSLLIMTGA-I-
Q74BQ7      ---------------------MQQSE---FDYRHYLTLIVARKRLFVVVALAVMAAA-V-
B5EA80      ---------------------MQSPE---TEYKKYLQLLISNKERFVVIALLLMTVA-F-
C6DZX6      ---------------------MQSPE---TEYKKYLQLLFSNKERFVVIALLLMTVA-F-
A1ARV9      ---------------------MSDSE---FDYKKYLELIVRKKELFVKLALLIMTIA-I-
E8WSZ4      -----------------------MQE---SEYKKYTQLIARRKEFFVVAALLIMTLV-F-
A5G425      --------------------MSTTNE---LDYKKYLMLIDKKKKLFIITALAIMTVI-T-
B9M2X7      --------------------MPTTND---FDYKRYLNLVKQRKTLFLVTALAVMTIT-V-
C2MBF7      -----MEYATDSIQQEPARSLEEAST---LSLQDILMILKANWLFILLSLIVCLTLG-F-
H8YYB8      ---------------------MEEQL---LSLDDYIAILKRRKWQLIIPAVLLSIVG-M-
E7T802      ---------MTTKNMNTPPGSTQENE---IDLLRLVGELWDHRKFIISVTALFTLIAVA-
F4SM98      -----------MPLIKNKKLDKDADE---IDLGRIIGELIDHRKLIIAVTALFTFISLL-
C4Z673      --------------MQEKSKETENIE---IDLREIFGVLIHRLWIIVVAALVCGSVAFM-
E3H7M4      ------------MQDNNKKEREKNEIRKEIDMVELFMIVKQNWKVLFRTIFIMVALGFT-
C2EWM2      -----------------------------------MEICRDHAKLFILWTVIMGIVGFV-
D0DSJ3      -----------------MESEKNTNA---IDLQHLWKLFVQHVRMILIWTVGLGVIAWG-
B2GF32      -----------------MESEKNTNA---IDLQHLWKLFVQHVRMILIWTVGLGVIAWG-
C0WW25      -----------------MESEKNTNA---IDLQHLWKLFVQHVRMILIWTVGLGVIAWG-
F8KGP2      ---------------MNSSQQTANNT---IDLHRLMMLCRKHIKMLIIWTLLAGVLGYV-
B3XL22      ---------------MNSSQQTANNT---IDLHRLMMLCRKHIKMLIIWTLLAGILGYV-
F8DRU3      ---------------MNSSQQTANNT---IDLHRLMMLCRKHIKMLIIWTLLAGVLGYV-
B1MZT2      ----------------------MNNV---LELRQLWDIIRKHFFAIFFMALIGAGIGYG-
H1WR07      ----------------------MNNV---LELRQLWDIIRKHFFAIFFMALIGAGIGYG-
Q03W94      ----------------------MNNV---LELRQLWQIIRKHFFSIVVMAIIGAAAGFG-
C2KHF2      ----------------------MNNV---LELRQLWHIIQKHFFAIIFMAIIGACAGYG-
H1X4N3      ----------------------MNNV---LELRQLWHIIQKHFFALIFMAIIGAGAGYG-
C2JZS0      ----------------------MNEQ---INLSQLWDVLKKSFIAMILLGLIGMAVAYF-
C1J9I2      ----------------------MNEQ---IDLAQLWNVFKRSFLAMIVFGIIGMAAAYF-
Q58Z11      ----------------------MNEQ---IDLARLWNVFKHSFIVMILLGLLGMFIAYF-
F0K0J8      --------------MSAEQQNNEEVT---IDLRRLFILIKKHIISILIWMIGLGLIAYG-
G6F8H0      --------------MSAEQQNNEEVT---IDLRRLFILIKKHIISILIWMIGLGLIAYG-
Q1G8E3      --------------MSAEQQNNEEVT---IDLRRLFILIKKHIISILIWMIGLGLIAYG-
D8FLF7      --------------MSAEQQNNEEVT---IDLRRLFILIRKHIISILIWMIGLGLIAYG-
F0HVF2      --------------MSAEQQNNEEVT---IDLRRLFILIRKHIISILIWMIGLGLIAYG-
Q5FIC6      ----------------MEQKQEQENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
E4SMV6      ------------------MEQKQENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
F0TGY3      ----------------MEQKQEQENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
F2M2M7      ----------------MEQKQEQENT---IDLTQLLRICRKHIWALILWSVGLALVGWG-
C4VP07      -----------------MEQLQENNT---IDLAQLLKILRRHLVSLLVWSFGFAIVAWG-
D6S4X3      -----------------MEQIHENNT---IDLAQLLKLLRRHIGSLLIWSLGFAIIAWG-
A4ZGZ7      ---------------MEQEQKQTDNT---IDLTQLLQLCRRHIWALILWSVGLALVGWG-
C2EPK4      ---------------MEQEQKQTDNT---IDLTQLLQICRRHIWALILWSIGLAVIGWG-
C7XKF2      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWG-
E3R265      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWG-
D0DJG9      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWG-
D5GZJ9      ---------------MEQEQKQTENT---IDLTQLLQICRRHIWALIIWSVGLALVGWS-
A8YX90      ---------------MEQEQKQTDNT---IDLTQLLQLCRRHIWALILWSVGLALVGWG-
F0NWJ8      ---------------MEQEQKQTDNT---IDLTQLLQLCRRHIWALILWSVGLALVGWG-
C6CW36      -----------------------------MEIKQYFRIVLKKWWLILILVLLASVISGI-
A8SQS9      ETTERDTGTQPSALSAYKAAEGEENE---IDLLDMGMALLEKLPYIILCFLVGAVLFNA-
D5HFS3      MAAVQDETTQIAAVNTYKNTEDDENE---IDLLDMGMALLEKLPYIILCFLIGAVLFNA-
A5Z5P8      --------MKQQVEKIKINEKEDEVE---INLLDLFNYYRKKILFIIAGFLIGAIIAGV-
G2KUP2      -----------------------------MSFSFLGLIIKRHLKLILSSIVFFVAISSF-
G8PE07      ------------------MET--EQQ---ISIGQVLSTLRRHIGLIAASTVIVTLLSVL-
E0NHP5      ------------------METAETQQ---ISIGQILAILRKHIGLIFASTFIITLLAAL-
Q03GL9      ------------------MESVESQQ---ISIGQILSILRKHIGLIFASTFIVTLLAAF-
C6CSC7      ----------------------MSEE---LDLREYFLIVRKRLLLIVIFVLVCTVASGV-
C6CS79      ----------------------MSSQ---LDLKEIVWLIRKKLWLVVLVTVLGASAAGA-
F5LM70      ----------------------MSID---FEIKRYLAVLRKRLWLILLIVAAGCLITGV-
G0LYN8      -------------------MMDQTVS---FGF--FIRLVRKYWLTIVSFTVAGLIVAAG-
F6ITB3      -------------------MMDQAVS---FDF--FIRLVRKYWRAIIGFTVAGLIVAAG-
G0M1Y0      -------------------MMDQAVS---FDF--FIRLVRKYWRAIIGFTVAGLIVAAG-
D7VC12      -------------------MMDQAVS---FDF--FIRLIRKYWRAIVSFTLVGLIVAAG-
F9UMZ5      -------------------MMDQAVS---FDF--FIRLVRKYWRAIVSFTVVGLIVAAG-
D4JI68      --------------MEREQDFDNEIE---IDLKDLFLEIISYWQWIILVTIATGAVAFA-
D6E329      --------------MEREQDFDNEIE---IDLKDLFLEIISYWQWIILVTIATGAVAFA-
Q1AUN7      -------MSTDTTTAREAAPAGRDAF---FSAKEFLKVLRR--RAWAVVFVASALAASA-
H4GK02      --------------------METSNT---IDLRRLVKILRKNLLMLIVWTLGLGIIAAA-
F6IR92      --------------------MEQIIT---FDF--MVKLVRHYWKVLLSLTLLGGLIATV-
G0M0G0      --------------------MEQIIT---FDF--MVKLVRHYWKVLLSLTLLGGLVATV-
D7VBW5      --------------------MEQVIT---FDF--IVKLIRQYWKVLLSLMILGGTIATV-
F9UQ55      --------------------MEQVIT---FDF--IVKLIRQYWKVLLSLMILGGTIATV-
B9Y883      ------------------MYENDEIE---IDLSRVFEIIKKYFKPFALIILAASIVAAL-
D4YHG8      --------------MLEEDEMNDTQE---ISLIEILNILTANIWKIISTTVIGIVLAAL-
F7V793      ---MNQENNTFDKQKERRLHSSEQTE---IDLGELFFCFLTRWKVLVLAFVIGAVAAGG-
C3WFM8      ------MSRKKKYEDYDEEFENDEDE---IDLADLIFTLIRRWKLIVLTAIPVVILGVI-
H7F1R6      ----------------------MEET---MNVKRLWGLLKKNKWLIFMSTCVCILLMSV-
H7F570      ----------------------MEDN---LNVKQLRNLVKKNKWILLACVSISTLLMLM-
C6LCS6      --------------MEENTSYTNEIE---FDLKAIFTAVRDRIFLLILVAAAGMIITYL-
A7VF43      NKRVSESDTAKEEKNNYIRVVQAEEDDKEIDLVDLGYALMDKLHFIVLSFLLGAVLLNA-
A7Z922      ----------------------MNEN---MSFKELFDIIKHRFLLIFIMTAVVTLVTGY-
I2CAF3      ----------------------MNEN---MSFKELFDIIKHRLLLIFIMTAVVTLVTGY-
I2HVL3      ----------------------MNEN---MSFKELFDIIKHRLLLIFIMTAVVTLVTGY-
E0U2Z4      ----------------------MNEN---MSFKELYAIVRHRFVLILLLTIGVTLITGF-
D4G1R3      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTLIMGF-
G4EQZ6      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTLIMGF-
P71050      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTLIMGF-
G4P115      ----------------------MNEN---MSFKELYAIVRHRFVLILLITIGVTVMTGF-
A8FHM0      ----------------------MNEN---IGFKQLFSVIKEKMALLILIVLIVTGISAY-
C0EBA5      ----------------------MNEG---LDLKQILRILVKRL-WIIVLCLIVGGLGAFS
F4FXQ8      ----------------------MENY---LDLRQILGIIRKHIIFIIISFILCLIIAVG-
C0WV34      ----------------------MENY---LDLRQILGIIRKHIIFIIISFILCLIIAVG-
H1LCW2      ----------------------MENY---LDLRQILGIIRKHIIFIMISFILCLIIAVG-
B7BDT7      -------------MATQNNISRPKQTDDFIRIQDLFYLCLNRWYWFVI-SLAVTVGVAV-
H6LKR9      --------------------MNKTGE---VDLKELFRIVLKKWWLIILLTIVGFVGAYF-
F5LE49      ------------------------ME---SGLNQYIQILRKRIWLIIITVFVVTVMSGI-
F3AHH1      --------------MEMNQPKDNEIQ---INVREIFFALLSKMGVILLSGVLLAVLAVT-
F3Y921      ----------------------MEET---ISIQEIIKTIKSHIGFIFVCAILGVGISGI-
G4L593      ----------------------MEET---ISLSEIFDVLKKYWTTILTSLFAGLALAAV-
E6LD65      ----------------------MEKT---YTVKQLLDMFKKHIQLILTCMFAGLALSGV-
C9ALZ8      ----------------------MEET---ISLKEIFETLRKHVITILISMFAGLAISGI-
C9BUG6      ----------------------MEET---ISLKEIFETLRKHLVIIIISMFAGLAISGI-
Q3XYS7      ----------------------MEET---INFKEIFETLRKHLLTIIISMFAGLAISGI-
C9B453      ----------------------MEET---ISLKEIFGTLRKHLATIIISMFAGLAISGI-
D4RJF5      ----------------------MEET---ISLKEIFETLRKHLVTIIISMFAGLAISGI-
F0EKB8      ----------------------MEET---ISLKEIFAILRKHLAAIFISMFAGLALAGI-
C9A6V4      ----------------------MEET---ISLKEIFAILRKHLAAIFISMFAGLALAGI-
C9CHY7      ----------------------MEET---ISLKEIFAILRKHLAAIFISMFAGLALAGI-
C8ZXT8      ----------------------MEET---ISLKEIFDILRKHLAAIFISLFAGLAFAGI-
G5IRQ5      ----------------------MEET---ISLKEIFEVLRKHLASIIIAMFAGLALAGI-
E6UHY5      ---------------------MEGKE---ISIQEILGILLSHIRMIIVVTILAGIVGYS-
E9SAU2      ---------------------MEEKE---ISVQEILGILLAHIRLIVIVTVVAGVAGYS-
F7K0U2      ----------MNQNNTNMGMENDEIT---IDLMDLFQVVFKKLHLVLLAGIIAALVAVL-
O06029      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
G8P3D6      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
A9QSJ3      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGGI-
F9VC43      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
G6FD41      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
G9M881      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
Q3ZK51      ------------------MQETQEQT---IDLRGIFKIIRKRLGLILFSALIVTILGSI-
Q83VG0      ------------------MQETQEQT---IDLRVIFKIIRKRLGLILFSALIVTILGSI-
C6LDI9      NPGL----------------KNDEIR---INLIELFYALLHKMKVIIFAVILGAAAAFT-
G5F9H3      ------MEKVYQ--------DDDEIE---IDLRELLFEMKKKIWFIIAGLLIGAAITGA-
C0CZV8      -------METYMN-------DNEEIE---IDLFELFMELKRKIWVILGVAVLCAGAAGA-
G5GFW1      ETAVSTGSSFYIPLEMVNNINEEEIQ---LDIFEVLYALKKRFFLLLFSTILGFGIFGA-
I5AV00      ----------------MDNRKNAQIE---IDLGAIMHLLFTKLPVIVITSAIFLLANLL-
H6NE44      -----------------------------MEVKHYLQILRRYIWLILGVTLITSLCTAL-
F4BS20      ----------------------MMNT---IGMVDIFKMLKKRWWVIVLLSLIGIALTTA-
E0RZL4      --------------------MNNRDDVLEINLGELFAVLMGRAFLIISAGIFFALAGLF-
C0CK72      ---------------METEHLNDELE---IDLIDLLLYLKRKIWLLLLGLLAGVLLSAL-
D9S1J8      ----------------MEEINIYEEE---ISLREIISVLKKRLRLITVVVAICIMAAAT-
C2EFR7      ----------------MDNIKKEYRE---LDLFEIFQMLLRHWWIILLSGLLCGLAAFT-
Q1WTC7      ----------------MDNIKKEYRE---LDLFEIFQMLLRHWWIILLSGLLCGLAAFT-
B0P2G1      ---------------MYELENDDEIE---IDLRELFLALKKKIVWILLTAIVFAGASGL-
D4MW28      ---------------MYELENDDEIE---IDLRELFLALKKKIVWILLTAIVFAGASGL-
E5VMX9      ---------------MYELENDDEIE---IDLREMFLALKKKIVWILLTAIVFAGASGL-
F2I6Z8      -------------------------------MASFFRGLKRQWLFIFLGILLGIVVASA-
E6U7N3      -------------MNETNEPTSYDQE---LDLGRLLLILKRGWLPILLASFLGLIVAFS-
C4Z8M6      -----MRGYVMEREQDFDN----EIE---IDLKDLFLEIISYWQWIILVTIATGAVAFA-
D4JMC3      ---------MENNEPIRDQ----EIE---IDLLALFHELVKHWKALVASMVLLAAVFGL-
D6E0V3      ---------MENNEPIRDQ----EIE---IDLLALFHELVKHWKALVASMVLLAAVFGL-
E3GPC7      -----------------------MEE---ISLHDILDMLKENWKFIVILTLCFMIVVSV-
A6BIG6      ------MSQDNNIIVLNQEADEEEIS---VNIAELIHVLCSKIHIIVLSAILTALVAFL-
C2CI43      ---------------------MNEQE---IDLIELSKKLVKHLPMIFLFAIVIGALSFV-
D4RX68      -----------MMEKLENKNKNDE-----IDLMKILRMLASKWMFIVITAVVLAGAAFI-
D4J4T5      -----------MEKKRNDN---EEME---IDLLELLMVMKKHLSAILLAGIVGLVIMFA-
I5ASF9      -----MEERAAVIQNLNLQDDGGEME---LDLVELLYEIRKKIWYVILFALIGASIAAG-
C0C0F9      ---------MNQNSVANREFENDEIN---IDLTELFLAVWSKIHLVILAGIFMALLAFA-
B6W7H3      ---------------------MDERE---IDLLELAKKLRQHLFSILCLAVIFAALSYA-
C7RGH5      ---------------------MNEQE---IDLIELSKKIGKHLPMIIIFSIIVGAASFL-
F0GT82      ---------------------MNEKEIYLIDLVDLIKKVFKHLFLIIILTILFGLGSFA-
F3AH93      -----------MEKKMEEQ------S---IDLIEIFYVLKQKILWILAAGLLFGCGAAA-
B0GAL4      -----------MGKNYDND----EME---IDLLELFYVLKSKILAILGVGLLFGCIACA-
G1WUK1      -----------MGKNYDND----EME---IDLLELFYVLKSKILAILGVGLLFGCIACA-
D4M2S1      -----------MGKTHDDD----EVE---IDLRELFYALKKRILVILAAILAGAVIAGA-
E7GL80      -----------MEKITHQHLDDDEIV---IDFRELFYEFKRRIWWILLAAVLGTGAAGA-
G5F9E3      -----------MEKITHQHLDDDEIV---IDFRELFYEFKRRIWWILLAAVLGTGAAGA-
D4CG07      -----------MEKNRYEE----NDE---IDLLELFYELKKKLWLIILAAIIGGGAFGL-
D4MP31      -----------MEKNRYEE----NDE---IDLLELFYELKKKLWLIILAAIIGGGAFGL-
G5HNC6      -----------MENKLYEDRDENEIE---IDVMELLYVFKKKAWIIILAAIAGCMAAGL-
A8RK86      -----------MEKRYRED----DME---IDLLELLFEFKKRAWVIILAAVLGCLGAGA-
G5HTB1      -----------MENNIYEDRNENEIE---IDVLELLFVFKKKAWVIILAALAGCLGSGI-
A8RSL0      -----------MEKTYDDD----EIE---IDLLELLGEFRRKIWIILGTIILFGSVAGA-
C5EN02      -----------MEKTYEDD----EIE---IDLLELLGEFRRKIWIILGVIVLFGGVAGA-
G5HG46      -----------MEKNFDDD----EIE---IDLLELLREFRRRIWIILGVIVLFGGVAGA-
E7GL39      -----------MEKVYQDD----EIE---IDLRELLFEMKKKIWFIIAGLLIGAAITGA-
E7GL56      -----------MEKMYTEDKE--EIE---IDLRELLFELKKRLWLILVALFLGIGIAGA-
G5F9B0      -----------MEKMYTEDKE--EIE---IDLRELLFELKKRLWLILVALFLGIGIAGA-
D3AC81      ----------------MGTNQDDEIE---IDLKELFYVIKRKLWIILLTGIVGAVGFGL-
D3AE79      ----------------MKDTRDDEIE---IDLLQLFWVMKRRLWIMILAVVVGAAAAML-
D4YF14      ----------------------MEKE---YELYDLWLLFKKYFIRILNMTIIGATLAAI-
B1YMM6      ----------------------MNET---ISLQELFSTLRKSLWRILALTIVAALISFA-
D4LG05      ---------------MNQKDMNDEME---IDLLDLAYMLMDHWHHLLLCLLAGALALNA-
D4LTH3      ---------------MNQKEQNEEME---IDLLDLAYMLLDNWHYLLICLLAGALLLNA-
F3ATF6      ----------------MEKTHDEEMA---IDLWELISALKKRALIILAACLLGGVVAGV-
E0I7B6      -----------------------------MELKEYIQTVMKRKWLIISIVLVACILSGI-
C9LAS2      -------------MMENT--REDELE---IDLKQIFYVLKEKILVILAVGLLFGCLSCV-
F7K8E8      -------MENTKGMEKDTVQQTDEIE---IDLWEICLVLIHNLALIISVGIMAALVAFL-
F7K9V0      -------------MEENTMQQTDEIE---IDLWEICLVLVHNLALIVSVGIMTALGTFL-
F7KL97      -------------MEENTIRQTDEIE---IDLWEICLVLIHNLALIVSVGIMVALGAFL-
D3FZP5      ----------------------MEET---ISLRELYETLKKRIIMIITITVLAVATSGV-
C0ZHV9      ----------------------MNEE---LNLREILLMLLKRWKLILLITSLCTIGTAL-
D7WMM9      ----------------------MKET---ITLQDMLKIVRENFLFIISFTLFAALVTAF-
A8U9F5      ----------------------MEEE---ISLSELFATLKKRLTLIVSLGLIGLIVAAG-
F4BSE0      ----------------------MEEE---ISLSELFATLKKRLSMVVSLSLIGLIVAAG-
E7RDR2      ----------------------MEET---ISLQDLFKTLKKRAGLIALMTILAITIAGV-
I0JRK5      ----------------------MEET---ISLKEIFEVLKKRLLLIIGLAAGAAIISTL-
G2TR26      ----------------------MEDT---ISLKELMQVLRKRLSMIALITLGAMIVTAI-
D5DBK2      ----------------------MEET---ISLRVFFQVLRKRLWLIALITVIAATISAV-
D5DY80      ----------------------MEET---ISLRELFAVLRKRLWLIVLITIVAATVSAV-
A7Z9K1      ----------------------MGES---TSIKEIFAILRKRLLFILIITAAASAAGGL-
I2CB17      ----------------------MGES---TSIKEIFAILRKRLLFILIITAAASAAGGL-
I2HW54      ----------------------MGES---TSIKEIFAILRKRLLFILIITAAASAAGGL-
G4P1M8      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
E0TTZ7      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
G4EQF2      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
P96715      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
I0F9R7      ----------------------MGES---TSLKEILSTLTKRILLIMIVTAAATAAGGL-
G9QKR5      ----------------------MEET---ISLRDLMETLKKRLRLIVLITVLAALISGL-
B5UQ74      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
B7HFH2      ----------------------MEET---ISLKELFHILRKRLGMILIIAFGAAIVSAI-
Q72XH7      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGVAIVSAI-
C2V4M3      ------------------MEELMEET---ISLKELFHILRKRLAMILVIAFGAAIVSAI-
C2YZB3      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2P8H2      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2Y451      ----------------------MEET---ISLKELFHILRKRLAMILVIAFGAAIVSAI-
C3EBC1      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C3H980      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2PN23      ------------------MEELMEET---ISLKELFHILKKRLAMILAITLIVAIVMAI-
B9IRQ7      ----------------------MEET---ISLKELFLILKKRLAMILIIAFGAAIVSAI-
A0RL71      ----------MLCANFRKLEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2XJI0      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
Q3EV65      ------------------MEELMEET---ISLKELFHIFKKRLAMILVIAFGAAIVSAI-
C2T8T7      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2RG50      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
Q814Y9      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
B3ZRD5      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
F0PU65      ----------------------MEET---ISLKELFHILKKRLAMILVITFGAAIVSAI-
Q6HB08      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2NQN7      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C3GRR1      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2ULR7      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C3GBJ9      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2WVG7      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
G9QCG2      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
C2QJY6      ----------------------MEET---ISLKELFYILKKRVAMILVIAFGAAIVSAI-
C2SSX9      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
B7IQS9      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGAAIVSAI-
A9VRC4      ----------------------MEET---ISLKELFYILKKRLAMILVIAFGAAIVSAI-
C2MTG4      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGAAIISAI-
B7HXB5      ----------------------MEET---ISLKELFHILKKRLAMILVIAFGVAIVSAI-
C2SBU5      ------------------MEELMEET---ISLKELFHILKKRLAMILVIAFGVAIVSAI-
Q2BFS6      ----------------------MEET---ISLKELFQTLRKRLGLILSIAFVAVATSGL-
I3EBB4      ----------------------MEET---ISLRELFMTLRKRLSLILIVTLMSVMVSGV-
A4ITF4      ----------------------MEET---ISLRELFETLRKRLWLIVLITALATVVSGV-
C5D962      ----------------------MEET---ISLRELFETLRKRLMLIVLITALATIISGV-
G8MZ94      ----------------------MEET---ISLRELFDTLRKRLWLIVLITALATVVSGV-
Q5KUM4      ----------------------MEET---ISLRELFDTLRKRLWLIVLITALATVVSGV-
G5SDT9      ----------MTEKAKQSAAVTGSDE---IDIGRLVGTVIEARWWVLGTTAIFALCAVI-
G5LQM7      ----------MTEKVKQSAAATGSDE---IDIGRLVGTVIEARWWVLGTTAIFALCAVI-
G5Q4J1      ----------MTEKVKQSAAVTGSDE---IDIGRLVGTVIEARWWVLGTTAIFALCAVI-
G2Z8Q4      ----------------------MEKT---LDIKYIGQFFKKYWYIIVAACVVGMIAIAF-
D9ST43      --------------------MEEERA---LVLGDFIRIFKKQIKLILLITILSTFLAGI-
H7F5T7      ----------------------MSQK---FNLIEIWTILFRHKWSLIIMGILGASLSLC-
G9WIR0      ----------------------MDTT---ISYQRLWELFKKNFFLLIISALVLAAVAYA-
D3LB11      ----------------------MDTT---ISYQRLWQLFKKNFFFMLVSALIFALMAFA-
A0NKF7      ----------------------MDTA---ISYQRLWELFKKNFFFMLFSALFFTAITFA-
Q04DV7      ----------------------MDTA---ISYQRLWELFKKNFFFMLFSALFFTAIAFA-
F6BI63      ---------------------MSEEE---IDLKEILEILRKRWWLILIITVAAVVMSGI-
G2MWC1      ---------------------MAEEE---IDLREIFLIMRKRAKVIVIITLLAMIVSGI-
B0K4N2      ---------------------MAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
C7ISF8      ---------------------MAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
B0KAR6      ---------MYTKERIKGGLKIAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
E8UV30      ---------MYTKERIKGGLKIAEEE---IDLREIFLIIRKRTKMIVIITLLATIISGI-
C0GGR6      ----------------------MEQE---IEIREIVAIVSKRWKAILALFIFAVATSLV-
A4J8V1      ------------MNDDKIESRDDFEV---IDLRDIWRIIKKGKWILISLPLIAMLTSGI-
C8VYQ7      -----------------------------MELRDILGILKKGKWFLIILPIAAMLTSGI-
C8W5K3      ------------------------ME---LEIKDIIRILKKGKLLLLILPFIAVLTSGI-
B1BNH4      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
B1V1Z3      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
B1R3V2      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
Q0SVR9      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
Q8XN47      ---------------------MEENT---ISLQEIAYALKKRWKLIALITIAATLVSAI-
G7M0Q2      ---------------------MNEDV---IRVQDLLKTLKKRWKLICIITIITVIISAA-
G7M565      ---------------------MNKDV---IKIEDIVNILIKRWKMILGITLIATALSAI-
A6M2M0      --------------------MMNNDI---IRIDEIANPIIKRWKMILLVTLVTTLLALI-
G7M1R8      --------------MNSEEIIKNEES---IRIEEIIDILMKRWKMIVSITLTATILAGL-
A5V0I4      --------------MQLSD----------------YLAVLRRRWWVILLTMVVAVASAL-
A7NQ70      --------------MQLSD----------------YLAVLRRRWWIILLTTVVAVASAL-
Q4JZ56      -----------------MN--NRIVD---ISLFDLLNVLWLRKWIIVFVSFVFGCISFL-
Q7X554      --------------------------------------------LVLFIAFYFVAFSFL-
Q7X550      --------------------------------------------LILFTAFYVAVFSFL-
Q7X562      --------------------------------------------LVLFTAFYFAAFSFL-
Q7X556      --------------------------------------------LVLFTAFYVAAFSFL-
Q7X552      --------------------------------------------LILFTAFYFAVFSFL-
Q7X558      --------------------------------------------LILFTAFYFAAFSFL-
C5NWJ9      --------------MDNQE--KDLIQ---LDIMLLLRRIWEKKVLIVLVTLLFTAASLA-
F3A498      --------------MDNQE--KDLIQ---LDIMLLLRRIWEKKILIVLVTLLFTAVSLA-
Q9AHD3      ---------------MMKE--QNTIE---IDVFQLVKSLWKRKLMILIVALVTGAGAFA-
Q4K2E2      ---------------MMKE--QNTME---IDVIQLLNTLWKRKLIIALVAIVTGAIAFA-
Q4K2F8      ---------------MMKE--QNTME---IDVFQLLNTLWKRKLIIALVAIVTGAIAFS-
Q4K046      ---------------MMKE--QNTTE---IDVFQLVKTLWKRKLMILLVALVTGAGAFV-
Q4K0R8      ---------------MMKE--QNTIE---IDVFQLLKTLWKRRLMILLVALVTGAGAFA-
Q4JYY0      ---------------MMKE--QNTIE---IDVFQLVKILWKRKLMILLVALVTGAGAFA-
Q4JZW8      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
I0J9C8      ---------------MMKE--QNMIE---IDVFQLVKTLWKRKLMILIVALVTGAGAFA-
Q4K0M4      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILIVALVTGAGAFA-
Q4JZS4      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4JZK2      ---------------MMKE--QNMIE---IDVFQLFKTLWKRKLIILIVALVTGAGAFA-
Q9AHA5      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q9X9A0      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4JYK9      ---------------MMKE--QNMIE---IDVFQLFKILWKRKLMILIVALVTGAGAFA-
Q4K006      ---------------MMKE--QNMIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4JZG8      ---------------MMKE--QNTTE---IDVFQLVKTLWKRKLMILLVALVTGAGAFA-
A6YIA7      ---------------MMKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
E5F5C4      ---------------MMKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
Q9AHB8      ---------------MMKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
Q4JZL8      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLMILIVALVTGAGAFA-
Q4K1B8      ---------------MMKE--QNTIE---IDVFQLLKTLWKRKLMILIVALVTGAGAFA-
Q8VU32      ---------------MMKE--QNTIE---IDVFQVLKTLWKHKLIILLVALVTGAGAFA-
D2ERX9      ---------------MMKE--QNTIE---IDVFQLFKTLWKRKLIILLVALVTGAGAFA-
G6C7Z0      ---------------MMKE--QNTIE---IDVFQLLKTLWKRKLIILLVALVTGAGAFA-
Q4K2A9      ---------------MMKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
D6ZQI7      ---------------MMKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
Q9ZFT9      ---------------MMKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
Q4K255      ---------------MMKE--QNTIE---IDVFQSLKTLWKHKLIILLVALVTGAVAFA-
F9HJP7      ---------------MNQE--NQMVE---IDIVSLLKIIWQRKFFIVLTALMTAILALG-
E8JWI4      ---------------MNQE--NQMIE---IDVLSLLKTIWKRKFLIILTALLTGILALG-
A8AZR4      ---------------MNKE--NQLVE---IDVLSLIKTVWKRKFIILLTALVAAVLALG-
D0RXH3      ---------------MNKE--NQLVE---IDVLSLIKTVWKRKFIILLTALVVAVLALG-
Q83YR6      ---------------MNKE--NQLVE---IDVLSLIKTVWKRKFIILLTALVAAVLALG-
F1Z125      --------------MNNME--KPTME---IDVLSLLKKLWTKKFLIIFMALFFGTLALL-
Q3K0S9      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
P0C0T8      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
Q67AY5      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
Q04662      --------------MNKIA--NTEVE---INIFNLLKKLWKKKFLITFVAIAFATAGLF-
Q8GP93      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFCFAAFSFL-
Q8GPF7      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFCFAAFSFL-
E3CP61      --------------MTQEN--TKRVE---IDVLALLHKLWSKKVFILFTAFYVAVFAFL-
E8KUY7      --------------MTQEN--TKRVE---IDVLALLHKLWSKKVFILFTAFYVAVFAFL-
C2LSE5      --------------MTQEN--TKRVE---IDVLALLHKLWTKKVFILFTAFYVAVFAFL-
E9DM16      --------------MTQEN--TKRVE---IDVLALLQKLWTKKVFVLFTAFYVAVFAFL-
I0QIK5      --------------MTQEN--TKRVE---IDVLALLQKLWTKKVFILFTAFYVAVFAFL-
Q7X560      ---------------------------------------------ILFTAFYVAAFSFL-
Q8GMA6      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
Q55204      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
Q8GPC4      --------------MNQDN--TKSVE---IDVLALLQKLWTKKVFILFTAFYVAAFSFL-
Q8GPA9      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
G6ERT2      --------------MNQDNTKTKSVE---IDILALLHKLWTKKLLILFIAFYFAAFSFL-
O87930      --------------MNQDNTKTKSVE---IDILALLHKLWTKKLLILFIAFYFAAFSFL-
Q8GP55      --------------MNQDN--TKSDE---IDVLALLHKLWTKKLLILFTAFYFAVFSFL-
F8HDC4      --------------MNQDN--TKSVE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
F8LJ76      --------------MNQDN--TKSVE---IDVLALLHKLWTKKLLILFTAFYFAAFSFL-
F8LXJ5      --------------MNQDN--TKSVE---IDVLALLQKLWTKKVFILFTAFYVAAFSFL-
Q1WCR2      --------------MNQDN--TKSVE---IDVLALLHKLWTKELLILFTAFYFAVFSFL-
G3G7C0      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFFILLMGLLGAGLAFA-
G3G7J8      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFFILLMGPLGAGLAFA-
G7SNU7      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
G8DU30      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
A4VTU2      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
D5AGQ4      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
Q9X4U6      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
G3G7G5      --------------MNNQE--VNAIE---IDVLFLLKTIWRKKFLILLTAVLTAGLAFV-
G7SG35      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G8DU06      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G8DUA9      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G8DTY9      --------------MNNQE--SNTIE---IDVLSLLKTIWRKKFFILVTAVLGAGLAFV-
G3G7I7      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFLIIITALFGAGIAFV-
G3G7J3      --------------MNNQE--MNTIE---IDILLLLKTIWRKKFLIIITALFGAGIAFV-
E0PD82      --------------MNSND--QASIE---IDVFYLLRKLWSKKFFIIFIALVVGTVALL-
F5X651      --------------MNSND--QASIE---IDVFYLLRKLWSKKFFIIFIALVVGTVALL-
G5JTD6      --------------MTSAE--NASFE---IDVFALLKKLWNRKFLIIFVALLFGFVTLF-
Q2KM75      --------------MNTSE--NTSIE---IDILSLLKRIWQKKVVILFVTLLAGFLALV-
G5KAJ3      --------------MNNTE--QSSIE---IDVLSLLKKLWNKKFLILFMGLFVGTLALM-
B9DUJ5      --------------MNTTE--TPSME---IDVLSLLKKLWMKKFLILFMALFFGTLALL-
G5KD12      --------------MNTNE--TPSIA---IDVLSLLKKLWMKKTLILFMAIFVGVLTLL-
E8JMT8      --------------MNSND--NASIE---IDVLYLLRKLWSRKFFIIFIALVVGTVALL-
F5X0J8      --------------MNSND--NASIE---IDVLYLLRKLWSRKFFIIFIALVVGTVALL-
H2A601      --------------MNSND--NASIE---IDVLYLLRKLWSRKFFIIFIALVVGTVALL-
E7S8W2      --------------MKNQE--SQEIE---LDVVSLFKTLWRRKFSIIITALLFAIGALG-
F8DFF5      --------------MNNQE--NQAVE---IDVFATLKVLWKRKFSIILVALVFAIAAFG-
I1ZPH8      --------------MNNQE--NQAVE---IDVFATLKVLWKRKFSIILVALVFAIAAFG-
E3CBR9      --------------MNNKE--NQAVE---IDVFAMLKTLWKRKFSIVLVALVFAIAAFG-
E8K787      --------------MNNQE--NQAVE---IDVFAMLKTLWKRKFSIVLVALVFAIAAFG-
F9M365      --------------MNNQE--NQAVE---IDVFAMLKTLWKRKFSIVLVALVFAIAAFG-
A3CQY3      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
E8KLZ0      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0FHA9      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0FQQ4      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0I4H6      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0IAY2      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0IJI1      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F0IS52      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F2C9N1      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F2CH54      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F3UDW8      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F3UNJ5      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F3SM33      --------------MEKQE--KQIVE---IDILSLLRALWLKKFTIVLGAVLFSLLAFG-
F9HC66      ----------------MKE--NKEIG---IDVVQLFKILWKKKLAIILTAVVTALLAFG-
E1LQJ6      ----------------MKE--NKEIM---IDVFQLFKVLWKKKIAIILTAIVAAVIAFG-
Q4JYU0      ----------------MKE--NKEIT---IDVFQLFKVLWKKKTSIILTAIVAAVLAFA-
Q4JZY2      ----------------MKE--NKEIT---IDVFQLFKVLWKKKTSIILTAIVAAVLAFA-
F9Q346      ----------------MKE--QNMME---IDVFQLLKILWKRKVLIALVAIVTGVVAFA-
Q6L5R1      ----------------MKE--QNMME---IDVFQLLKILWKRKVLIALVAIVTGVVAFA-
E9FEC6      ----------------MKE--QNMME---IDVFHLLKILWKRKFLIALVAFVTGTVAFA-
E0Q2S9      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFA-
F5VSH0      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFA-
A5YTV6      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFS-
Q6L5T1      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGTVAFA-
E0PPH8      ----------------MKE--KNVME---IDVFHLLKILWKRKLLIVLVAFVTGAVAFA-
A5YTT8      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGTVAFA-
E6KKR9      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGIVAFA-
A1ILY0      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGIVAFA-
F2QF91      ----------------MKE--QNMME---IDVFHLLKILWKRKLLIALVAFVTGTVAFA-
Q4K0I3      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
Q8KWQ1      ----------------MKE--QNTIE---IDVFQLFKTLWKRKLMILIVALVTGAGAFA-
Q4K238      ----------------MKE--QNTIE---IDVFQSLKTLWKYKLIILLVALVTGAGAFA-
B1I966      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
G6J8A3      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
G6LKG4      ----------------MKE--QNTIE---IDVFQLLKTLWKHKLIILLVALVTGAGAFA-
F9LZC3      ----------------MKE--QNTIE---IDVFQLFKTLWKRKLIILLVALVTGAGAFA-
F9P1W9      ----------------MKE--QNTIE---IDVFQLLKTLWKRKLIILLVALVTGAGAFA-
A5LJR9      ----------------MKE--QNTIE---IDVFQLFKTLWQRKLMILLVALVTSAGAFA-
Q9ZII7      ----------------MKE--QNTIE---IDVFQLFKTLWKRKLMILLVALVTGAGAFA-
Q4K1K7      ----------------MEE--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
E1LPE6      ----------------MKD--QNTLE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
F9MJW6      ----------------MKD--QNTLE---IDVFQLFRTLWKRKLVILLVTIITSSVAFA-
Q4K0V3      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q54519      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
C1CBD0      ----------------MEK--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
Q7WVX1      ----------------MEK--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
Q4K0E2      ----------------MQD--QNTLE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
Q9AH96      ----------------MQD--QNALE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
A5M4L2      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
B2ILP4      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
C1CCB8      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
P72511      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
Q4K1S8      ----------------MKE--QNTLE---IDVLQLSRALWKRKLVILLVAIITSSVAFA-
P96474      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q4K196      ----------------MKE--QNTLE---IDGLQLFRALWKRKLVILLVAIITSSVAFT-
Q4K0Z7      ----------------MKE--QNTLE---IDVLQLFRSLWKRKLVILLVAIITSSVAFA-
Q4JZ85      ----------------MKE--QNTLE---IDVLQLFRILWKRKLVILLVAIITSSVAFA-
Q4JYH6      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q4JZ19      ----------------MQD--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
Q4K0A1      ----------------MQD--QNTLE---IDVFQLFRALWKRKLVILLVAIITSSVAFA-
Q4K1M5      ----------------MKE--HNTLE---IDILQLFRALWKRKLVILLVAIITSSVAFA-
Q4K2Q8      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFV-
Q4K1G0      ----------------MKE--QNTLE---IDVLQLFRVLWKRKLVILLVAIITSSVAFA-
Q4K0T6      ----------------MKE--QNTLE---IDVLQLFRTLWKRKLVILLVAIITSSVAFA-
Q4K0K3      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFT-
Q4K0X6      ----------------MKE--QNTLE---IDVLQLFRALWKRKLVILLVAIITSSVAFA-
E8KDN1      ----------------MKE--QDKIE---IDVVQVLKVLWKRKLMIALVAIATGVLAFG-
F9PEU3      ----------------MKE--QEKFE---IDVFQLVKVLWKRKFLIVLAALVAGLAAFA-
E8K321      ----------------MKE--QDKIE---IDVLQLVKVLWKRKFLIALVALLAGITAFA-
F9PZP6      ----------------MKE--QDKFE---IDVFQLVKVIWKRKFLIVLTAIIAGLAAFA-
D6R2T7      --------------MEKKE--NQMME---IDVLSMLRTLWLKKFTIVLGAVVFALLALG-
F3UUQ1      --------------MEKKE--NQMME---IDVLSMLRTLWLKKFTIVLGAVVFALLALG-
E6IZC3      --------------MKNQD--NQTVE---IDVLSLVKTLWRRKFLIVVTAFVIAIIALG-
G6A746      --------------MKNQD--NQTVE---IDVLSLVKSLWRRKFLIVVTAFVMAIITLG-
B1V0N8      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFSA--
B1BNK2      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFSA--
B1R3X7      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFSA--
Q8XN77      ---------------------MEEKT---LDIQEILYALKKRYKLIIIIMLLPILFSA--
A3ICA4      --------------------MNEEM-----TIQSLVKVLQKRWFLILILMMLSIGIAVF-
B1HR40      --------------------MNEEM-----TIQSLVKVWQKRWFFILILMILSIGIAVF-
H1BJT0      -------------------MDEKEIK---LRLNDLIGIFKKHYKVILFCTLLCMVFLMV-
F8FCE3      --------------------------------------------------MITSLCTAL-
I0BSG5      ------------------------------------------------------MCTAL-
A8YPQ6      --------------------MESTL-----ELTKIKEVLQKNLKILIILPLLFLIISAI-
P95695      --------------------MESTL-----ELTKIKEVLQKNLKILIILPLLFLIISAI-
Q2G1K8      --------------------MESTL-----ELTKIKEVLQKNLKILIILPLLFLIISAI-
C5QNG5      --------------------MENTL-----DLMRVWEIIKKNWKLLVIIPLIFLILSAI-
Q4L9H8      --------------------MENKL-----DLSNIFKIIKKNWGIWLFIPIIFLLISLI-
Q2FUV1      --------------------MKEKF-----DLVKLLNILKKNIKLLLILPAICLVVSAA-
P39850      --------------------MESTI-----DLSELLGRVRKNMKLLIILPLLGLLISAI-
D7UYE3      --------------------MGDVV-----DLSKVLKVLKQNLKWIVIIPVVFLIIAMA-
Q4A121      --------------------MEETI-----DLNKLFAILKKNMKYLIILPIVFLVLSMM-
E3HB17      -----MFKKSRYEEDINTHWMEEDDE---IELMDLLFILIRRWKMIIAIAVPVIIIG---
C9AAE4      --------------------MNKEI-----NMKKLKQVLQQRIGWILMIISIPLLAMFL-
H7F6C7      --------------------MNEQI-----DLKKMLLAIRKNSWWLIGIIVVTILSMFI-
F0SX23      ------------------MPTQLYRE---FDLWKTLNVLWKKAWIIILGTGLSGAIALG-
Q38VG4      --------------------MEQTI-----NIEQIFGILRKYSRLIILSTVIFTLLAGI-
F2I4B6      --------------------MEEEI-----SLLDLWQIIKEHIYVIFISSLVGVLLAAA-
Q8RBS6      -------------------MMEEEL-----DLREVFLILRKRIKIILLITVLAMLVSGL-
D9SR42      -----------------------------MELKEYWYIIKKRLILIISFTLLCGAISGI-
D9SVC8      -----------------------------MDLHELLYIIKKRMVLMVSITLVIGASGWI-
E7RG09      --------------------MIETI-----SLREIYSILKNKIRLILAITIVIMIITAL-
D4G2E2      ----------------------------------------------MIVTAAATAAGGL-
Q8EME7      --------------------MEETI-----SLKEIFEVIKKRLLLIFTFILVAALAAAI-
D6Y035      --------------------MEESI-----SLKEIIDVLKKRLAMIVSITMIAVIAAAS-
Q5WBB3      --------------------MEETI-----SLKEIFQTLKQRWRLLVAIPFFAMLVSAI-
Q9K6Q9      --------------------MEETI-----SLKEMFQTIMRRLKLIIALPVLAVCLAGF-
Q97EP7      --------------------MEQGND---IDFTGFIDVLNKEKAMIALVTIFFVLFSAI-
Q97ER4      --------------------MEQEND---IDFTGIFEVLNKEKAMIAAVTIFFVLFSAI-
E4S7Y7      -----------------------------MEVKEYFLIIRKRIILIITTTILSSLIAAI-
E4Q5T6      -----------------------------MEIKEYILIIRKRLPLIVATTLISTFIAAI-
E4SDX3      -----------------------------MEIKEYILIIRKRLPLIVATTLISTLIAAI-
G2FWX3      --------------------MEEEI-----DLRQYWEVLKKRWKIIAMLPLIAALVSGI-
G7WJV2      --------------------MEEKL-----DLKQYWDMLRRRWIIVVALPLIAALTSGV-
G7W774      --------------------MEEEI-----DLRQYWEILRKRWIIVVVLPLIAALTSGI-
G2FM60      --------------------MEEEM-----ELRQYWDVLRKRWMIVVVIPLIAALTSGM-
H5XZD5      --------------------MEEKV-----DLRQYWGVLRKRWIIVVALPLIAALTSGV-
I4DBG9      --------------------MEEEI-----DLRQYLEVLGKRWLIIVAIPLIAAITSGV-
G2FWT7      --------------------MEEEI-----ELRQYWDMLRKRWMIVVVLPLIAALTSGI-
H5XZG8      --------------------MEEEI-----DLRQYWEMLRKRWIIVIVLPLIAALTSGV-
G0V448      --------------------MEQEMT---LDLRDLLEIIKKRWKMIFSVTTICILISAL-
A0PZ01      --------------------MEDEIT---LDLRDLFFVLRKRFKLIVSITLIATILSGI-
B1B737      --------------------MEDEIT---LDLRNLFFVLRKRFKLIIFITLIATILSGI-
                                                                        

G7EJX5      MVTLTLV-P-KYTATATLLIEAE-------------------------------------
G9RSY8      VSSFAMT-P-QYEASATLIVNSR-------------------------------------
F3CAY8      GYAILAT-P-VYQATAMIQIEPR-------------------------------------
I0UTA4      -FSFLAP-P-KYTAKSSVLVNPL-----------------------------VTDPAAGG
B7B948      LYLKWAP-K-VYTRTASVLI----KD----------DAKGGAMS--------ESAAFEDL
G8AU95      YVMQSLK-P-MYRATAMVQL----DSRRVELAEFKSVVSNLTPE--------APAVRSEV
G5IFS2      FTATMMK-P-VYTSSTMLYI----VN------KTTTLTSLTDLQL-------GSQLTKDY
F0G6H6      -YALCAR-P-VYRSDVLFQV----EQ------SPTDTKPASPTGDPSSMFDLKTDAATEI
F6CNF6      FFIL--P-P-VYEAQTLLLVVQATEK------QQVYQTPQGGLEG-------VVGSISRL
A3W0H6      IVALNQP-K-VFQATAVIQI----ET------PQVGSDLAGQTI--------ATDANQRL
A3K8W6      DYALMQQ-K-VYEATAVVQI----ED------ARVTSTATGTAAD-------ANEASRRL
Q0FMP1      WLALNQI-K-VYEATAVVQI----EE------GQMPDSLAGASAQ-------NQDGSRRV
S9QRP2      WVALNQD-K-AYEATAVVQI----EE------ARVPERLTGGAAQ-------NADAARRV
D0D9W1      WVAFNQT-K-VYETTAVVQI----EE------GQVPDSLAGPSAQ-------GQDASRRV
I1AYC4      YIATQQV-K-TYETTAVVQI----EE------SQVPDTLAGSAAQ-------SQDAARRV
E9TE87      VYTFFAT-P-IYSADALVQI----EQ--NSGNSLVQDIGSALAN--------KPPASDAE
E6PYQ4      MWAHFQP-S-LYDATAMIHL----DQ--------HSSISLGPSG--------ATGDEYGL
C0QCJ1      YLALTSP-R-TYMAETSILV----QA------QTVPGNYVKSIV--------SSGISSRI
I5B297      GMTLTAN-K-TYEAGTMILV----QP------QRVPINYIKSVV--------SSSIGERI
B8D0N1      ILTSYKP-A-VFQSDALLMI----DE--------TPTTLNQIEL--------SPFNNNNR
D9QTC7      VASSLMT-K-IYQTSALVMV----KEDKGMENLFSEQMGALGSL--------AGSTSNKL
C7LPS4      ITSYVLP-R-KYEAQSTVFI----EQ------SVISELVKGIAT--------TPSMEAKI
Q314L4      GFAYSLP-K-IYQAKSTVAI----EQ------NVINDLVRGIAI--------TPSMGAKI
G0VNK5      AYLCIAS-P-VYQSTSLLRI----KQDKGLGDSIMSQVSGGNTL--------DD--KQRM
D2RIR1      AYLLIVP-N-TYQSTALLRI----KQERGLSSSIMEQLPIGNAQ--------LT--KQQM
I0GRR3      AYLLITP-P-TYQSTSLLRI----KQEKGLGDSILSSVA-GNAG--------MT--TQRM
Q39U16      WGSFFLP-K-KYEASSTVFI----EK------SVIKDLVKGITF--------TPSVEDKV
F0JCB9      VTSYVLP-K-KYEAKSIVFI----EQ------NVISDLVKGIAV--------TPSMDTKI
G7QCG0      AVGYLSP-K-KYEAKSTIFI----EQ------NVITDLVKGIAI--------SPSMQQKI
I2Q342      AVAYLSP-K-KYEAKSTIFI----EQ------NVITDLVKGIAI--------SPSMQQKI
Q74BQ7      VYSYVLP-K-KYEARSTVFI----EK------NVISELVKGIAV--------TPSMEQAI
B5EA80      VVSFVLP-R-KYEASSTVFI----EK------NVISELVKGITV--------TPSMEDTI
C6DZX6      VVSFVLP-R-KYQATSTVFI----EK------NVISELVKGITV--------TPSMEDTI
A1ARV9      VTSYVLP-K-KYEASSTVFI----EK------NVISELVKGITV--------TPSMEDTI
E8WSZ4      LVSYLLP-R-KYESSSTVFI----EK------NVISELVKGLAV--------TPSMDDTI
A5G425      IVSYFLP-R-KYEAKSTVFI----EK------SVISDLVKGIAI--------TPSMDEKI
B9M2X7      IVSYVLP-E-KYEAKCTVFI----EK------ALINELVRGFAV--------TPSMEDKI
C2MBF7      LYIKSSP-H-QYSRSASLLI-----KNETPMSSAMQQLAQFAGD--------KHAYSDDV
H8YYB8      ITAVVLP-P-TYRSTATILI----EQQEIPDELVRSTVTSYAAQ--------R---VQTI
E7T802      YSLLSTP---IYQADTLVQVEQK-------------------------------------
F4SM98      YALFATP---IYQADALLQVEQK-------------------------------------
C4Z673      YSFFVIT-P-QYESTTKVYILNK-------------QNASGSVT--------YSDVQLSS
E3H7M4      YSYYKAD---TYKAEVILMVSGS------------NLISPDRLE--------NSQVSLNQ
C2EWM2      VAEFVIT-P-QYTASTQILVNQK---------H----DNADGQA--------YNNQQADI
D0DSJ3      IATFVIP-A-KYTATTQILVNQR---------N---SNDNNGQA--------YNNQQADI
B2GF32      IATFVIP-A-KYTATTQILVNQR---------N---SNDNNGQA--------YNNQQADI
C0WW25      IATFVIP-A-KYTATTQILVNQR---------N---SNDNNGQA--------YTNQQADI
F8KGP2      VAQFVVV-P-KYTATTEILVNQK---------H---ENNDNGQA--------YNNQQADI
B3XL22      VAQFVVV-P-KYTATTEILVNQK---------H---ENNDNGQA--------YNNQQADI
F8DRU3      VAQFVVV-P-KYTATTEILVNQK---------H---ENNDNGQA--------YNNQQADI
B1MZT2      IAKFLIA-P-TYSASTSMLVNRS---------T--DNT-TGNAN--------LSDQQADV
H1WR07      IAKFLIA-P-TYSASTSMLVNRS---------T--DNT-QSGVN--------LSDQQADV
Q03W94      IAKFVIA-P-TYSASTSMLVNRS---------A--DDTSTATAN--------LSDQQADV
C2KHF2      VAKFVIA-P-TYSASTSMLVNRS---------A--DDTSTATAN--------LSDQQADV
H1X4N3      VAKFVIA-P-TYSASTSLLVNRS---------A--DDTSTATAN--------LSDQQADV
C2JZS0      GTKMLVA-P-KYQSSTSMLVNRK---------Q----DNNPNMQ--------LNAQQADI
C1J9I2      GAKAFIA-P-KYESDTSLLVNRK---------Q----DNDPNMQ--------LNAQQADI
Q58Z11      GAKTFIA-P-KYSASTSMLVNRK---------Q----DNNPNMQ--------LNAQQADI
F0K0J8      VSEYVLV-P-KYTASTQLLVNRK---------TADANHADANQA--------YANQQADI
G6F8H0      VSEYVLV-P-KYTSSTQLLVNRK---------T-----TDANQA--------YTNQQADI
Q1G8E3      VSEYVLV-P-KYTASTQLLVNRK---------T-----ADANQA--------YANQQADI
D8FLF7      VSEYVLV-P-KYTASTQLLVNRK---------S-----TDANQA--------YANQQADI
F0HVF2      VSEYVLV-P-KYTASTQLLVNRK---------T-----EDANQA--------YANQQADI
Q5FIC6      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNNDPNAA--------YATQQANM
E4SMV6      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNNDPNAA--------YATQQANM
F0TGY3      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNNDPNAA--------YATQQANM
F2M2M7      VSEFVIS-P-KYTSTAQLLVNQK---------S---RNNDPNAA--------YATQQANM
C4VP07      VSALIIQ-P-KYTAATQLLVNQK---------T---DKNDIGAA--------YTLQQANM
D6S4X3      VSSFMIQ-P-KYSASTQLLVNQK---------T---DEKNIGAA--------YTLQQANM
A4ZGZ7      IANFVIS-P-KYTSSAQILVNQK---------S---NKNDPNTA--------YITQQANM
C2EPK4      LAEFVVT-P-KYSSSAQILVNQK---------S---RNNDPNAA--------YVTQQANM
C7XKF2      VANFIIS-P-KYTSNAQILVNQK---------A---NKNDPNAA--------YNTQQANM
E3R265      VANFIIS-P-KYTSNAQILVNQK---------A---NKNDPNAA--------YNTQQANM
D0DJG9      VANFIIS-P-KYTSNAQILVNQK---------A---NKNDPNAA--------YNTQQANM
D5GZJ9      VANFIIS-P-KYTSNAQILVNQK---------A---NKNDPNAA--------YNTQQANM
A8YX90      IANFVIS-P-KYTSSAQILVNQK---------S---NKNDPNTA--------YITQQANM
F0NWJ8      LANFVIS-P-KYTSSAQILVNQK---------A---NKNDPNAA--------YATQQANM
C6CW36      KSSFYTT-P-IYEATAKLIVNQS-----------SGAYQQGYPD--------VGLLQSNL
A8SQS9      YAYFFIK-P-TYQSTAKLYVVSA-------SDDS-------IVN--------LQDLNIGS
D5HFS3      FAYFLIK-P-TYQSTAKLYVVSA-------SDDS-------IVN--------LQDLNIGS
A5Z5P8      WTKVGIT-P-KYTATAKVYMVSA---------SK--NSVV---D--------LADLSIGT
G2KUP2      ITYGVMR-P-KYTSTTDLLVNQK---------LSKSQAAI---Q--------SQQVQADV
G8PE07      VTFFIMT-P-KYSATTEILVNRK---------LPAEMQGA---Q--------FQQVQADV
E0NHP5      MTFFVMT-P-KYSATTQILVNRK---------LSDDMAGA---Q--------LQQTQADV
Q03GL9      MTFFVMT-P-KYSATTQILVNRK---------LSDDMAGA---Q--------LQQTQADV
C6CSC7      YTKMFKD-P-IYEASTKIVVNQP---------SQ--QLAVGQLD--------LNQINSNI
C6CS79      YSAWVMK-P-VYEAYTKLIVNST---------AG--QAGSFKLD--------LNMINTNL
F5LM70      VSKYYLK-P-VYQASTKLIVNSP---------AD--NQGMLRLD--------MNAINTNI
G0LYN8      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT---E--------YAGQQADI
F6ITB3      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT---E--------YAGQQADV
G0M1Y0      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT---E--------YAGQQADV
D7VC12      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT---E--------YVGQQADV
F9UMZ5      LTFFVIT-P-KYQSSVQILVNRK---------NT--NAAT---E--------YAGQQADV
D4JI68      ISRFMIT-P-MYESTSELYVLSK---------S---TSIT---S--------LADIQTGT
D6E329      ISRFMIT-P-MYESTSELYVLSK---------S---TSIT---S--------LADIQTGT
Q1AUN7      VGFGLLQTP-VYEASITILVGQK-------------SGEE---G--------PRNLSGDV
H4GK02      DAEFLVQ-P-KYTASTQILVNNK---------ENKVQAGQ---A--------YNNQQADV
F6IR92      VTLWVVK-P-QYQANVQILVNRK---------HS--SAGT---D--------LTGQQADV
G0M0G0      VTLWVVK-P-QYQANVQILVNRK---------HS--SAGT---D--------LTGQQADV
D7VBW5      VTLWVIQ-P-EYQANVQILVNRK---------HS--SAGA---D--------LTGQQADV
F9UQ55      VTLWVIQ-P-EYQANVQILVNRK---------HS--SAGA---D--------LTGQQADV
B9Y883      ITLFLIP-K-KYTAEAKLIIVQK-------SNPDS-----QQIS--------YNDLQTSQ
D4YHG8      VTFFLMT-P-KYTSTTDIVVNNA-------ATATT----ENTIT--------QSGLQANL
F7V793      ISYGLIT-P-KYAATSSLYMVSA-------DRNK-------VVD--------LTSLTAGS
C3WFM8      -FAITRP-T-VYQAETTLIVSNN--------------MSSVSLD--------SSDISLSQ
H7F1R6      YLYAFSV-P-TYQSETEVLINQS-------VPENT------VVQ--------SQDVQANL
H7F570      YLSFFST-P-IYRSSTEVLINQS-------VSENS------QVK--------SQDVQANL
C6LCS6      CSRVFIT-P-TYDSTTKIYVLNR-------QNSDA-----AAIT--------YSDLQSAT
A7VF43      CAYFLIK-P-TYQSTAKLYVVSA-------SEDS-------VVN--------LSDLNIGT
A7Z922      IQFRVIS-P-VYQASTQVLIHET-------SGEKN----SNL-----------SDVQLNL
I2CAF3      IQFRVIS-P-VYQSSTQVLIHET-------SGEKN----SNL-----------SDVQLNL
I2HVL3      IQFRVIS-P-VYQSSTQVLIHET-------SGEKN----SNL-----------SDVQLNL
E0U2Z4      AQFKVIS-P-TYQASTQVLVHES-------DGEEN----SNL-----------SDIQRNL
D4G1R3      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----SNL-----------SDIQRNL
G4EQZ6      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----SNL-----------SDIQRNL
P71050      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----SNL-----------SDIQRNL
G4P115      VQFKVIS-P-TYQASTQVLVHES-------DGEEN----SNL-----------SDIQRNL
A8FHM0      YQFYVST-P-VYQATTQILVHKR-------SNDAQ----ANL-----------NDIQMNL
C0EBA5      ITKFLMT-P-MYTSSATMYVNNK-------TKTDN----VDIIS--------GSDLVTSQ
F4FXQ8      LEKFVIT-P-QFTSTAQILVNQK-------KDTSV-----PGAA--------FQDQQADV
C0WV34      LEKFVIT-P-QFTSTAQILVNQK-------KDTSV-----PGAA--------FQDQQADV
H1LCW2      LEKFVIT-P-QFTSTAQILVNQK-------KDTSV-----PRAA--------FQDQQADV
B7BDT7      VYLLTTP-P-VYTRSASLLIKEDSKGNSLGDAAGL------MGD--------FDLFQTNT
H6LKR9      GTAKLIT-P-IYEAKTVLYIGRE-------NSGLG----TIDVS--------LGQLEADS
F5LE49      ISYFFID-K-QYAASTKLVVNKS-------SSYQG----YDILD--------YNAVNTNI
F3AHH1      GTKLFMT-P-QYQSVTKMYVLSK-------QDNAT-------LT--------SMDMQTST
F3Y921      MTFFMIT-P-KYSSQAQLIVRLP-------QTTNA------N----------SNEVSANL
G4L593      VTFFIMT-P-QYNSRAQMIVALP-------QDENS------DES--------LNTVNYNL
E6LD65      VTFFIVT-P-KYSSQAQLVVTLP-------QSDST------N----------VNDVNSNL
C9ALZ8      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA------N----------VNDVNTNL
C9BUG6      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA------N----------VNDVNTNL
Q3XYS7      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA------N----------VNEVNTNL
C9B453      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA------N----------VNDVNTNL
D4RJF5      VTFFILT-P-KYSSQAQLIVTLP-------QSDTA------N----------VNDVNTNL
F0EKB8      FTFFVIT-P-KYSSQAQLIVTLP-------QSETT------N----------ANDVNTNL
C9A6V4      FTFFVIT-P-KYSSQAQLIVTLP-------QSETT------N----------ANDVNTNL
C9CHY7      FTFFVIT-P-KYSSQAQLIVTLP-------QSETT------N----------ANDVNTNL
C8ZXT8      ATFFVIT-P-KYSSQAQLIVTLP-------QSETT------N----------VNDVNTNL
G5IRQ5      ATFFVIT-P-KYSSQAQLIVTLP-------QSETA------N----------VNDVNTNL
E6UHY5      YAKFVLP-L-QYTASIKIYVTNG--KTGDQDNDDN------LIN--------AQDLNTAR
E9SAU2      YAKFVLP-L-QYTSSIKIYVTNGVRNSHDDDDENE------LIN--------GADINTAR
F7K0U2      VTKLFMT-P-VYTSTTKMYVLSK-------QDANS------AVT--------SSDLQAGS
O06029      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGEVTGNI
G8P3D6      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
A9QSJ3      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
F9VC43      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
G6FD41      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
G9M881      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
Q3ZK51      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
Q83VG0      YTFFIAS-P-VYTASTQLVVKLP-------NSDNS------AAY--------AGQVTGNI
C6LDI9      VTKILIT-P-MYSSSSMIYI--V-------GDSLD------VSF--------LVNMEVGT
G5F9H3      YSKFLIT-P-QYKSEAKLYV--L-------SKETT------LTS--------LADLQIGS
C0CZV8      FSAFVLT-P-QYTSTAMVYI--L-------SKETT------LTS--------LADLQIGS
G5GFW1      YSYFILS-P-QYTSTAMLYV--F-------SKETT------LTS--------LADLQIGS
I5AV00      YVNAKYA-P-YYTSSTKLYVMPK-------SSTGN--------L--------NSDLQAGA
H6NE44      VSVQYLP-R-VYQASVKLLINSE-------GKGNG-------VD--------ISSINTNL
F4BS20      LTNYVLI-P-RYSSTTQLLVSRQ-------DMNTQ------SIE--------LGEIETNI
E0RZL4      LSKFVIR-P-EYESTTKIYILNK-------EENQT-------VT--------YSDVQIST
C0CK72      FTFKIVE-P-MYGASSMIYMRGA-------GNT--------ISS--------LQDLQIGA
D9S1J8      YTFWIKK-P-VYESYTTIMVGKP-------VQRVQDS--SAPIT--------YQELQTNR
C2EFR7      YSKFAVV-P-QYTSVTKIYLSN-----------------KLTEN--------QTNPTPST
Q1WTC7      YSKFAVV-P-QYTSVTKIYLSN-----------------KLTEN--------QTNPTPST
B0P2G1      ITKFAMT-P-IYSSTAQLYVVSK----------------GGLSQ--------LTDLTMGS
D4MW28      ITKFAMT-P-IYSSTAQLYVVSK----------------GGLSQ--------LTDLTMGS
E5VMX9      ITKFAMT-P-IYSSTAQLYVVSK----------------GGFSQ--------LTDLTMGT
F2I6Z8      YNFLWAE-A-EYASQTQIVVTPK-------D--------SDKDK--------ADEKKAG-
E6U7N3      LAAWAIS-P-LYASSTMLVVNAN-------NNQNN----TTTIT--------NDQLTTAQ
C4Z8M6      ISRFMIT-P-MYESTSELYVLSK-------S--------TSITS--------LADIQTGT
D4JMC3      YSKITFV-P-EYEASAEMYVLTK-------S--------TSITS--------LADIQVGS
D6E0V3      YSKITFV-P-EYEASAEMYVLTK-------S--------TSITS--------LADIQVGS
E3GPC7      FTIFFMN-K-EYSSYTTLMIGKS-------EGYSDT---NANAN--------YNEVLTNQ
A6BIG6      ATKLFMT-P-VYTSVTKLYVMTK-------NGEN-----SSSAT--------YTELQSGS
C2CI43      LSSFIIT-P-KYDSNATMIVSNS-------TQNNDQNP-QANVD--------YGQIQANK
D4RX68      YFNFVVT-P-RYTSTARIMVINR-------QN-------SDSLT--------STDLNSST
D4J4T5      YTSFLVT-P-LYSASSMMYVMPD-------NSNS-----MNSST--------LSDMQVGQ
I5ASF9      ITKFVMT-P-MYTSSSMMIVLTK-------E--------TTIAS--------IADLQMGS
C0C0F9      GTKMFIT-P-MYSSTTKMYVLTK-------QDS------SAGVT--------YSDIQTGT
B6W7H3      ASVFVIT-P-KYEATTTMIVSNS--------KNEDPNQ-KGDVD--------INQINANR
C7RGH5      LSKFVIT-P-KYDSNTTMIVSNS-------NQNNDPNNPQTNVE--------LGQIQANK
F0GT82      YSNFVVT-P-SYNANATMIISSS-------SKNEDQQD-LADID--------FYQIQANK
F3AH93      YTQFCIA-P-TYTSTSSMLVLSK-------E--------TTLTS--------MADLQLGT
B0GAL4      YAGFLVK-P-LYTSSSMMLVLTK-------E--------TTLSS--------LADLQMGS
G1WUK1      YAGFLVK-P-LYTSSSMMLVLTK-------E--------TTLSS--------LADLQMGS
D4M2S1      VTKLFIT-P-VYSATATMLVLTK-------E--------TTLSS--------LADLQIGS
E7GL80      YSYYLLT-P-QYISEAKIYVLSK-------E--------TTLTS--------LADLQMGT
G5F9E3      YSYYLLT-P-QYISEAKIYVLSK-------E--------TTLTS--------LADLQMGT
D4CG07      YSKMILV-P-KYTSTAMMYVLSK-------E--------TTLTS--------LADLQIGS
D4MP31      YSKMILV-P-KYTSTAMMYVLSK-------E--------TTLTS--------LADLQIGS
G5HNC6      YSVMILN-P-VYTSTSMVYVLSK-------E--------TTLTS--------LADLQIGS
A8RK86      YSRLILT-P-VYTSTAMVYVLSK-------E--------TTLTS--------LADLQIGS
G5HTB1      YSKMILK-P-VYTSTSMVYVLSK-------E--------TTLTS--------LADLQIGS
A8RSL0      FSAFVLT-P-QYKSTAMVYILSK-------E--------TTLTS--------LADLQIGS
C5EN02      FSKFVLT-P-QYKSTAMVYILSK-------E--------TTLTS--------LADLQIGS
G5HG46      FSKFVLT-P-QFKSTAMVYILSK-------E--------TTLTS--------LADLQIGS
E7GL39      YSKFLIT-P-QYKSEAKLYVLSK-------E--------TTLTS--------LADLQIGS
E7GL56      GSAFLIT-P-QYKSEAKLYILSK-------E--------TTLTS--------LADLQIGS
G5F9B0      GSAFLIT-P-QYKSEAKLYILSK-------E--------TTLTS--------LADLQIGS
D3AC81      FTAMVMK-P-VYTSSTMLYIVNK-------TTT--------LTS--------LTDLQLGT
D3AE79      YTTTLVE-P-VYTSSTMIYILNK-------TNN--------ITS--------LSDLQLGT
D4YF14      VVMFFVE-P-QYSSQAQLIVNQR-------SSQDT------SIQ--------YNEIQTNV
B1YMM6      VSTFLIK-P-TYQAGTQILVTPK-------KQEND------VID--------ASQVQSSV
D4LG05      FAFFFIE-P-TYESTAKLYVVST-------SDDS-------VVN--------LNDLNLGT
D4LTH3      YSFFCIQ-P-TYQSTSKLYIVST-------SDDS-------VVN--------LNDLNLGT
F3ATF6      YTKLCIT-P-MYTATSSMLVTTQ-------ETT--------LTS--------IADLQLGS
E0I7B6      KGFFYTT-P-VYSASAKLVVNQS-------YEYNG----ISMLD--------YNLIQTNL
C9LAS2      ATKLLIT-P-TYTSTSSMLLLTD-------QGLET-------V----------SDVQMGT
F7K8E8      ATQLFGV-P-KYESTTKIYILNK-------QENNA-------VT--------YSDIQLGT
F7K9V0      ITQLFIT-P-KYESTTKIYILNK-------QENNA-------VT--------YSDIQLGT
F7KL97      VTQIFGV-P-KYESTTKIYILNK-------QENNS-------VT--------YSDIQLGT
D3FZP5      VSYFVLT-P-MYQSSTQILVSQQ-------AAGAA----SAALQ--------QAGFDVDS
C0ZHV9      VSFYLLT-P-IYQAKTEILVNRS-------LDSTV----ESMLS--------VAEIDSNL
D7WMM9      ISIFVLK-P-TYEAETQILVNQK-------NIEQP------HLG--------VQQVETDL
A8U9F5      FTFFIAT-P-QYNATTQILVNRT-------TESAE------GLQ--------LNDINSNV
F4BSE0      FTFFIAT-P-QYNATTQILVNRT-------TESTE------GLQ--------LNDINSNV
E7RDR2      VSFLVLT-P-MYQTSTQILVNQE-------QSEAA------QLT--------NQNIQTDL
I0JRK5      VTFFVLT-P-SYEASSQFIVNQS-------QSQSQ----DNIYE--------GNELQTNI
G2TR26      VTYFVMT-P-VYESSTQILVNKA-------SDDQT------MYT--------TNAVQTNV
D5DBK2      ISFFVLT-P-VYQTNTQILVNQA-------KSEQQ------LYN--------AGAVQTNV
D5DY80      ISFFVLT-P-VYQSKTQILVNQA-------KSDEQ------LYN--------MQAVQTNI
A7Z9K1      ISFFALT-P-VYENSTQILVSQS-------KNNQK------EVQ--------FNDVQTNL
I2CB17      ISFFALT-P-VYENSTQILVSQS-------KNNQK------EVQ--------FNDVQTNL
I2HW54      ISFFALT-P-VYENSTQILVSQS-------KNNQK------EVQ--------FNDVQTNL
G4P1M8      ISFFALT-P-IYENSTQILVNQS-------KNNQK------EVQ--------FNDVQTNL
E0TTZ7      ISFFALT-P-IYENSTQILVNQS-------KNDRK------EVQ--------FNDVQTNL
G4EQF2      ISFFALT-P-IYENSTQILVNQS-------KNERK------EVQ--------FNDVQTNL
P96715      ISFFALT-P-IYENSTQILVNQS-------KNERK------EVQ--------FNDVQTNL
I0F9R7      ISFFALT-P-IYENSTQILVNQS-------KNDRK------EVQ--------FNDVQTNL
G9QKR5      VSFFILT-P-IYQASTQLLVNQS-------KNDQQ------MYD--------FNQVQANL
B5UQ74      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------VIQ--------YNEVQTNI
B7HFH2      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT------ALQ--------IGEVQTNI
Q72XH7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------YNEVQTNV
C2V4M3      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------FNEVQTNI
C2YZB3      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------YNEVQTNI
C2P8H2      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------FNEVQTNI
C2Y451      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------YNEVQTNI
C3EBC1      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------AIQ--------FNEVQTNI
C3H980      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------YNEVQTNI
C2PN23      ISFFFMT-P-LYQSSTQILVNQK-------KQEGT------AIQ--------IGEIQSNI
B9IRQ7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT------AIQ--------LGEIQSNI
A0RL71      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------MFQ--------AGEVQTNI
C2XJI0      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------MFQ--------AGEVQTNI
Q3EV65      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MFQ--------AGEIQTNI
C2T8T7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------LGEIQSNI
C2RG50      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------LGEIQSNI
Q814Y9      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------LGEIQSNI
B3ZRD5      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------MFQ--------AGEVQTNI
F0PU65      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------MFQ--------AGEVQTNI
Q6HB08      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEVQTNI
C2NQN7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------MFQ--------AGEVQTNI
C3GRR1      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEVQTNI
C2ULR7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MFQ--------AGEIQTNI
C3GBJ9      ISFFFMT-P-IYQSATQILVNQK-------KQEGA------MFQ--------AGEVQTNI
C2WVG7      ISFFFMT-P-IYQSSTQILVNQK-------KQEGS------AIQ--------YNEVQTNI
G9QCG2      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT------AIQ--------LGEIQSNI
C2QJY6      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------AIQ--------YNEVQTNI
C2SSX9      ISFFFMT-P-IYQSSTQILVNQK-------KQEGT------AIQ--------YNEVQTNI
B7IQS9      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEIQTNI
A9VRC4      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEIQTNI
C2MTG4      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEVQTNI
B7HXB5      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEVQTNI
C2SBU5      ISFFFMT-P-IYQSSTQILVNQK-------KQEGA------MIQ--------AGEVQTNI
Q2BFS6      ISYFYLT-P-IYQSSTQLLVNQA-------KSDQP------VYN--------PGEIQTNL
I3EBB4      VSYFFLT-P-IYEASTQLLVNQA-------KNEQA------LYN--------YNEVQTNL
A4ITF4      VSYFLLT-P-IYQASTQILVNQA-------KSEQQ------MYN--------VGEIQTNL
C5D962      VSYFFLT-P-IYQASTQILVNQA-------KSEQQ------LYN--------YNEIQTNV
G8MZ94      VSYFILT-P-IYEASTQILVNQA-------KSEQQ------LYN--------FNEIQTNV
Q5KUM4      VSYFLLT-P-IYQSSTQILVNQA-------KSEQQ------LYN--------FNEIQTNV
G5SDT9      YT-FFAT-P-IYSADALVQIEQN------------AGNSLVQDI--------NSALANKP
G5LQM7      YT-FFAT-P-IYSADALVQIEQN------------AGNSLVQDI--------NSALANKP
G5Q4J1      YT-FFAT-P-IYSADALVQIEQN------------AGNSLVQDI--------NSALANKP
G2Z8Q4      YTSYFVT-P-IYQVSTDVLV---------------NQKKNEQVT--------VSDVQSNQ
D9ST43      LSFLIIE-P-TYEAKSTIVVGKA----------DRGSNDNPKYQ--------FDDIMMYK
H7F5T7      IALFVIT-P-SYQMQSQVLVVPS------------SKDQSGVSQ--------SAEVQANL
G9WIR0      GSRFLIH-P-KYQSTAAL-LVNR------------SNNTDPNAA--------LGNQQADI
D3LB11      VCKFVIT-P-QYQSTTAL-LVNR------------SQDDTAATA--------LNDQQADV
A0NKF7      ACKFVIA-P-KYQSTAAL-LVNR------------SQDDTAATA--------LNDQQADV
Q04DV7      TCKFVIA-P-KYQSTAAL-LVNR------------SQDDTAATA--------LNDQQADV
F6BI63      LSFYVIK-P-TYQASTSLIVSKS----------QTAQYNNGQIQ--------FQDVQTNR
G2MWC1      FSYFIAT-P-VYKASTSLIVSRT----------QSSVLTNSQIQ--------VQDIQTSR
B0K4N2      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNNSQIQ--------VQDIQTSR
C7ISF8      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNNSQIQ--------VQDIQTSR
B0KAR6      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNNSQIQ--------VQDIQTSR
E8UV30      FSYFIAT-P-VYKASTSLIVSRT----------QSSALNNSQIQ--------VQDIQTSR
C0GGR6      ASLYFIQ-P-VYESSATLLVGKP--------------TEGTQVV--------IQDVQLNR
A4J8V1      ISFFVLT-P-RYEASTTLMVGKT-----------YSGQDAMMLQ--------YNDILTAN
C8VYQ7      VSYFLIT-P-IYKSSTTLMVGKT-----------YAGENGPLLQ--------YNDILTAN
C8W5K3      ISYYFLT-P-VYSATATILVNNK------------SQRIMGGLD--------YQDIMLST
B1BNH4      LSFFVIK-P-QYEATTKLFIGKQ-----------E-SQDNNAYN--------NNDVMMYQ
B1V1Z3      LSFFVIK-P-QYEATTKLFIGKQ-----------E-SQDNNAYN--------NNDVMMYQ
B1R3V2      LSFFVIK-P-QYEATTKLFIGKQ-----------E-SQDNNAYN--------NNDVMMYQ
Q0SVR9      LSFFVIK-P-QYEAKTKLFIGKQ-----------ETSQNAANYD--------NNDIMMYQ
Q8XN47      LSFFVIK-P-QYEAKTKLFIGKQ-----------ETTQENASYN--------NNDVMMYQ
G7M0Q2      LSFLVIS-P-KYETSTKVFIGKE--------GSVIKDLPDQNYN--------GNDVEMYQ
G7M565      ISIFIIS-P-KYEASTKVFIGKE----------LNAQGQEQSYD--------TNDVQMYQ
A6M2M0      ISYFIIP-P-KYEANTKVFIGKE-----------NTTGQDQNYS--------TNDVQMYQ
G7M1R8      VSFFVIA-P-KYESNTKVFIGKE-----------NTNSKDQSYN--------SSDVQMYQ
A5V0I4      IFSRLQE-R-IYRSEASYLVVPN------------RIDNGLSIV--------LQNS----
A7NQ70      IFSRLQE-R-VYRSEASYLVVPN------------RIDNGLSIV--------LQNS----
Q4JZ56      YYQFFVP-K-TYTSDTRIYVVSK--------------GDNKNLS--------NADLQAGS
Q7X554      GTYFFIQ-P-TYTSPTRIYVANQ------------ATDDNN-LS--------AQDLQAGT
Q7X550      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGA
Q7X562      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNKN-LS--------AEDLQAGT
Q7X556      LTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q7X552      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNKN-LS--------AQDLQAGT
Q7X558      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
C5NWJ9      YSIFLVT-P-QYSSTTKVYVVNQ------------KKDDKA-IT--------TQDVQLGS
F3A498      YSIFLVT-P-QYSSTTKVYVVNQ------------KKDDKA-IT--------TQDVQLGS
Q9AHD3      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
Q4K2E2      YSSFIIK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGS
Q4K2F8      YSSFIIK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGS
Q4K046      YSTFIVR-P-EYTSVTRIYIVNR------------NQGDKAGLT--------NQDLQAGT
Q4K0R8      YSTFVVK-P-EYTSTTRIYVVNR------------NQEDKPGLT--------NQDLQAGT
Q4JYY0      YSTFIVK-P-EYTSTTRIYVVNR------------NQEDKPGLT--------NQDLQAGT
Q4JZW8      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDKSGLT--------NQDLQAGT
I0J9C8      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDKPGLT--------NQDLQAGS
Q4K0M4      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDKPGLT--------NQDLQAGS
Q4JZS4      YSAFIVK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGS
Q4JZK2      YSTFIVK-P-EYTSTTRIYVVNR------------DQGDKPGLT--------NQDLQAGS
Q9AHA5      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGS
Q9X9A0      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGS
Q4JYK9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKLGLT--------NQDLQAGS
Q4K006      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDNPGLT--------NQDLQAGS
Q4JZG8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
A6YIA7      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
E5F5C4      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGT
Q9AHB8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
Q4JZL8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
Q4K1B8      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
Q8VU32      YSTFIVK-P-EYTSTTRIYVVNR------------NQEGKSGLT--------NQDLQAGT
D2ERX9      YSAFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
G6C7Z0      YSTFIVN-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
Q4K2A9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
D6ZQI7      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
Q9ZFT9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
Q4K255      YSTFIVK-P-EYMSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGA
F9HJP7      YSVFIAK-P-SYQSTTRIYVVSR------------QQSDNNALT--------NQDLQAGA
E8JWI4      YSVFIAK-P-AYKSTTRIYVVNR------------QQGENPTLT--------NQDLQAGS
A8AZR4      YSLFIAK-P-SYQSTTRIYVVNR------------QQTDNNTLT--------NQDLQAGS
D0RXH3      YSLFIAK-P-SYQSTTRIYVVNR------------QQTDNNTLT--------NQDLQAGS
Q83YR6      YSLFIAK-P-SYQSTTRIYVVNR------------QQTDNNTLT--------NQDLQAGS
F1Z125      SSIFLIK-P-SYTASTRIYVLNK------------TQQADN-LS--------ATDLQAGG
Q3K0S9      YSLFIVT-P-QYTSSTRIYVINP------------NTPNNS-IT--------AQDLQAGS
P0C0T8      YSLFIVT-P-QYTSSTRIYVINP------------NTPNNS-IT--------AQDLQAGS
Q67AY5      YSLFIVT-P-QYTSSTRIYVINP------------NTPNNS-IT--------AQDLQAGS
Q04662      YSLFIVT-P-QYTSSTRIYVINP------------NTPNNS-IT--------AQDLQAGS
Q8GP93      GTYFFIQ-P-TYTSSTRIYVVNQ------------ANDSKN-LS--------AQDLQADT
Q8GPF7      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNKS-LS--------AQDLQAGT
E3CP61      GTYFLIQ-P-TYTSSTRIYVANQ------------TNDSKN-IS--------AQDLQAGT
E8KUY7      GTYFLIQ-P-TYTSSTRIYVANQ------------TNDSKN-IS--------AQDLQAGT
C2LSE5      GTYFLIQ-P-TYTSSTRIYVVNQ------------ANDGKN-LS--------AQDLQAGT
E9DM16      GTYFFIQ-P-TYTSSTRIYVVNQ------------ADDGKN-LS--------AQDLQAGT
I0QIK5      GTYFFIQ-P-TYTSSTRIYVVNQ------------ADDGKN-LS--------AQDLQAGT
Q7X560      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q8GMA6      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q55204      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q8GPC4      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q8GPA9      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNKN-LS--------AEDLQAGT
G6ERT2      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
O87930      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q8GP55      GTYFFIQ-P-TYTSTTRIYVVNK------------ATDNNN-LS--------AQDLQAGT
F8HDC4      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNKN-LS--------AQDLQAGT
F8LJ76      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNKN-LS--------AQDLQAGT
F8LXJ5      VTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
Q1WCR2      GTYFFIQ-P-TYTSTTRIYVVNQ------------ATDNNN-LS--------AQDLQAGT
G3G7C0      YSSFLVT-P-QYKSTTRIYVVGQ------------HAEAGAGLT--------NQDLQAGS
G3G7J8      YSSFLVT-P-QYKSTTRIYVVGQ------------HAEAGAGLT--------NQDLQAGS
G7SNU7      YSSFLVT-P-QYESTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G8DU30      YSSFLVT-P-QYESTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
A4VTU2      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
D5AGQ4      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
Q9X4U6      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G3G7G5      YSSFLVT-P-QYDATTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G7SG35      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G8DU06      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G8DUA9      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G8DTY9      YSSFLVT-P-QYDSTTRIYVVSQ------------NVEAGAGLT--------NQDLQAGS
G3G7I7      YSSFLVT-P-PYDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
G3G7J3      YSSFLVT-P-QFDSTTRIYVVSQ------------NVEAGAGLT--------NQELQAGT
E0PD82      GSIFLIK-P-KYTSTTRIYVVSK------------TADN---IT--------SQDLQAGS
F5X651      GSIFLIK-P-KYTSTTRIYVVSK------------TADN---IT--------SQDLQAGS
G5JTD6      VSVFIIP-K-TYTAGTRIYVVNN------------STSDS--IN--------YQDIQAGT
Q2KM75      ASMFLIK-P-SYTSTTRLYVINR------------QQSDN--LT--------ATDLQAGG
G5KAJ3      ASLFLIK-P-SYTSTTRLYVINR------------QQSDN--LT--------ATDLQAGG
B9DUJ5      GSVFLIK-P-SYSASTRIYVINQ------------QNAEN--IT--------ATDLQAGS
G5KD12      VSAFLIK-P-SYTSSTRIYVINQ------------QNSDN--LT--------ALDLQAGG
E8JMT8      GSIFFIK-P-KYTSTTRIYVVSR------------SSD--SSLT--------NQDLQAGS
F5X0J8      GSVFLIK-P-KYTSTTRIYVVSR------------SSD--SSLT--------NQDLQAGS
H2A601      GSVFFLK-P-KYTSTTRIYVVSR------------SSD--GSLT--------NQDLQAGS
E7S8W2      YSAFVAK-K-IYQSTSRIYVVSR------------QNQENNALT--------NQDLQAGS
F8DFF5      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDNNALT--------NSDLQAGA
I1ZPH8      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDNNALT--------NSDLQAGA
E3CBR9      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDNNALT--------NSDLQAGS
E8K787      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDNNALT--------NSDLQAGS
F9M365      YSAFLAK-K-EYQSTSRIYVVSR------------QNQDNNALT--------NSDLQAGS
A3CQY3      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
E8KLZ0      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F0FHA9      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F0FQQ4      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F0I4H6      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F0IAY2      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F0IJI1      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F0IS52      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F2C9N1      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F2CH54      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F3UDW8      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F3UNJ5      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F3SM33      YSVFIAK-K-MYQSTTRIYVVSR------------QNETQAALT--------NQDLQAGS
F9HC66      LSSFVLK-P-EYASTTRIYVVSR------------NQSENTGLT--------NQDLQAGT
E1LQJ6      VSSFVLT-P-EYSSTTRIYVVNR------------NQSEKAGLT--------NQDLQAGT
Q4JYU0      VSSFVLT-P-EYSSTTRIYVVNR------------NQSEKAGLT--------NQDLQAGT
Q4JZY2      VSSFVLT-P-EYSSTTRIYVVNR------------NQSEKAGLT--------NQDLQAGT
F9Q346      YSSFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
Q6L5R1      YSSFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
E9FEC6      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
E0Q2S9      YSSFIVK-S-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
F5VSH0      YSSFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
A5YTV6      YSSFIVK-P-EFTSTTRIYVVNR------------NQGNKPGLT--------NQDLQAGS
Q6L5T1      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
E0PPH8      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
A5YTT8      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
E6KKR9      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
A1ILY0      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
F2QF91      YSSFIVK-P-EFTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
Q4K0I3      YSIFIVK-P-EYTSTTRIYVVNR------------NQENKPGLT--------NQDLQAGT
Q8KWQ1      YSTFIVK-P-EYTSTTRIYVVNH------------NQGNKLGLT--------NQDLQAGS
Q4K238      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
B1I966      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
G6J8A3      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
G6LKG4      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
F9LZC3      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
F9P1W9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGS
A5LJR9      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKPGLT--------NQDLQAGT
Q9ZII7      YSTFIVK-P-EYTSTTRIYVVNR------------NQGDKSGLT--------NQDLQAGS
Q4K1K7      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGT
E1LPE6      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEKSGLT--------NQDLQAGS
F9MJW6      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEKSGLT--------NQDLQAGS
Q4K0V3      YSTFVIK-P-EFTSMTRIYVVNR------------NQGEKSGLT--------NQDLQAGS
Q54519      YSTFVIK-P-EFTSMTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
C1CBD0      YSTFVIK-P-EFTSTTRIYVVSR------------DQGEKSGLT--------NQDLQAGS
Q7WVX1      YSTFVIK-P-EFTSTTRIYVVSR------------DQGEKSGLT--------NQDLQAGS
Q4K0E2      YSTFIIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGS
Q9AH96      YSTFVIK-P-EFTSTTRIYVVNR------------NKEEKSGLT--------NQDLQAGS
A5M4L2      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
B2ILP4      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
C1CCB8      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
P72511      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
Q4K1S8      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
P96474      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEKPGLT--------NQDLQAGA
Q4K196      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKPGLT--------NQDLQAGS
Q4K0Z7      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGT
Q4JZ85      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGS
Q4JYH6      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGS
Q4JZ19      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGT
Q4K0A1      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGS
Q4K1M5      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGT
Q4K2Q8      YSTFVIK-P-EFTSTTRIYVVNR------------DQGEKSGLT--------NQDLQAGS
Q4K1G0      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEKSGLT--------NQDLQAGS
Q4K0T6      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGS
Q4K0K3      YSTFVIK-P-EFTSTTRIYVVNR------------NQGEKSGLT--------NQDLQAGT
Q4K0X6      YSTFVIK-P-EFTSTTRIYVVNR------------NQEEKSGLT--------NQDLQAGS
E8KDN1      FSSFIVK-P-QFTSTTRIYVVNR------------NQGDKPGLS--------NQDLQAGS
F9PEU3      YSSFVIQ-P-QYTSTTRIYVVNR------------NQADKPGLT--------NQDLQAGS
E8K321      YSSFVIK-P-QYTSTTRIYVVNR------------NQADKPGLT--------NQDLQAGA
F9PZP6      YSSFVIK-P-QYTSTTRIYVVNR------------NQADKPGLT--------NQDLQAGA
D6R2T7      YSAFIAP-K-VYQTTTRIYVVSR------------QNTTESALT--------NQDLQAGS
F3UUQ1      YSAFIAP-K-VYQTTTRIYVVSR------------QNTTESALT--------NQDLQAGS
E6IZC3      YSTFIIK-P-TYTSSTRIYVVNR------------QPGDNSTLT--------NQDLQAGS
G6A746      YNTFIIK-P-NYTSSTRIYVVNR------------QPSDNSTLT--------NQDLQAGS
B1V0N8      YKAYKMK-P-SYQSRVKFFIGKE--------GIKGTYSVG--------------ELEEYK
B1BNK2      YKAYKMK-P-SYQSRVKFFIGKE--------GIKGTYSVG--------------ELEEYK
B1R3X7      YKAYKMK-P-SYQSRVKFFIGKE--------GIKGTYSVG--------------ELEEYK
Q8XN77      YKAYKMK-P-SYQSRVKFFIGKE--------GIKGTYSVG--------------ELEEYK
A3ICA4      ISYFLQT-P-IYEAETQLLVNQK--------SYENQQLIG------------AQNVDTDL
B1HR40      INYFLQT-P-IYEAETQLLVNQK--------SYENQQLIG------------AQNVDTDL
H1BJT0      VSLCILP-K-KYASDSNIYLKPK--------TTSEGIIDN-------------QTVITNR
F8FCE3      VSVQYLP-R-VYQASVKLLINSE--------GKGNGVDIS--------------SINTNL
I0BSG5      VSVQYLP-R-VYQASVKLLINSE--------GKGNGVDIS--------------SINTNL
A8YPQ6      VTFFVLS-P-KYQANTQILVNQT--------KGDNPQFMA-------------QEVQSNI
P95695      VTFFVLS-P-KYQANTQILVNQT--------KGDNPQFMA-------------QEVQSNI
Q2G1K8      VTFFVLS-P-KYQANTQILVNQT--------KGDNPQFMA-------------QEVQSNI
C5QNG5      FTFFLAK-P-KYEASTQILVSQ---------KEKESKMMA-------------QEVQSNI
Q4L9H8      ITFLFMT-P-KYEATTQILINQ---------KEKNKELMA-------------QEVQSNI
Q2FUV1      LTFFVMP-D-KYTASTQILVNM---------KKSSSDLAF-------------QNVQSSL
P39850      ISFFFLD-V-KYQASTQILVNQ---------KGNDSQIMA-------------QEVQSNI
D7UYE3      LTYFFMT-P-KYASSTQILVNK---------KESNSQFMA-------------QEVQSNL
Q4A121      MTFLFIT-P-KYSSSTQVLVNQ---------KETDSQMMA-------------QQVQSDL
E3HB17      LTYAVLK-PAMYKAETTLMVSSG--------QIYSVEKLD------------SSEISKNQ
C9AAE4      YLTFFAE-P-IYQKSAQLLISQS--------ETTSGNRLE------------NQTIQADL
H7F6C7      YLQYIAT-P-IYQKSTQILVNQS--------ESTKSNSVD------------SQTVQADL
F0SX23      ITYYFMT-P-LYTASIKLYVNNS--------TELAVQITD-------------SDMKASQ
Q38VG4      LTFFVIT-P-QYSASTEVLVNRK--------QNTDANAQ-------------YNQVQTDV
F2I4B6      YAFVLAT-P-IYQSSTEILVNQS--------ESKGQNNTL------------NQDINASL
Q8RBS6      ISYYVLS-P-VYKASTSLIISRT--------QN---ITINDQIQ--------LQDIQTSR
D9SR42      ITTFVID-K-IYTADISVLIGK----------QESSDSEKTSTT--------YNDILMYQ
D9SVC8      FSTLFIN-K-LYTSDISVIIGKN--------YRNPAEGESSIAT--------YSDILMYQ
E7RG09      ISYYFIT-P-IYQTSTQLLISQK--------QSEVIV--D------------SQSIDIDL
D4G2E2      ISFFALT-P-IYENSTQILVNQS--------KNERKEV-Q------------FNDVQTNL
Q8EME7      ISYFVMT-P-KYENSSQFIVNQS--------NQEQANQFT------------QTDIRTNV
D6Y035      VSYFVLT-P-KYQASTQVLVSQA--------ATGASILSS------------ANPFESDA
Q5WBB3      ISSFVLT-P-MYERSTQLLVNQA--------VPEGQL--N------------QQVVRNNL
Q9K6Q9      VSFFLLT-P-IYQSSTQILVNHS--------NDNQSF--N------------SQDIRTNI
Q97EP7      LSFFIIK-P-TYQGHVTVIIGRN--------DSKSSTNEQ------------YNDVMMSQ
Q97ER4      LSFFIIK-P-TYQGHVTVIIGKN--------DSKSSTNEQ------------YNDVMMSQ
E4S7Y7      LSFYVLE-P-VYRASVTLFAGRS--------TNNSASSDSIQAL--------YSDVLLGQ
E4Q5T6      LSFYILP-P-IYKATVTLFAGRS--------TNSNGSNDNIQAL--------YSDVLLGQ
E4SDX3      LSFYILP-P-IYKATVTLFAGRS--------TNSDGANDSIQAL--------YSDVLLGQ
G2FWX3      VSFYCIQ-P-VFQTSTTLIVGKK--------SLDIGQPLEHMLD--------YNVLLANQ
G7WJV2      ISFFVLK-P-VYQASTTLIVGKK--------AAEPGQEAAKILD--------NNVLLANQ
G7W774      ISYFIIK-P-VYQASTTLIVGKK--------ASEEGQAAVQMLD--------NNVLLANQ
G2FM60      ISFFVMK-P-VYQASTTLIVGKK--------AAETGKDPTQILD--------NSVLLANQ
H5XZD5      ISFFVIK-P-VYQASTTLIVGKK--------AAESGQEAVKMLD--------NNVLQANQ
I4DBG9      ISFFILK-P-SYEASTTLIVGKK--------ATEEGQAAAQMLD--------NNVLLANQ
G2FWT7      ISFFVIK-P-VYQASTTLIVGKK--------AAEAGQAATQMLD--------NSVLLANQ
H5XZG8      VSFFILK-P-VYQASTTLIVGKK--------ATESGQAAMQMLD--------NSVLLANQ
G0V448      LSFFVLP-P-IYEAKVSIIIGKE--------DTSQEKRID--YN----------DIMMYQ
A0PZ01      ISFFVIH-P-TYEATLSVFIGKN--------ENEQSQKIS--YN--------ESDIMMYQ
B1B737      ISFFVIH-P-TYEATLSVFIGKN--------ENEQSQKIS--YN--------ESDIMMYQ
                       :                                                

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      NANSLKVDISTESRAA-GSREVADKAADNLRSEG--------------VD----------
B7B948      GLFGTKRNVDNEVLVF-KSRRLMTEVARNLHLDVSYTVKDGLR-----------------
G8AU95      SI-------------V-GSRALAERVVEKLGLLNDPEFNPSLKAPDGT------------
G5IFS2      KVLVT-------------SRPVTSKVIENLDLNLD-----------H-------------
F0G6H6      EVLKS--------------RAVMARAVDTTKLYIE-----------ARPRYVPLIGWRLV
F6CNF6      PVLTMNTY----LGQL-KSEVLLQRVIDKLKL--------------DP------------
A3W0H6      QLIEQ---------RL-MARDNLVKVIERHGLFAN-----------AR------------
A3K8W6      QLIEQ---------RL-MSRDNLVSLMDKYDLFAE-----------DP------------
Q0FMP1      RLIEQ---------RL-MSRDNLLALMEEHGLFDG-----------DT------------
S9QRP2      RLIEQ---------RL-MSRDNLMRIMEEHDLFTD-----------AP------------
D0D9W1      RLIEQ---------RL-MSRDNLLRFMEEHQLFTA-----------DP------------
I1AYC4      QLIEQ---------RL-MSRDNLVRIMQEHQLFSD-----------DP------------
E9TE87      IQL------------I-RSRLVLGKTVDDLDLDIAV----------SK------------
E6PYQ4      KIQTQ-------IIGL-RNPDVAISTMKKLKLSQNPIFNPSLQQDLDN------------
C0QCJ1      STISQ-------Q--I-MSMSNLEKIIDQFGLFEEE---------GAK------------
I5B297      STISQ-------Q--V-LSRSNLEQIIEQFGLYEN-----------SS------------
B8D0N1      DLITY-------SKLL-KTRKLLKKVSQHFD-----------------------------
D9QTC7      ATYTQ-------I--L-KSRSIIQQTIEELELKSKE----------TG------------
C7LPS4      KVLTV-------A--M-LSRETLFKVMRILDKDVEF----------AS------------
Q314L4      RILNV-------S--L-LSRSSLLSVMKELDMDLGL----------SG------------
G0VNK5      MTDAE-------I--L-KSRNVVLPVIEKTE---ER----------ND------------
D2RIR1      NTNAE-------I--L-KSRHVVIPVIEQTE---E-----------EK------------
I0GRR3      NTNAE-------I--L-KSRNVIEPVIEKTE---EP----------NK------------
Q39U16      RILRY-------A--M-LSRTFVTNVLKSLDADTKV----------KN------------
F0JCB9      KAIKV-------T--M-LSRNMLSKVINALDLDVDL----------KN------------
G7QCG0      QNLAV-------S--L-TSRNLLLPVIKQLDKDITL----------KT------------
I2Q342      QNLAV-------S--L-TSRNLLLPVIKQLDRDITL----------KT------------
Q74BQ7      KGLSE-------A--I-TSRTLVTKVINDLDLDVTT----------KS------------
B5EA80      NVLTY-------E--I-TSRTLLTKVMDSLDLNLGK----------SD------------
C6DZX6      NVLTY-------E--I-TSRTLLAKVVDNLDLDLGK----------ND------------
A1ARV9      KVLTY-------A--I-TSRTLLSKAAENLDMNVTR----------KG------------
E8WSZ4      SVLTY-------A--I-TSRTLLNKVVESLDMNLGK----------DG------------
A5G425      KVLNY-------A--I-TSRTLLLKVIDDLDLNVNK----------QN------------
B9M2X7      KGLNY-------A--M-ASRPLLQKVVSDLDLNLGK----------NG------------
C2MBF7      SNQII-------I--L-STERVVSETVRRLGLDVQYHY--------NA------------
H8YYB8      SQRVMTTENLGKI--I-ESYQLYPELMQRYGLVSAVEQ--------MR------------
E7T802      -----------------QGNAILSGLSDMIP-----------------------------
F4SM98      -----------------QGNAILNSLSQMLP-----------------------------
C4Z673      TLSKD------YEQLV-TSRYVIEGVINDLK-----------------LD----------
E3H7M4      KLVST------YTEIA-QSSSIMRDVVQKL-D----------------LK----------
C2EWM2      QVINT------YKDII-TNQVILSKASKQLENPVRV-ITPAKKA---VYERNANG-----
D0DSJ3      QMINT------YKDII-TNQVILKSASKQLANP---------------------------
B2GF32      QMINT------YKDII-TNQVILKSASKQLANP---------------------------
C0WW25      QMINT------YKDII-TNQVILKSASKQLANP---------------------------
F8KGP2      QMINT------YKDII-TNQVILSKASKQLKNPVKV-IKPAQPA---EYRRNADG-----
B3XL22      QMINT------YKDII-TNQVILSKASKQLKNPVRV-IKPAQPA---EYRRNADG-----
F8DRU3      QMINT------YKDII-TNQVILSKASKQLKNPVRV-IKPAQPA---EYRRNADG-----
B1MZT2      QIINT------YKNLV-ISSNVLGDVADKLKQPKTEVVQPAKPA---VYETLADG-----
H1WR07      QIINT------YKNLV-ISSNVLGDVANKLKQPKTVVVQPGKPA---VYDTLADG-----
Q03W94      QLINT------YKNLI-ISSNVLGTVSKELKNPAPIVVQEAQDA---EYKTLADG-----
C2KHF2      QLINT------YKNLI-ISSNVLGTVSDKLKNPAPIVVQKAKDA---VYKTLADG-----
H1X4N3      QLINT------YKNLI-ISSNVLGTVSDELENPAPIVVQKAKDA---VYETLADG-----
C2JZS0      QLINT------YKDII-TRPLVLKTVSKNLTSPQKVKVQKAEKA---VYGTRYNSITGVQ
C1J9I2      QIINT------YKDII-TRPVVLQAVAEDLTSPQRVMVKKAKPA---VYGTRYNAATGTR
Q58Z11      QIINT------YKDII-TRPVILREVADDLTSPRRVKVKKAQKA---VYGTRYNAATGVR
F0K0J8      NAITT------YKDII-TSNVILKGASKYLANPVTL-VKKATPA----------------
G6F8H0      NAVTT------YKDII-TSNVILKGASKYLANPVTL-VKKATPAKKAVYKTN-DG-----
Q1G8E3      NAITT------YKDII-TSNVILKGASKYLANPVTL-VKKATPA----------------
D8FLF7      NAVTT------YKDII-TSNVILKGASKYLANPVTL-VKKATPAKKAVYRTNDDG-----
F0HVF2      NAVTT------YKDII-TSNVILKGASKYLANPVTL-VKKATPAKKAVYKTNDDG-----
Q5FIC6      QMVTT------YKDIV-TSNKILTEASNRLANPTVV-VKKAQKA---VYRTDENG-----
E4SMV6      QMVTT------YKDIV-TSNKILTEASNRLANPTVV-VKKAQKA---VYRTDENG-----
F0TGY3      QMVTT------YKDIV-TSNKILTEASNRLANPTVV-VKKAQKA---VYRTDENG-----
F2M2M7      QMVTT------YKDIV-TSNKILTEASNRLANPTVV-VKKAQKA---VYRTDENG-----
C4VP07      QVITT------YKDIV-TSSKILKDASNLLANPVKV-VREAQPA---KYQTLADG-----
D6S4X3      QVITT------YKDIV-TSPKILKAASKQLANPVKV-VKEAVPA---KYETLADG-----
A4ZGZ7      QLVNT------YKDIV-TSHVILQDASDRLANPVRV-VKKAKPA---KYKT-IDG-----
C2EPK4      QMVTT------YKDIV-TSHKILEEASNRLANPTVV-VKKAKKA---VYRIDENG-----
C7XKF2      QMVTT------YKDIV-TSHVILQDASNRLANPVRV-VKKAKPA---KYKTNAEG-----
E3R265      QMVTT------YKDIV-TSHVILQDASNRLANPVRV-VKKAKPA---KYKTNAEG-----
D0DJG9      QMVTT------YKDIV-TSHVILKDASDRLANPVRV-VRKARPA---KYRTNEEG-----
D5GZJ9      QMVTT------YKDIV-TSHVILKDASDRLANPVRV-VRKARPA---KYRTNEEG-----
A8YX90      QLVNT------YKDIV-TSHVILQDASDRLANPVRV-VKKAKPA---KYRTNADG-----
F0NWJ8      QMVTT------YKDIV-TSHVILQDASDRLANPVRV-VMKAKPA---KYRTNADG-----
C6CW36      MLMDS------YKEII-SSAAILDKVVEKNPS----------------LS----------
A8SQS9      SLTAD------YEELI-LSYPVLDQVIDKM-N----------------LN----------
D5HFS3      SLTKD------YEDLI-LSYPVLDQVIEKL-G----------------LD----------
A5Z5P8      SLSED------YAELL-HVRPIIEAINEE--N----------------------------
G2KUP2      QRVYT------YKDII-TSPVIQNTVKKDLAG----------------------------
G8PE07      QMIST------YKDII-MSPAVLRDVDSSLAG----------------------------
E0NHP5      QMINT------YKDII-TSPTVLREADEKLTG----------------------------
Q03GL9      QMIST------YKDII-TSPTVLKTVNTKLQG----------------------------
C6CSC7      KMIDT------YKEVI-KTPAILGKVAEK-YP----------------------------
C6CS79      SLINT------YKEII-KTPAIMDLVVKK-HP----------------------------
F5LM70      SLIHT------YKEII-KTPAIMDLVVKE-HP----------------------------
G0LYN8      QMVTT------YKELI-AGQVVLKPAKQQLSK----------------------------
F6ITB3      QMITT------YKELI-AGQVVLKPAKQQLSK----------------------------
G0M1Y0      QMITT------YKELI-AGQVVLKPAKQQLSK----------------------------
D7VC12      QMITT------YKELI-AGQVVLNPAKQQLSK----------------------------
F9UMZ5      QMITT------YKELI-AGQVVLKPAKQQLSK----------------------------
D4JI68      SLTND------YIVVV-KG----RPVLDQVIE----------------------------
D6E329      SLTND------YIVVV-KG----RPVLDQVIE----------------------------
Q1AUN7      EGLQQ------LAQTV-AEAVATRPIAEAAAQ----------------------------
H4GK02      QLINT------YKDII-TNQVILQEATKDLAN----------------------------
F6IR92      QMITT------YKELI-TNSVVLKPARQDLMD----------------------------
G0M0G0      QMITT------YKELI-TNSVVLKPARQDLMD----------------------------
D7VBW5      QMITT------YKELI-TKPVVLKPARQTLMA----------------------------
F9UQ55      QMITT------YKELI-TKPVVLKPARQTLMA----------------------------
B9Y883      KLVNT------YSEIL-KSEAISDEVIQNL-K----------------LED---------
D4YHG8      TLLNT------YQSLV-SRPLVLDPAIADVPE----------------AEG---------
F7V793      SMATD------YEQLI-RVRTIADDTIKDL-H----------------LK----------
C3WFM8      RLVIT------YSEIA-KNKSILNKVINKY-D----------------LK----------
H7F1R6      QLVNT------YTSII-TSPRILSAVSAIL-D----------------DK----------
H7F570      QLVNT------YASIL-KSPGLLNGVAQKI-N----------------HK----------
C6LCS6      QLTKD------YMELV-TTRPVLEAVISAL-E----------------LEN---------
A7VF43      SLTKD------YEDLM-LSYPLLEQVIAKL-D----------------LS----------
A7Z922      HYNNT------FQTIM-KSPVVLEKVKQTL-H----------------LS----------
I2CAF3      HYNNT------FQTIM-KSPVVLEKVKQTL-H----------------LS----------
I2HVL3      HYNNT------FQTIM-KSPVVLEKVKQTL-H----------------LS----------
E0U2Z4      QYSST------FQSIM-KSTALMEEVKAEL-H----------------LS----------
D4G1R3      QYSST------FQSIM-KSTALMEEVKAEL-H----------------LS----------
G4EQZ6      QYSST------FQSIM-KSTALMEEVKAEL-H----------------LS----------
P71050      QYSST------FQSIM-KSTALMEEVKAEL-H----------------LS----------
G4P115      QYSST------FQSIM-KSTALMEEVKAEL-H----------------LS----------
A8FHM0      QYTRT------FQVLL-KSPIVIEKVKETL-N----------------LT----------
C0EBA5      KLIST------YSQIA-QTPEVIDQVIRKL-K----------------LD----------
F4FXQ8      QMIST------YKDII-TNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASR
C0WV34      QMIST------YKDII-TNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASR
H1LCW2      QMIST------YKDII-TNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASR
B7BDT7      NVNNE------IQSL--QSPAVMLDVVKRL-H----------------LDVNYHTDGGFY
H6LKR9      QLIID------YKEIA-LTRLVIDAVVKNT-G----------------LNINDNESKN--
F5LE49      MLVNT------YKEII-KTPAIMEKVASRFTG----------------EG----------
F3AHH1      LLTKD------YAELI-LSRTVTEAVIGKL-D----------------LD----------
F3Y921      QMINT------YKDLI-KSDSLIGEIHKQL-N----------------ATANI-------
G4L593      QMLNT------YKDIIEEGDALAASMQDRL-A----------------SDYGL-------
E6LD65      QMINT------YKDFI-VSDLVLNQVQSRL-D----------------TQYKI-------
C9ALZ8      QMINT------YKDMI-VSDLVLNEVKDRL-E----------------TEDNV-------
C9BUG6      QMINT------YKDMI-VSDLVLNEVKDRL-E----------------TEDNV-------
Q3XYS7      QMINT------YKDMI-VSDLVLNEVKNRL-E----------------TEDNV-------
C9B453      QMINT------YKDMI-VSDLVLNEVKDRL-E----------------TEDNV-------
D4RJF5      QMINT------YKDMI-VSDLVLNEVKDRL-E----------------TEDNV-------
F0EKB8      QMINT------YKDMI-VSDLVMTQVKDRL-E----------------SENNL-------
C9A6V4      QMINT------YKDMI-VSDLVMTQVKDRL-E----------------SENNL-------
C9CHY7      QMINT------YKDMI-VSDLVMTQVKDRL-E----------------SENNL-------
C8ZXT8      QMINT------YKDMI-VSDLVLNEVKDRL-E----------------SESNV-------
G5IRQ5      QMINT------YKDMI-VSDLVLNEVKDRL-E----------------SESNV-------
E6UHY5      SLATT------YIVIL-DDPLLYESISDKL-L----------------KD----------
E9SAU2      SLAAT------YIVIL-DDASVYEAISDRL-L----------------ED----------
F7K0U2      QLTKD------YMELI-KSRSVMEQVISQL-Q----------------LD----------
O06029      QMANT------INQVI-VSPVILDKVRSNL-N----------------LS----------
G8P3D6      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
A9QSJ3      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
F9VC43      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
G6FD41      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
G9M881      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
Q3ZK51      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
Q83VG0      QMANT------INQVI-VSPVILDKVQSNL-N----------------LS----------
C6LDI9      ALTAD------YQMIA-TSRPVVDQVIENL-E----------------LD----------
G5F9H3      QLTQD------YKVLV-GSRPVLQGVVDHM-K----------------LD----------
C0CZV8      QLTKD------YKIIV-TSRPVLEDVIEGL-E----------------LN----------
G5GFW1      QLTKD------YKIII-SSRPVLQKVINTL-D----------------LK----------
I5AV00      TLTKD------YVELI-QSREVTEAVSARL-S----------------MKNTV-------
H6NE44      KLIKT------YSEIL-RTSAVLEKVAAAYPE----------------FM----------
F4BS20      QMINT------YRDII-EDPVVIDKVINEL-G----------------NT----------
E0RZL4      QLTQD------YAELI-KSRRVLEEVIQRLHL----------------TD----------
C0CK72      ELTND------YEIIF-TSRPILQEVIDEL-K----------------LD----------
D9S1J8      LLVST------YGEIA-KSRSTLEEVLRRL-N----------------LN----------
C2EFR7      ELIKD------YEEMV-KSRAVLENIIEKQ-D----------------LR----------
Q1WTC7      ELIKD------YEEMV-KSRAVLENIIEKH-D----------------LR----------
B0P2G1      QLTQD------YMVIV-KTRPVLEQVIADL-K----------------LD----------
D4MW28      QLTQD------YMVIV-KTRPVLEQVIADL-K----------------LD----------
E5VMX9      QLTQD------YMVIV-KTRPVLEQVIADL-K----------------LD----------
F2I6Z8      --LKT------YDDLL-HTPLILQPVAQAH-Q----------------RD----------
E6U7N3      ELVNT------YSVIL-TSDTVLDQVISDL-N----------------LK----------
C4Z8M6      SLTND------YIVVV-KGRPVLDQVIENL-N----------------LN----------
D4JMC3      SLTND------YEYVI-TGRTVLSQVIDNL-D----------------MD----------
D6E0V3      SLTND------YEYVI-TGRTVLSQVIDNL-D----------------MD----------
E3GPC7      KLVGT------YSEIA-KSKSVVSEVENNL-N----------------LD----------
A6BIG6      MLTKD------YMEMV-KSRPVLEKVISEL-N----------------LD----------
C2CI43      ALIST------YSEIV-KSKGIADKVIKNL-G----------------LD----------
D4RX68      TLSSD------YVEIV-KSRTVLEQVIANL-D----------------LK----------
D4J4T5      QLTSD------YSSMI-KSRSFMEDVIKKL-N----------------LT----------
I5ASF9      QLTND------YKVLI-LSRPVLEKTIKKT-G----------------LD----------
C0C0F9      QLTKD------YMELV-KSRPVLEQVIAVL-N----------------LD----------
B6W7H3      ALVST------YSEIV-KSKGVADKVIDNL-K----------------LD----------
C7RGH5      ALIST------YSEIV-KSKGIAERVINNL-G----------------LD----------
F0GT82      ALIST------YSEIV-KSKGIADQVIKNL-S----------------LN----------
F3AH93      QLASD------YQVLI-KSKPVMEQVIENL-N----------------LK----------
B0GAL4      QLTKD------YSILI-TSRPVLTDVIDQL-D----------------LD----------
G1WUK1      QLTKD------YSILI-TSRPVLTDVIDQL-D----------------LD----------
D4M2S1      QLTKD------YNILI-TSRTVLQDVVDEL-N----------------LD----------
E7GL80      QLTQD------YKELI-GSRPVMQEVINTL-N----------------LD----------
G5F9E3      QLTQD------YKELI-GSRPVMQEVINTL-N----------------LD----------
D4CG07      QLTQD------YKVMI-TSRPVLQQVVDEL-G----------------LE----------
D4MP31      QLTQD------YKVMI-TSRPVLQQVVDEL-G----------------LE----------
G5HNC6      QLTKD------YSVMI-TSRPVLEQVIEKQ-G----------------LD----------
A8RK86      QLTKD------YSVMI-TSRPVLEQVIKNQ-G----------------LN----------
G5HTB1      QLTKD------YSVMI-TSRPVLEQVIENQ-G----------------LN----------
A8RSL0      QLTKD------YKIIV-TSRRVLNQVIEDM-E----------------LS----------
C5EN02      QLTKD------YKIIV-TSRRVLNQVIDDM-K----------------LN----------
G5HG46      QLTKD------YKIIV-TSRRVLNQVIDEM-E----------------LG----------
E7GL39      QLTQD------YKVLV-GSRPVLQGVVDHM-K----------------LD----------
E7GL56      QLTQD------YKVLV-SSRPVMEGVINHL-K----------------LD----------
G5F9B0      QLTQD------YKVLV-SSRPVMEGVIKHL-K----------------LD----------
D3AC81      QLTKD------YKVLV-TSRPVTAQVITNL-D----------------LN----------
D3AE79      QLTKD------YKVLV-TSRPVLEQVTENL-G----------------LN----------
D4YF14      TLVST------YRDII-LGDGVLTEVNNSL-D----------------GK----------
B1YMM6      TLVNT------YRVII-KSPAILEKVQAEVKN----------------AP----------
D4LG05      SLTSD------YEELM-FSYPVLNRVIEKL-K----------------LD----------
D4LTH3      SLTSD------YEELM-LSYPVLNRVIEKL-D----------------LD----------
F3ATF6      ALTGD------YSILA-TSRSVLEEVIEDL-G----------------LN----------
E0I7B6      MVINS------YKEII-KSKAIMDKVAAAYPD----------------LG----------
C9LAS2      QLTKD------YSVLI-TSRPVLDETVKNL-D----------------LE----------
F7K8E8      QLTKD------YAELI-QSRFVLEEVVQGM-G----------------LD----------
F7K9V0      QLTKD------YAELI-QSRFVLEEVVQGM-G----------------LD----------
F7KL97      QLTKD------YAELI-QSRFVLEEVVQGM-G----------------LD----------
D3FZP5      KYIQT------YNVIM-KSPYILDQVIDEL-D----------------LN----------
C0ZHV9      KLIET------YRVII-ESPRVMERVLEVI-G----------------AG----------
D7WMM9      RLINT------YNIII-TSSAILSKVINKL-D----------------LD----------
A8U9F5      QMINT------YKDII-KGPVVLNEVRENL-G----------------TN----------
F4BSE0      QMINT------YKDII-KGPVILNEVRENL-G----------------TK----------
E7RDR2      QLINT------YSVII-KSPAILDEVASQL-D----------------LD----------
I0JRK5      DLINT------YNVII-KSPRILDQVVEEL-G----------------LD----------
G2TR26      QLVNT------YNVII-KSPSILDKVIDEL-K----------------LN----------
D5DBK2      QLIST------YNDII-KSPAILDKVIDKL-K----------------LD----------
D5DY80      QLINT------YNDII-TSPVILDKVIKEL-K----------------LD----------
A7Z9K1      QLINT------YNVII-KSPVILDEVIKQL-H----------------LS----------
I2CB17      QLINT------YNVII-KSPVILDEVIKQL-H----------------LS----------
I2HW54      QLINT------YNVII-KSPVILDEVIKQL-H----------------LS----------
G4P1M8      QLINT------YNVII-KSPAILDEVIKEM-G----------------LS----------
E0TTZ7      QLINT------YNVII-KSPAILDEVIKEM-G----------------LS----------
G4EQF2      QLINT------YNVII-KSPAILDEVIKEM-G----------------LS----------
P96715      QLINT------YNVII-KSPAILDEVIKEM-G----------------LS----------
I0F9R7      QLINT------YNVII-KSPAILDEVIKEM-G----------------LS----------
G9QKR5      QLVNT------YSVII-KSPAVLEKVIKEL-K----------------LD----------
B5UQ74      QLTNT------YKVII-KSPVILEQVKEKL-G----------------LN----------
B7HFH2      QLTNT------YKVII-KSPVILEQVKQKL-N----------------LN----------
Q72XH7      QLTNT------YKVII-KSPVILEQVKEMQ-G----------------LN----------
C2V4M3      QLTNT------YKVII-KSPVILDQVKEKL-G----------------LN----------
C2YZB3      QLTNT------YKVII-KSPVILDQVKEKL-G----------------LN----------
C2P8H2      QLTNT------YKVII-KSPVILDQVKEKL-G----------------LN----------
C2Y451      QLTNT------YKVII-KSPVILDQVKEKL-G----------------LN----------
C3EBC1      QLTNT------YKVII-KSPVILDQVKENL-G----------------LN----------
C3H980      QLTNT------YKVII-KSPVILDQVKEKL-G----------------LN----------
C2PN23      QLTNT------YKVII-KSPVILDQVNEKL-N----------------LK----------
B9IRQ7      QLTNT------YKVII-KSPVILDQVKSKL-G----------------LN----------
A0RL71      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C2XJI0      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
Q3EV65      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C2T8T7      QLTNT------YKVII-KSPVILDRVNEKL-N----------------LN----------
C2RG50      QLTNT------YKVII-KSPVILDRVNEKL-N----------------LN----------
Q814Y9      QLTNT------YKVII-KSPVILDRVNEKL-N----------------LN----------
B3ZRD5      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
F0PU65      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
Q6HB08      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C2NQN7      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C3GRR1      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C2ULR7      QLTNT------YKVII-KSPVILDQVNEKL-N----------------LN----------
C3GBJ9      QLTNT------YKVII-KSPVILDQVNEKL-N----------------LN----------
C2WVG7      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
G9QCG2      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C2QJY6      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
C2SSX9      QLTNT------YKVII-KSPVVLDQVNEKL-N----------------LN----------
B7IQS9      QLTNT------YKVII-KSPVILEQVNEKL-N----------------LN----------
A9VRC4      QLTNT------YKVII-KSPVVLDQVNEKL-N----------------LN----------
C2MTG4      QLTNT------YKVII-KSPVILDQVNEKL-K----------------LN----------
B7HXB5      QLTNT------YKVII-KSPVILDQVNEKL-N----------------LN----------
C2SBU5      QLTNT------YKVII-KSPVILDQVNEKL-N----------------LN----------
Q2BFS6      QLINT------YNVII-KSPAILDLVKEEL-D----------------LD----------
I3EBB4      QLINT------YNVII-KSPAILDLVIKEL-H----------------LD----------
A4ITF4      QLINT------YSVII-KSPTILEKVKGEL-Q----------------LD----------
C5D962      QLINT------YSVII-KSPTILEKVKEEL-N----------------LD----------
G8MZ94      QLINT------YSVII-KSPTILEKVKDEL-H----------------LD----------
Q5KUM4      QLINT------YSVII-KSPTILEKVKDEL-H----------------LD----------
G5SDT9      PASDA------EIQLI-RSRLVLGKTVDDLD-----------------------------
G5LQM7      PASDA------EIQLI-RSRLVLGKTVDDLD-----------------------------
G5Q4J1      PASDA------EIQLI-RSRLVLGKTVDDLD-----------------------------
G2Z8Q4      QFVNT------YSVIL-TSSRILDQVKDNLN-----------------LP----------
D9ST43      NLITT------YAEIG-RSASVAENASKMLK------------------D----------
H7F5T7      QMINT------YKALI-KSPKVLNQVSADLK-----------------GE----------
G9WIR0      QIIYT------YRDLA-TRPVILDQVARNLR-----------------GR----------
D3LB11      QLIYT------YKDLV-TRPVILNKVAKELK-----------------ST----------
A0NKF7      QLIYT------YKDLI-TRPVILNKVAKELK-----------------ST----------
Q04DV7      GLIYT------YKDLI-TRPVILNKVAKELK-----------------ST----------
F6BI63      LLAAT------YAEIA-TSRSVLQEAINKLN-----------------LN----------
G2MWC1      MLAAT------YSEIV-KSRRVLQPVIERLR-----------------LP----------
B0K4N2      MLAAT------YSEFV-KSRRVLQPVIERLR-----------------LP----------
C7ISF8      MLAAT------YSEFV-KSRRVLQPVIERLR-----------------LP----------
B0KAR6      MLAAT------YSEFV-KSRRVLQPVIERLR-----------------LP----------
E8UV30      MLAAT------YSEFV-KSRRVLQPVIERLR-----------------LP----------
C0GGR6      QLVKT------YEEIA-RSGVVASAVIQDLN-----------------LD----------
A4J8V1      QLVKT------YSQIA-KSRTVVEKVMQSEK-----------------IN----------
C8VYQ7      QLVKT------YSQIA-KSRTVAEKIIEQEK-----------------LD----------
C8W5K3      ELAKT------YSKIA-VSRTVAEKVLQVEK-----------------LD----------
B1BNH4      QLMKT------YAELA-KTSDLVTKAVKSAD-----------------LD----------
B1V1Z3      QLMKT------YAELA-KTSDLVTKAVKSAD-----------------LD----------
B1R3V2      QLMKT------YAELA-KTSDLVTKAVKSAD-----------------LD----------
Q0SVR9      KLMKT------YAELA-KTSDLVTKAVKNAK-----------------LD----------
Q8XN47      KLMKT------YAELV-KTSDLVTKAVKSAN-----------------LD----------
G7M0Q2      KLLKT------YAEII-KTNDLIEKAVDVEN-----------------LD----------
G7M565      KLLKT------YVEII-KTNDLIDRAINFSN-----------------LN----------
A6M2M0      KLIKT------YAEII-KTNDLVQRAIDSSD-----------------IN----------
G7M1R8      QLLKT------YAEVV-KTNDLVEKAIEKTG-----------------AD----------
A5V0I4      --MSS------FREMA-LARPQLQKISDELK-----------------LD----------
A7NQ70      --MSS------FREMA-LARPQLQKISDDLQ-----------------LD----------
Q4JZ56      ALTKD------YKEII-LSDEVLEETISDLK-----------------LE----------
Q7X554      YLVND------YYEII-TSDDVLSEVIKDEK-----------------LN----------
Q7X550      FLVKD------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q7X562      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q7X556      YLVND------YNEII-TSNDVLSEVIKDEK-----------------LN----------
Q7X552      YLAND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q7X558      YLAND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
C5NWJ9      LLVKD------YKEII-LSNKVMEDAAEKSG-----------------TE----------
F3A498      LLVKD------YKEII-LSNKVMEDSAEKSG-----------------LG----------
Q9AHD3      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q4K2E2      YLVKD------YREII-LSQDVLEKVVTDLQ-----------------LD----------
Q4K2F8      YLVKD------YREII-LSQDVLEKVVTDLQ-----------------LD----------
Q4K046      YLVKD------YREII-LSQDVLEKVAANLK-----------------LD----------
Q4K0R8      YLVKD------YREII-LSHDVLEKVATNLK-----------------LD----------
Q4JYY0      YLVKD------YREIT-LSHDVLEKVATNLK-----------------LD----------
Q4JZW8      YLVKD------YREIT-LSQDVLEKVATNLK-----------------LD----------
I0J9C8      YLVKD------YREII-LSQDVLEKVVTNLK-----------------LD----------
Q4K0M4      YLVKD------YREII-LSQNVLEKVATNLK-----------------LD----------
Q4JZS4      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q4JZK2      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q9AHA5      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q9X9A0      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q4JYK9      YLVKD------YREII-LSQDSLEKVATNLK-----------------LD----------
Q4K006      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q4JZG8      YLVKD------YREIV-LSQDVLEKVVTNLK-----------------LD----------
A6YIA7      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
E5F5C4      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q9AHB8      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q4JZL8      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q4K1B8      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q8VU32      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
D2ERX9      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
G6C7Z0      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q4K2A9      YLVKD------YREII-LSQDVLEKVAINLK-----------------LD----------
D6ZQI7      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q9ZFT9      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q4K255      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
F9HJP7      YLVKD------YKEII-LSQDVLSTVISELK-----------------LS----------
E8JWI4      YLVKD------YKEII-LSQDVLASVISELK-----------------LS----------
A8AZR4      YLVKD------YKEII-LSQDVLSTVISELK-----------------LP----------
D0RXH3      YLVKD------YKEII-LSQDVLSTVISELK-----------------LP----------
Q83YR6      YLVKD------YKEII-LSQDVLSTVISELK-----------------LP----------
F1Z125      LLVND------YKEII-TSRDVMKDVIANDG-----------------VS----------
Q3K0S9      FLAND------YKEII-TSTDVLEKVISSEK-----------------LN----------
P0C0T8      FLAND------YKEII-TSTDVLEKVISSEK-----------------LN----------
Q67AY5      FLAND------YKEII-TSTDVLEKVISSEK-----------------LN----------
Q04662      FLAND------YKEII-TSTDVLEKVISSEK-----------------LN----------
Q8GP93      FLTKD------YKEII-TLNDVLSEVIKDEK-----------------LN----------
Q8GPF7      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
E3CP61      FLTKD------YKEII-TSNDVLSEVIKDEK-----------------LK----------
E8KUY7      FLTKD------YKEII-TSNDVLSEVIKDEK-----------------LK----------
C2LSE5      FLTKD------YKEII-TSNDVLSEVIKDEK-----------------LN----------
E9DM16      FLTKD------YKEII-TSNDVLSEVIKDEK-----------------LN----------
I0QIK5      FLTKD------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q7X560      YLAND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q8GMA6      YLAND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q55204      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q8GPC4      YLAND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q8GPA9      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
G6ERT2      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
O87930      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q8GP55      YLAND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
F8HDC4      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
F8LJ76      YLVND------YKEII-TSNDVLSEVIKDEK-----------------LN----------
F8LXJ5      FLVKD------YKEII-TSNDVLSEVIKDEK-----------------LN----------
Q1WCR2      FLVKD------YKEII-TSNDVLSEVIKDEK-----------------LN----------
G3G7C0      YLAKD------YKEII-LSQDVLTQIATELN-----------------LN----------
G3G7J8      YLVKD------YKEII-LSQDVLTQIATELN-----------------LN----------
G7SNU7      YLVKD------YREII-LSQDVLTQVATELN-----------------LK----------
G8DU30      YLVKD------YREII-LSQDVLTQVATELN-----------------LK----------
A4VTU2      YLAKD------YREII-LSQDVLTQVATELN-----------------LK----------
D5AGQ4      YLAKD------YREII-LSQDVLTQVATELN-----------------LK----------
Q9X4U6      YLAKD------YREII-LSQDVLTQVATELN-----------------LK----------
G3G7G5      YLVKD------YKEII-LSQDVLTQVATELN-----------------LK----------
G7SG35      YLVKD------YKEII-LSQDVLTQVATELN-----------------LN----------
G8DU06      YLVKD------YKEII-LSQDVLTQVATELN-----------------LN----------
G8DUA9      YLVKD------YKEII-LSQDVLTQVATELN-----------------LN----------
G8DTY9      YLVKD------YKEII-LSQDVLTQVATELN-----------------LN----------
G3G7I7      YLVKD------YREII-LSQDVLTQVATELN-----------------LK----------
G3G7J3      YLVKD------YKEII-LSQDVLSRVKTELG-----------------LT----------
E0PD82      YLVND------YKEVI-TSSEVLSSVIDQQK-----------------LA----------
F5X651      YLVND------YKEVI-TSSEVLSSVIDQQK-----------------LP----------
G5JTD6      DLVND------YKEII-QSQDVLDDVVKKEK-----------------LD----------
Q2KM75      YLVND------YKEII-TSRDVMHDVIAKEN-----------------VS----------
G5KAJ3      YLVND------YKEII-TSRDVMQDVIASDG-----------------LS----------
B9DUJ5      FLVND------YKEII-TSRDVMKDVIATNS-----------------LS----------
G5KD12      YLVND------YKEII-TSRDVMKDVIANNN-----------------VT----------
E8JMT8      YLVND------YKEVI-TSNEVLSSVIDQEN-----------------LS----------
F5X0J8      YLVND------YKEVI-TSNEVLSSVISQEN-----------------LS----------
H2A601      YLVND------YKEVI-TSNEVLSSVISQEN-----------------LS----------
E7S8W2      YLVKD------YREII-LSQNVLNQAIEELK-----------------LE----------
F8DFF5      YLVKD------YREII-LSQNVLSQAIEELK-----------------LN----------
I1ZPH8      YLVKD------YREII-LSQNVLSQAIEELK-----------------LD----------
E3CBR9      YLVKD------YREII-LSQNVLSQAIEELK-----------------LD----------
E8K787      YLVKD------YREII-LSQNVLSQAIEELK-----------------LD----------
F9M365      YLVKD------YREII-LSQNVLSQAIEELK-----------------LD----------
A3CQY3      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
E8KLZ0      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F0FHA9      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F0FQQ4      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F0I4H6      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F0IAY2      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F0IJI1      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F0IS52      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F2C9N1      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F2CH54      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F3UDW8      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F3UNJ5      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F3SM33      YLVKD------FKEII-LSQAVLSQAISELK-----------------LQ----------
F9HC66      YLVKD------YKEII-LSQDVLEKVISNLK-----------------LE----------
E1LQJ6      YLVKD------YKEII-LSQDVLEKVISNLK-----------------LE----------
Q4JYU0      YLVKD------YKEII-LSQDVLEKVISNLK-----------------LE----------
Q4JZY2      YLVKD------YKEII-ISQDVLEEVISNLK-----------------LE----------
F9Q346      YLVKD------YREII-LSQDVLEKVATDLK-----------------LD----------
Q6L5R1      YLVKD------YREII-LSQDVLEKVATDLK-----------------LD----------
E9FEC6      YLVKD------YREII-LSQDVLEKVATDLK-----------------LD----------
E0Q2S9      YLVKD------YREII-LSQGVLEKVATDLK-----------------LD----------
F5VSH0      YLVKD------YREII-LSQGVLEKVATDLK-----------------LD----------
A5YTV6      YLVKD------YREII-LSQDVLEKVATDLK-----------------LD----------
Q6L5T1      YLVKD------YREII-LSQDVLEKVATDLK-----------------LE----------
E0PPH8      YLVKD------YREII-LSQDVLEKVATDLK-----------------LE----------
A5YTT8      YLVKD------YREII-LSQDVLEKVATDLK-----------------LE----------
E6KKR9      YLVKD------YREII-LSQDVLEKVTTDLK-----------------LE----------
A1ILY0      YLVKD------YREII-LSQDVLEKVATDLK-----------------LE----------
F2QF91      YLVKD------YREII-LSQDVLEKVATDLK-----------------LE----------
Q4K0I3      YLVKD------YHEII-LSQDVLEKVATNLK-----------------LD----------
Q8KWQ1      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
Q4K238      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
B1I966      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
G6J8A3      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
G6LKG4      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
F9LZC3      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
F9P1W9      YLVKD------YREII-LSQDVLEKVATNLK-----------------LD----------
A5LJR9      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q9ZII7      YLVKD------YREII-LSQDALEKVATNLK-----------------LD----------
Q4K1K7      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
E1LPE6      YLVKD------YREII-LSQDVLEKVVSDLK-----------------LD----------
F9MJW6      YLVKD------YREII-LSQDVLEKVVSDLK-----------------LD----------
Q4K0V3      SLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q54519      SLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
C1CBD0      YLTKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q7WVX1      YLTKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q4K0E2      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q9AH96      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
A5M4L2      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
B2ILP4      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
C1CCB8      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
P72511      YLVKD------YREII-LSQYVLEEVVSDLK-----------------LD----------
Q4K1S8      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
P96474      YLVKD------YREIV-LSQDVLEEVISDLK-----------------LD----------
Q4K196      YLVKD------YREII-LSQDVLEEVVSGLK-----------------LD----------
Q4K0Z7      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4JZ85      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4JYH6      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4JZ19      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4K0A1      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4K1M5      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4K2Q8      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q4K1G0      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q4K0T6      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
Q4K0K3      YLVKD------YREII-LSQDVLEEVVSDLK-----------------LD----------
Q4K0X6      YLVKD------YREII-LSQDVLEEVISDLK-----------------LD----------
E8KDN1      YLVKD------YREII-LSQDVLEKVVTEQN-----------------LK----------
F9PEU3      YLVKD------YREII-LSQDVLEKVVADQS-----------------LA----------
E8K321      YLVKD------YREII-LSQDVLEKVVADQS-----------------LT----------
F9PZP6      YLVKD------YREII-LSQDVLEKVVADQK-----------------LT----------
D6R2T7      YLVKD------FKEII-LSQAVLSQAISDLQ-----------------LK----------
F3UUQ1      YLVKD------FKEII-LSQAVLSQAISDLQ-----------------LK----------
E6IZC3      YLVKD------YKEII-LSQDVLAKVISDLK-----------------LN----------
G6A746      YLVKD------YKEII-LSQDVLAKVISDLK-----------------LN----------
B1V0N8      KMIGA------YVEIF-NNEDVVSKLLKKAN-----------------ID----------
B1BNK2      KMIGA------YVEIF-NNEDVVSKLLKKAN-----------------ID----------
B1R3X7      KMIGA------YVEIF-NNEDVVSKLLKKAN-----------------ID----------
Q8XN77      KMIGA------YVEIF-NNEDVVSKLLKKAN-----------------ID----------
A3ICA4      RLINT------YNVII-KSPVILTKVIDVLA-----------------LD----------
B1HR40      RLINT------YNVII-KSPVILTKVIDVLA-----------------LE----------
H1BJT0      NLVKD------YEKIL-QGTTVLSQVDKKLH-----------------------------
F8FCE3      KLIKT------YSEIL-RTSAVLEKVAAAYP----------------EFM----------
I0BSG5      KLIKT------YSEIL-RTSAVLEKVAAAYP----------------EFM----------
A8YPQ6      QLVNT------YKEIV-KSPRILDEVSKDLN-----------------DK----------
P95695      QLVNT------YKEIV-KSPRILDEVSKDLN-----------------DK----------
Q2G1K8      QLVNT------YKEIV-KSPRILDEVSKDLN-----------------DK----------
C5QNG5      QLVNT------YAEII-KSPRILDDVAKE-N-----------------KD----------
Q4L9H8      QLVNT------YSQIL-KSPRILDEVAKK-D-----------------NK----------
Q2FUV1      QSVNT------YTEII-KSPRILDKVSREFD-----------------GQ----------
P39850      QLVNT------YSEIV-KSPRILDKVSKELD-----------------DK----------
D7UYE3      QLVNT------YAEII-KSPRILESVSKNLD-----------------RE----------
Q4A121      QLVNT------YSEII-KSPRILDKVSKNLK-----------------GK----------
E3HB17      KLVSS------YTEVA-RSKSIMKNVIKRLG-----------------LE----------
C9AAE4      QLVST------YSTII-MSPRILNEVSEALE-----------------GS----------
H7F6C7      QLVNT------YSTII-SSPRILNEVQQDLG-----------------KQ----------
F0SX23      SLIKT------YMTII-QSDTVLEKVITTLG--------------LPPSN----------
Q38VG4      QMINT------YKDLI-TKPVIMDSVTKKIND-------------GKTNK----------
F2I4B6      QLINT------YSDVI-RNEVVLSPVIDQLN-----------------LQ----------
Q8RBS6      MLAAT------YSEIV-KSRRVLQPVVTKLN-----------------LP----------
D9SR42      KIVKT------YSQIA-KSRKVADDVKEKLS-----------------LN----------
D9SVC8      KAVKT------YGKIA-TSRTVASDVIDKLS-----------------LN----------
E7RG09      QLVST------YSEIL-KSPIILDQVISQLD-----------------LE----------
D4G2E2      QLINT------YNVII-KSPAILDEVIKEMG-----------------LS----------
Q8EME7      EIINT------YNVII-KSPAILDTVATELQ-----------------LD----------
D6Y035      RYIET------YSVIL-KSPYILDQVVDELE-----------------LE----------
Q5WBB3      ELIDT------YSEII-KSPRILNEVIEAEG-----------------LD----------
Q9K6Q9      DLINT------YSVII-KSPAILDKVIDNLQ-----------------LE----------
Q97EP7      NLTKT------YAQIA-ESRSVASKTVSKLS-----------------NG----------
Q97ER4      NLTKT------YAQIA-QSKQVADKTVSKLA-----------------DG----------
E4S7Y7      QLVKD------YREIA-VSRTVLERVIKELN-----------------LK----------
E4Q5T6      QLVKD------YREIA-VSRTVLERVIKELN-----------------LK----------
E4SDX3      QLVKD------YREIA-VSRTVLERVIKELN-----------------LN----------
G2FWX3      QLTKT------YAAIA-KSRTVEQNVINGLE-----------------LP----------
G7WJV2      QLAKT------YALIA-QSRTVEEKVIKELN-----------------LE----------
G7W774      QLAKT------YAAIA-QSRTVEQSVIDDLD-----------------LS----------
G2FM60      QLAKT------YATIA-QSRTVEQNVLKDLN-----------------LP----------
H5XZD5      QLAKT------YALIA-QSRTVEEKVIEELD-----------------LE----------
I4DBG9      QLAKT------YATIA-QSRTVEEQVIKDLD-----------------LP----------
G2FWT7      QLAKT------YATIA-QSRTVEQSVLNDLN-----------------LA----------
H5XZG8      QLAKT------YAAIA-QSRTVEQNVINNLD-----------------LP----------
G0V448      KLVKT------YASIA-KSRTVVEKTIQKLS-----------------KQ----------
A0PZ01      RLVKT------YATIA-KTNDVLEQVIEKLN-----------------LD----------
B1B737      RLVKT------YATIA-KTNDVLEKVIEKLK-----------------LD----------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
B7B948      ------------------------TVELYTQSPVQLSFPDAEEAQAFSLQAVPVSGKEVM
G8AU95      ------------------------DDHWLKRVTKAGVGALPPE-----------------
G5IFS2      ------------------------EQ----------------------------------
F0G6H6      NGADGLSSPLPGGYVYGTERIDVAAF----------------------------------
F6CNF6      ------------------------DL----------------------------------
A3W0H6      ------------------------DM----------------------------------
A3K8W6      ------------------------AL----------------------------------
Q0FMP1      ------------------------GM----------------------------------
S9QRP2      ------------------------EM----------------------------------
D0D9W1      ------------------------TM----------------------------------
I1AYC4      ------------------------DM----------------------------------
E9TE87      ------------------------NTFPIFGAGWDRLMGRQNETVKVTTFNRPKEMADQV
E6PYQ4      ------------------------PA----------------------------------
C0QCJ1      ------------------------DM----------------------------------
I5B297      ------------------------GM----------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------EL----------------------------------
C7LPS4      ------------------------DM----------------------------------
Q314L4      ------------------------P-----------------------------------
G0VNK5      ------------------------DG----------------------------------
D2RIR1      ------------------------DG----------------------------------
I0GRR3      ------------------------DG----------------------------------
Q39U16      ------------------------DK----------------------------------
F0JCB9      ------------------------EI----------------------------------
G7QCG0      ------------------------AY----------------------------------
I2Q342      ------------------------AY----------------------------------
Q74BQ7      ------------------------NA----------------------------------
B5EA80      ------------------------S-----------------------------------
C6DZX6      ------------------------S-----------------------------------
A1ARV9      ------------------------GA----------------------------------
E8WSZ4      ------------------------N-----------------------------------
A5G425      ------------------------DA----------------------------------
B9M2X7      ------------------------DT----------------------------------
C2MBF7      ------------------------GL----------------------------------
H8YYB8      ------------------------ED----------------------------------
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      -------------------------E----------------------------------
E3H7M4      -------------------------N----------------------------------
C2EWM2      RRVLVRS---AKPAVVERTNGKSYHV----------------------------------
D0DSJ3      -----------------SGSQRAYAL----------------------------------
B2GF32      -----------------SGSQRAYTL----------------------------------
C0WW25      -----------------SGSQRAYAL----------------------------------
F8KGP2      TRKLIKE---AQPAVVERGGKSYN-L----------------------------------
B3XL22      TRRLIKE---AQPAVVERGGKSYS-L----------------------------------
F8DRU3      TRKLIKE---AQPAVVERGGKSYN-L----------------------------------
B1MZT2      TRRLVSP---EQKEITKTSSQQTYDF----------------------------------
H1WR07      TRRLVSP---EQKEITRASSQPTYDL----------------------------------
Q03W94      TQRLVTP---AKKRITKPSTKTKYNL----------------------------------
C2KHF2      TRRLVTP---AQKEITKPSNKKKYYL----------------------------------
H1X4N3      TRRLVTP---AKKEITKPSNKTKHQI----------------------------------
C2JZS0      EKYLVKK---EQPAKYKLEPAKYDNL----------------------------------
C1J9I2      ERYVTEE---AQPAKYKLKPAKYSNI----------------------------------
Q58Z11      ERYVVKE---EQPAKYKLKPAKYANI----------------------------------
F0K0J8      -----KKAVKAKPAVYKRESKSYS-V----------------------------------
G6F8H0      TRTLVKKAVKAKPAVYKRESKSYS-V----------------------------------
Q1G8E3      -----KKAVKAKPAVYKRESKSYS-V----------------------------------
D8FLF7      TRTLVKKAVKAKPAVYKRESKSYS-V----------------------------------
F0HVF2      TRTLVKKAVNAKPAVYKRESKSYS-I----------------------------------
Q5FIC6      RRRLVRK---AQPAVIERSGKSYS-V----------------------------------
E4SMV6      RRRLVRK---ARPAVIERSGKSYS-V----------------------------------
F0TGY3      RRRLVRK---ARPAVIERSGKSYS-V----------------------------------
F2M2M7      RRRLVRK---ARPAVIERSGKSYS-V----------------------------------
C4VP07      TKKLVKK---AQSAVLERSGKSYM-V----------------------------------
D6S4X3      TKKLVKK---AQPAVLERSGKSYT-I----------------------------------
A4ZGZ7      RKVLVRK---AQPAVIERDGKSYS-V----------------------------------
C2EPK4      RRRLVRR---AQPAVIERSGKSYV-V----------------------------------
C7XKF2      RRVLVRK---AQPEVVERSGKSYS-V----------------------------------
E3R265      RRVLVRK---AQPEVVERSGKSYS-V----------------------------------
D0DJG9      RRVLVRK---AQPEVVERSGKSYS-V----------------------------------
D5GZJ9      RRVLVRK---AQPEVVERSGKSYS-V----------------------------------
A8YX90      RRVLVRK---AQPAVIERDGKSYS-V----------------------------------
F0NWJ8      RRVLVRK---AQPAVIERDGKSYS-V----------------------------------
C6CW36      -------------------------D----------------------------------
A8SQS9      -------------------------M----------------------------------
D5HFS3      -------------------------M----------------------------------
A5Z5P8      DLGY--------------------------------------------------------
G2KUP2      EPGMTKK-----------------------------------------------------
G8PE07      QAGYPGE-----------------------------------------------------
E0NHP5      LPGYKSG-----------------------------------------------------
Q03GL9      QPGYEKG-----------------------------------------------------
C6CSC7      QLGL--------------------------------------------------------
C6CS79      ELGL--------------------------------------------------------
F5LM70      EYGV--------------------------------------------------------
G0LYN8      RYGIER------------------------------------------------------
F6ITB3      RFGIER------------------------------------------------------
G0M1Y0      RFGIER------------------------------------------------------
D7VC12      RYGIER------------------------------------------------------
F9UMZ5      RYGIER------------------------------------------------------
D4JI68      NLNLNE------------------------------------------------------
D6E329      NLNLNE------------------------------------------------------
Q1AUN7      KLGLSE------------------EY----------------------------------
H4GK02      PETSHAN-------------GKAYDL----------------------------------
F6IR92      EHGLRR------------------------------------------------------
G0M0G0      EHGLRR------------------------------------------------------
D7VBW5      ETDIRR------------------------------------------------------
F9UQ55      ETDIRR------------------------------------------------------
B9Y883      -------------------------L----------------------------------
D4YHG8      -------------------------M----------------------------------
F7V793      -------------------------Y----------------------------------
C3WFM8      -------------------------E----------------------------------
H7F1R6      -------------------------Y----------------------------------
H7F570      -------------------------Y----------------------------------
C6LCS6      -------------------------I----------------------------------
A7VF43      -------------------------Y----------------------------------
A7Z922      -------------------------E----------------------------------
I2CAF3      -------------------------E----------------------------------
I2HVL3      -------------------------E----------------------------------
E0U2Z4      -------------------------E----------------------------------
D4G1R3      -------------------------E----------------------------------
G4EQZ6      -------------------------E----------------------------------
P71050      -------------------------E----------------------------------
G4P115      -------------------------E----------------------------------
A8FHM0      -------------------------E----------------------------------
C0EBA5      -------------------------M----------------------------------
F4FXQ8      PAVVKST-------------GTPYDV----------------------------------
C0WV34      PAVVKST-------------GTPYDV----------------------------------
H1LCW2      PAVVKST-------------GTPYDV----------------------------------
B7BDT7      KKVLYGR-------------DCPYTV----------------------------------
H6LKR9      -----GI-------------TGKSSM----------------------------------
F5LE49      -------------------------L----------------------------------
F3AHH1      -------------------------L----------------------------------
F3Y921      ----------------------Q--L----------------------------------
G4L593      ----------------------D--M----------------------------------
E6LD65      ----------------------A--M----------------------------------
C9ALZ8      ----------------------K--M----------------------------------
C9BUG6      ----------------------K--M----------------------------------
Q3XYS7      ----------------------K--M----------------------------------
C9B453      ----------------------K--M----------------------------------
D4RJF5      ----------------------K--M----------------------------------
F0EKB8      ----------------------D--L----------------------------------
C9A6V4      ----------------------D--L----------------------------------
C9CHY7      ----------------------D--L----------------------------------
C8ZXT8      ----------------------K--M----------------------------------
G5IRQ5      ----------------------K--M----------------------------------
E6UHY5      -------------------------Y----------------------------------
E9SAU2      -------------------------Y----------------------------------
F7K0U2      -------------------------M----------------------------------
O06029      -------------------------D----------------------------------
G8P3D6      -------------------------D----------------------------------
A9QSJ3      -------------------------D----------------------------------
F9VC43      -------------------------D----------------------------------
G6FD41      -------------------------D----------------------------------
G9M881      -------------------------D----------------------------------
Q3ZK51      -------------------------D----------------------------------
Q83VG0      -------------------------D----------------------------------
C6LDI9      -------------------------M----------------------------------
G5F9H3      -------------------------M----------------------------------
C0CZV8      -------------------------T----------------------------------
G5GFW1      -------------------------I----------------------------------
I5AV00      ----------------------GGYI----------------------------------
H6NE44      -------------------------L----------------------------------
F4BS20      -------------------------M----------------------------------
E0RZL4      -------------------------M----------------------------------
C0CK72      -------------------------M----------------------------------
D9S1J8      -------------------------T----------------------------------
C2EFR7      -------------------------Y----------------------------------
Q1WTC7      -------------------------Y----------------------------------
B0P2G1      -------------------------M----------------------------------
D4MW28      -------------------------M----------------------------------
E5VMX9      -------------------------M----------------------------------
F2I6Z8      -------------------------V----------------------------------
E6U7N3      -------------------------T----------------------------------
C4Z8M6      -------------------------E----------------------------------
D4JMC3      -------------------------E----------------------------------
D6E0V3      -------------------------E----------------------------------
E3GPC7      -------------------------L----------------------------------
A6BIG6      -------------------------M----------------------------------
C2CI43      -------------------------M----------------------------------
D4RX68      -------------------------Y----------------------------------
D4J4T5      -------------------------I----------------------------------
I5ASF9      -------------------------M----------------------------------
C0C0F9      -------------------------M----------------------------------
B6W7H3      -------------------------M----------------------------------
C7RGH5      -------------------------M----------------------------------
F0GT82      -------------------------M----------------------------------
F3AH93      -------------------------I----------------------------------
B0GAL4      -------------------------M----------------------------------
G1WUK1      -------------------------M----------------------------------
D4M2S1      -------------------------M----------------------------------
E7GL80      -------------------------I----------------------------------
G5F9E3      -------------------------I----------------------------------
D4CG07      -------------------------Y----------------------------------
D4MP31      -------------------------Y----------------------------------
G5HNC6      -------------------------L----------------------------------
A8RK86      -------------------------M----------------------------------
G5HTB1      -------------------------L----------------------------------
A8RSL0      -------------------------L----------------------------------
C5EN02      -------------------------L----------------------------------
G5HG46      -------------------------L----------------------------------
E7GL39      -------------------------M----------------------------------
E7GL56      -------------------------Y----------------------------------
G5F9B0      -------------------------Y----------------------------------
D3AC81      -------------------------L----------------------------------
D3AE79      -------------------------L----------------------------------
D4YF14      -------------------------F----------------------------------
B1YMM6      -------------------------D----------------------------------
D4LG05      -------------------------M----------------------------------
D4LTH3      -------------------------M----------------------------------
F3ATF6      -------------------------M----------------------------------
E0I7B6      -------------------------L----------------------------------
C9LAS2      -------------------------L----------------------------------
F7K8E8      -------------------------L----------------------------------
F7K9V0      -------------------------L----------------------------------
F7KL97      -------------------------L----------------------------------
D3FZP5      -------------------------R----------------------------------
C0ZHV9      -------------------------S----------------------------------
D7WMM9      -------------------------V----------------------------------
A8U9F5      -------------------------L----------------------------------
F4BSE0      -------------------------L----------------------------------
E7RDR2      -------------------------M----------------------------------
I0JRK5      -------------------------M----------------------------------
G2TR26      -------------------------M----------------------------------
D5DBK2      -------------------------S----------------------------------
D5DY80      -------------------------G----------------------------------
A7Z9K1      -------------------------M----------------------------------
I2CB17      -------------------------M----------------------------------
I2HW54      -------------------------M----------------------------------
G4P1M8      -------------------------M----------------------------------
E0TTZ7      -------------------------M----------------------------------
G4EQF2      -------------------------M----------------------------------
P96715      -------------------------M----------------------------------
I0F9R7      -------------------------M----------------------------------
G9QKR5      -------------------------M----------------------------------
B5UQ74      -------------------------I----------------------------------
B7HFH2      -------------------------T----------------------------------
Q72XH7      -------------------------I----------------------------------
C2V4M3      -------------------------I----------------------------------
C2YZB3      -------------------------I----------------------------------
C2P8H2      -------------------------I----------------------------------
C2Y451      -------------------------I----------------------------------
C3EBC1      -------------------------I----------------------------------
C3H980      -------------------------M----------------------------------
C2PN23      -------------------------M----------------------------------
B9IRQ7      -------------------------I----------------------------------
A0RL71      -------------------------M----------------------------------
C2XJI0      -------------------------M----------------------------------
Q3EV65      -------------------------M----------------------------------
C2T8T7      -------------------------M----------------------------------
C2RG50      -------------------------M----------------------------------
Q814Y9      -------------------------M----------------------------------
B3ZRD5      -------------------------M----------------------------------
F0PU65      -------------------------M----------------------------------
Q6HB08      -------------------------M----------------------------------
C2NQN7      -------------------------M----------------------------------
C3GRR1      -------------------------M----------------------------------
C2ULR7      -------------------------M----------------------------------
C3GBJ9      -------------------------M----------------------------------
C2WVG7      -------------------------M----------------------------------
G9QCG2      -------------------------M----------------------------------
C2QJY6      -------------------------M----------------------------------
C2SSX9      -------------------------M----------------------------------
B7IQS9      -------------------------M----------------------------------
A9VRC4      -------------------------M----------------------------------
C2MTG4      -------------------------M----------------------------------
B7HXB5      -------------------------M----------------------------------
C2SBU5      -------------------------M----------------------------------
Q2BFS6      -------------------------I----------------------------------
I3EBB4      -------------------------M----------------------------------
A4ITF4      -------------------------Q----------------------------------
C5D962      -------------------------L----------------------------------
G8MZ94      -------------------------R----------------------------------
Q5KUM4      -------------------------R----------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      -------------------------Q----------------------------------
D9ST43      -------------------------V----------------------------------
H7F5T7      -------------------------Y----------------------------------
G9WIR0      -------------------------Y----------------------------------
D3LB11      -------------------------Y----------------------------------
A0NKF7      -------------------------Y----------------------------------
Q04DV7      -------------------------Y----------------------------------
F6BI63      -------------------------M----------------------------------
G2MWC1      -------------------------L----------------------------------
B0K4N2      -------------------------L----------------------------------
C7ISF8      -------------------------L----------------------------------
B0KAR6      -------------------------L----------------------------------
E8UV30      -------------------------L----------------------------------
C0GGR6      -------------------------M----------------------------------
A4J8V1      -------------------------T----------------------------------
C8VYQ7      -------------------------I----------------------------------
C8W5K3      -------------------------I----------------------------------
B1BNH4      -------------------------Y----------------------------------
B1V1Z3      -------------------------Y----------------------------------
B1R3V2      -------------------------Y----------------------------------
Q0SVR9      -------------------------Y----------------------------------
Q8XN47      -------------------------Y----------------------------------
G7M0Q2      -------------------------V----------------------------------
G7M565      -------------------------L----------------------------------
A6M2M0      -------------------------L----------------------------------
G7M1R8      -------------------------I----------------------------------
A5V0I4      -------------------------R----------------------------------
A7NQ70      -------------------------R----------------------------------
Q4JZ56      -------------------------S----------------------------------
Q7X554      -------------------------L----------------------------------
Q7X550      -------------------------M----------------------------------
Q7X562      -------------------------M----------------------------------
Q7X556      -------------------------L----------------------------------
Q7X552      -------------------------L----------------------------------
Q7X558      -------------------------L----------------------------------
C5NWJ9      -------------------------I----------------------------------
F3A498      -------------------------L----------------------------------
Q9AHD3      -------------------------L----------------------------------
Q4K2E2      -------------------------M----------------------------------
Q4K2F8      -------------------------M----------------------------------
Q4K046      -------------------------M----------------------------------
Q4K0R8      -------------------------M----------------------------------
Q4JYY0      -------------------------M----------------------------------
Q4JZW8      -------------------------M----------------------------------
I0J9C8      -------------------------M----------------------------------
Q4K0M4      -------------------------M----------------------------------
Q4JZS4      -------------------------M----------------------------------
Q4JZK2      -------------------------M----------------------------------
Q9AHA5      -------------------------M----------------------------------
Q9X9A0      -------------------------M----------------------------------
Q4JYK9      -------------------------M----------------------------------
Q4K006      -------------------------M----------------------------------
Q4JZG8      -------------------------M----------------------------------
A6YIA7      -------------------------M----------------------------------
E5F5C4      -------------------------M----------------------------------
Q9AHB8      -------------------------M----------------------------------
Q4JZL8      -------------------------I----------------------------------
Q4K1B8      -------------------------M----------------------------------
Q8VU32      -------------------------M----------------------------------
D2ERX9      -------------------------M----------------------------------
G6C7Z0      -------------------------M----------------------------------
Q4K2A9      -------------------------M----------------------------------
D6ZQI7      -------------------------I----------------------------------
Q9ZFT9      -------------------------M----------------------------------
Q4K255      -------------------------M----------------------------------
F9HJP7      -------------------------S----------------------------------
E8JWI4      -------------------------G----------------------------------
A8AZR4      -------------------------G----------------------------------
D0RXH3      -------------------------G----------------------------------
Q83YR6      -------------------------G----------------------------------
F1Z125      -------------------------M----------------------------------
Q3K0S9      -------------------------Y----------------------------------
P0C0T8      -------------------------Y----------------------------------
Q67AY5      -------------------------Y----------------------------------
Q04662      -------------------------Y----------------------------------
Q8GP93      -------------------------M----------------------------------
Q8GPF7      -------------------------L----------------------------------
E3CP61      -------------------------M----------------------------------
E8KUY7      -------------------------M----------------------------------
C2LSE5      -------------------------M----------------------------------
E9DM16      -------------------------M----------------------------------
I0QIK5      -------------------------M----------------------------------
Q7X560      -------------------------M----------------------------------
Q8GMA6      -------------------------L----------------------------------
Q55204      -------------------------M----------------------------------
Q8GPC4      -------------------------M----------------------------------
Q8GPA9      -------------------------M----------------------------------
G6ERT2      -------------------------L----------------------------------
O87930      -------------------------L----------------------------------
Q8GP55      -------------------------L----------------------------------
F8HDC4      -------------------------L----------------------------------
F8LJ76      -------------------------L----------------------------------
F8LXJ5      -------------------------M----------------------------------
Q1WCR2      -------------------------M----------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      -------------------------L----------------------------------
F5X651      -------------------------L----------------------------------
G5JTD6      -------------------------I----------------------------------
Q2KM75      -------------------------M----------------------------------
G5KAJ3      -------------------------L----------------------------------
B9DUJ5      -------------------------L----------------------------------
G5KD12      -------------------------L----------------------------------
E8JMT8      -------------------------L----------------------------------
F5X0J8      -------------------------L----------------------------------
H2A601      -------------------------L----------------------------------
E7S8W2      -------------------------M----------------------------------
F8DFF5      -------------------------M----------------------------------
I1ZPH8      -------------------------M----------------------------------
E3CBR9      -------------------------L----------------------------------
E8K787      -------------------------M----------------------------------
F9M365      -------------------------L----------------------------------
A3CQY3      -------------------------T----------------------------------
E8KLZ0      -------------------------T----------------------------------
F0FHA9      -------------------------T----------------------------------
F0FQQ4      -------------------------T----------------------------------
F0I4H6      -------------------------T----------------------------------
F0IAY2      -------------------------T----------------------------------
F0IJI1      -------------------------T----------------------------------
F0IS52      -------------------------T----------------------------------
F2C9N1      -------------------------T----------------------------------
F2CH54      -------------------------T----------------------------------
F3UDW8      -------------------------T----------------------------------
F3UNJ5      -------------------------T----------------------------------
F3SM33      -------------------------T----------------------------------
F9HC66      -------------------------K----------------------------------
E1LQJ6      -------------------------K----------------------------------
Q4JYU0      -------------------------K----------------------------------
Q4JZY2      -------------------------K----------------------------------
F9Q346      -------------------------L----------------------------------
Q6L5R1      -------------------------L----------------------------------
E9FEC6      -------------------------L----------------------------------
E0Q2S9      -------------------------L----------------------------------
F5VSH0      -------------------------L----------------------------------
A5YTV6      -------------------------L----------------------------------
Q6L5T1      -------------------------L----------------------------------
E0PPH8      -------------------------L----------------------------------
A5YTT8      -------------------------L----------------------------------
E6KKR9      -------------------------L----------------------------------
A1ILY0      -------------------------L----------------------------------
F2QF91      -------------------------L----------------------------------
Q4K0I3      -------------------------I----------------------------------
Q8KWQ1      -------------------------M----------------------------------
Q4K238      -------------------------I----------------------------------
B1I966      -------------------------I----------------------------------
G6J8A3      -------------------------I----------------------------------
G6LKG4      -------------------------I----------------------------------
F9LZC3      -------------------------M----------------------------------
F9P1W9      -------------------------M----------------------------------
A5LJR9      -------------------------M----------------------------------
Q9ZII7      -------------------------M----------------------------------
Q4K1K7      -------------------------L----------------------------------
E1LPE6      -------------------------L----------------------------------
F9MJW6      -------------------------L----------------------------------
Q4K0V3      -------------------------L----------------------------------
Q54519      -------------------------L----------------------------------
C1CBD0      -------------------------L----------------------------------
Q7WVX1      -------------------------L----------------------------------
Q4K0E2      -------------------------L----------------------------------
Q9AH96      -------------------------L----------------------------------
A5M4L2      -------------------------L----------------------------------
B2ILP4      -------------------------L----------------------------------
C1CCB8      -------------------------L----------------------------------
P72511      -------------------------L----------------------------------
Q4K1S8      -------------------------L----------------------------------
P96474      -------------------------L----------------------------------
Q4K196      -------------------------L----------------------------------
Q4K0Z7      -------------------------L----------------------------------
Q4JZ85      -------------------------L----------------------------------
Q4JYH6      -------------------------L----------------------------------
Q4JZ19      -------------------------L----------------------------------
Q4K0A1      -------------------------L----------------------------------
Q4K1M5      -------------------------L----------------------------------
Q4K2Q8      -------------------------L----------------------------------
Q4K1G0      -------------------------L----------------------------------
Q4K0T6      -------------------------L----------------------------------
Q4K0K3      -------------------------L----------------------------------
Q4K0X6      -------------------------L----------------------------------
E8KDN1      -------------------------F----------------------------------
F9PEU3      -------------------------M----------------------------------
E8K321      -------------------------I----------------------------------
F9PZP6      -------------------------M----------------------------------
D6R2T7      -------------------------I----------------------------------
F3UUQ1      -------------------------I----------------------------------
E6IZC3      -------------------------M----------------------------------
G6A746      -------------------------M----------------------------------
B1V0N8      -------------------------L----------------------------------
B1BNK2      -------------------------L----------------------------------
B1R3X7      -------------------------L----------------------------------
Q8XN77      -------------------------L----------------------------------
A3ICA4      -------------------------T----------------------------------
B1HR40      -------------------------T----------------------------------
H1BJT0      -------------------------L----------------------------------
F8FCE3      -------------------------L----------------------------------
I0BSG5      -------------------------L----------------------------------
A8YPQ6      -------------------------Y----------------------------------
P95695      -------------------------Y----------------------------------
Q2G1K8      -------------------------Y----------------------------------
C5QNG5      -------------------------Y----------------------------------
Q4L9H8      -------------------------Y----------------------------------
Q2FUV1      -------------------------Y----------------------------------
P39850      -------------------------Y----------------------------------
D7UYE3      -------------------------F----------------------------------
Q4A121      -------------------------Y----------------------------------
E3HB17      -------------------------A----------------------------------
C9AAE4      -------------------------Y----------------------------------
H7F6C7      -------------------------Y----------------------------------
F0SX23      -------------------------E----------------------------------
Q38VG4      -------------------------L----------------------------------
F2I4B6      -------------------------E----------------------------------
Q8RBS6      -------------------------M----------------------------------
D9SR42      -------------------------M----------------------------------
D9SVC8      -------------------------Y----------------------------------
E7RG09      -------------------------M----------------------------------
D4G2E2      -------------------------M----------------------------------
Q8EME7      -------------------------L----------------------------------
D6Y035      -------------------------E----------------------------------
Q5WBB3      -------------------------M----------------------------------
Q9K6Q9      -------------------------D----------------------------------
Q97EP7      -------------------------T----------------------------------
Q97ER4      -------------------------T----------------------------------
E4S7Y7      -------------------------I----------------------------------
E4Q5T6      -------------------------M----------------------------------
E4SDX3      -------------------------M----------------------------------
G2FWX3      -------------------------L----------------------------------
G7WJV2      -------------------------L----------------------------------
G7W774      -------------------------L----------------------------------
G2FM60      -------------------------L----------------------------------
H5XZD5      -------------------------L----------------------------------
I4DBG9      -------------------------L----------------------------------
G2FWT7      -------------------------L----------------------------------
H5XZG8      -------------------------L----------------------------------
G0V448      -------------------------V----------------------------------
A0PZ01      -------------------------V----------------------------------
B1B737      -------------------------V----------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------TDSKL-
B7B948      LSGFTLGDQEVSDGKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVA
G8AU95      ------------------------------------------------------GNDVLR
G5IFS2      ------------------------------------------------------LLRKLT
F0G6H6      ------------------------------------------------------DVPKRL
F6CNF6      ------------------------------------------------------YTPRTL
A3W0H6      ------------------------------------------------------PMAEKV
A3K8W6      ------------------------------------------------------NDGERI
Q0FMP1      ------------------------------------------------------SVGQRL
S9QRP2      ------------------------------------------------------TMNERV
D0D9W1      ------------------------------------------------------TLNERV
I1AYC4      ------------------------------------------------------SLNERV
E9TE87      FTLNVLDNKNYTLSSDGGFSARGQAGQMLKKEGVTLMVEAIHARPGSEFTVTKYSTLGMI
E6PYQ4      ------------------------------------------------------SRDRLV
C0QCJ1      ------------------------------------------------------YLEDKI
I5B297      ------------------------------------------------------YQEEKI
B8D0N1      ------------------------------------------------------ENKVSV
D9QTC7      ------------------------------------------------------ISPQAL
C7LPS4      ------------------------------------------------------DREAYI
Q314L4      ------------------------------------------------------ALEERI
G0VNK5      ------------------------------------------------------ELPDYE
D2RIR1      ------------------------------------------------------KYPRYE
I0GRR3      ------------------------------------------------------KLPSYE
Q39U16      ------------------------------------------------------EMEGLV
F0JCB9      ------------------------------------------------------SLDSTI
G7QCG0      ------------------------------------------------------DQEVYI
I2Q342      ------------------------------------------------------DQEVYI
Q74BQ7      ------------------------------------------------------EIEARV
B5EA80      ------------------------------------------------------ETEELI
C6DZX6      ------------------------------------------------------ETEELI
A1ARV9      ------------------------------------------------------DMEALY
E8WSZ4      --------------------------------------------------------EELI
A5G425      ------------------------------------------------------QLEELV
B9M2X7      --------------------------------------------------------DTLI
C2MBF7      ------------------------------------------------------REKDLY
H8YYB8      ------------------------------------------------------IELEMI
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------TYESL-
E3H7M4      ------------------------------------------------------SPESL-
C2EWM2      ------------------------------------------------------TTAQL-
D0DSJ3      ------------------------------------------------------SVAKL-
B2GF32      ------------------------------------------------------SVAKL-
C0WW25      ------------------------------------------------------SVAKL-
F8KGP2      ------------------------------------------------------STAEL-
B3XL22      ------------------------------------------------------STDEL-
F8DRU3      ------------------------------------------------------STAEL-
B1MZT2      ------------------------------------------------------TVDQL-
H1WR07      ------------------------------------------------------TVDQL-
Q03W94      ------------------------------------------------------SVEEL-
C2KHF2      ------------------------------------------------------SVDEL-
H1X4N3      ------------------------------------------------------SVDEL-
C2JZS0      ------------------------------------------------------TESDI-
C1J9I2      ------------------------------------------------------SEEDL-
Q58Z11      ------------------------------------------------------SEDDL-
F0K0J8      ------------------------------------------------------SASEL-
G6F8H0      ------------------------------------------------------SANEL-
Q1G8E3      ------------------------------------------------------SASEL-
D8FLF7      ------------------------------------------------------SASEL-
F0HVF2      ------------------------------------------------------SPSEL-
Q5FIC6      ------------------------------------------------------SASEL-
E4SMV6      ------------------------------------------------------SAKEL-
F0TGY3      ------------------------------------------------------SAKEL-
F2M2M7      ------------------------------------------------------SAKEL-
C4VP07      ------------------------------------------------------SATQL-
D6S4X3      ------------------------------------------------------SATEL-
A4ZGZ7      ------------------------------------------------------SASQL-
C2EPK4      ------------------------------------------------------SAKQL-
C7XKF2      ------------------------------------------------------STSEL-
E3R265      ------------------------------------------------------STSEL-
D0DJG9      ------------------------------------------------------STSEL-
D5GZJ9      ------------------------------------------------------STSEL-
A8YX90      ------------------------------------------------------SASQL-
F0NWJ8      ------------------------------------------------------SASQL-
C6CW36      ------------------------------------------------------SSYEM-
A8SQS9      ------------------------------------------------------DSEQL-
D5HFS3      ------------------------------------------------------DSEGL-
A5Z5P8      ------------------------------------------------------TYEQL-
G2KUP2      ------------------------------------------------------------
G8PE07      --------------------------------------------------------NGM-
E0NHP5      -------------------------------------------------------VDNL-
Q03GL9      ------------------------------------------------------DVDSL-
C6CSC7      ------------------------------------------------------SAKEL-
C6CS79      ------------------------------------------------------TTQQL-
F5LM70      ------------------------------------------------------TSDDL-
G0LYN8      ------------------------------------------------------SLSTL-
F6ITB3      ------------------------------------------------------SLNTL-
G0M1Y0      ------------------------------------------------------SLNTL-
D7VC12      ------------------------------------------------------SLNSL-
F9UMZ5      ------------------------------------------------------SLNTL-
D4JI68      ------------------------------------------------------SYKTL-
D6E329      ------------------------------------------------------SYKTL-
Q1AUN7      ------------------------------------------------------AQKTL-
H4GK02      ------------------------------------------------------SVAEL-
F6IR92      ------------------------------------------------------SVNTL-
G0M0G0      ------------------------------------------------------SVNTL-
D7VBW5      ------------------------------------------------------SLESL-
F9UQ55      ------------------------------------------------------SLESL-
B9Y883      ------------------------------------------------------DTEGY-
D4YHG8      ------------------------------------------------------TAAEL-
F7V793      ------------------------------------------------------DYKQL-
C3WFM8      ------------------------------------------------------TTEQL-
H7F1R6      ------------------------------------------------------SIKEL-
H7F570      ------------------------------------------------------SVKEL-
C6LCS6      ------------------------------------------------------SYEEL-
A7VF43      ------------------------------------------------------DYEQL-
A7Z922      ------------------------------------------------------TASAL-
I2CAF3      ------------------------------------------------------TASAL-
I2HVL3      ------------------------------------------------------TASAL-
E0U2Z4      ------------------------------------------------------SASSL-
D4G1R3      ------------------------------------------------------SASSL-
G4EQZ6      ------------------------------------------------------SASSL-
P71050      ------------------------------------------------------SASSL-
G4P115      ------------------------------------------------------SASSL-
A8FHM0      ------------------------------------------------------SAEGL-
C0EBA5      ------------------------------------------------------TVGQV-
F4FXQ8      ------------------------------------------------------SVKQL-
C0WV34      ------------------------------------------------------SVKQL-
H1LCW2      ------------------------------------------------------SVKQL-
B7BDT7      ------------------------------------------------------DFNDLQ
H6LKR9      ------------------------------------------------------TYTDF-
F5LE49      ------------------------------------------------------TSDML-
F3AHH1      ------------------------------------------------------KPEQL-
F3Y921      ------------------------------------------------------STEEL-
G4L593      ------------------------------------------------------TIREI-
E6LD65      ------------------------------------------------------EPKEI-
C9ALZ8      ------------------------------------------------------TAGQI-
C9BUG6      ------------------------------------------------------TAEQI-
Q3XYS7      ------------------------------------------------------TAGQI-
C9B453      ------------------------------------------------------TAGQI-
D4RJF5      ------------------------------------------------------TAEQI-
F0EKB8      ------------------------------------------------------TVGQL-
C9A6V4      ------------------------------------------------------TVGQL-
C9CHY7      ------------------------------------------------------TVGQL-
C8ZXT8      ------------------------------------------------------TAGEI-
G5IRQ5      ------------------------------------------------------TAGEI-
E6UHY5      ------------------------------------------------------DVDDLK
E9SAU2      ------------------------------------------------------KIEDLR
F7K0U2      ------------------------------------------------------SVDKL-
O06029      ------------------------------------------------------D--SF-
G8P3D6      ------------------------------------------------------D--SF-
A9QSJ3      ------------------------------------------------------D--SF-
F9VC43      ------------------------------------------------------D--AF-
G6FD41      ------------------------------------------------------D--SF-
G9M881      ------------------------------------------------------D--SF-
Q3ZK51      ------------------------------------------------------D--SF-
Q83VG0      ------------------------------------------------------D--SF-
C6LDI9      ------------------------------------------------------TYENL-
G5F9H3      ------------------------------------------------------TYREL-
C0CZV8      ------------------------------------------------------TYKDL-
G5GFW1      ------------------------------------------------------DYKEL-
I5AV00      ------------------------------------------------------SPSAI-
H6NE44      ------------------------------------------------------TPEQM-
F4BS20      ------------------------------------------------------SEVEL-
E0RZL4      ------------------------------------------------------EYKDL-
C0CK72      ------------------------------------------------------DYKEL-
D9S1J8      ------------------------------------------------------TYEKL-
C2EFR7      ------------------------------------------------------SYGEL-
Q1WTC7      ------------------------------------------------------SYGEL-
B0P2G1      ------------------------------------------------------DYKEL-
D4MW28      ------------------------------------------------------DYKEL-
E5VMX9      ------------------------------------------------------DYKEL-
F2I6Z8      --------------------------------------------------------ETL-
E6U7N3      ------------------------------------------------------DASAL-
C4Z8M6      ------------------------------------------------------SYKTL-
D4JMC3      ------------------------------------------------------TYEQL-
D6E0V3      ------------------------------------------------------TYEQL-
E3GPC7      ------------------------------------------------------SDGQL-
A6BIG6      ------------------------------------------------------EPEDL-
C2CI43      ------------------------------------------------------DYEEF-
D4RX68      ------------------------------------------------------SVGEL-
D4J4T5      ------------------------------------------------------DYQQL-
I5ASF9      ------------------------------------------------------DYKEL-
C0C0F9      ------------------------------------------------------EAEEL-
B6W7H3      ------------------------------------------------------DYGDF-
C7RGH5      ------------------------------------------------------DYEEF-
F0GT82      ------------------------------------------------------GYEEF-
F3AH93      ------------------------------------------------------SPNAL-
B0GAL4      ------------------------------------------------------DYKQL-
G1WUK1      ------------------------------------------------------DYKQL-
D4M2S1      ------------------------------------------------------TYKEL-
E7GL80      ------------------------------------------------------TYRQL-
G5F9E3      ------------------------------------------------------TYRQL-
D4CG07      ------------------------------------------------------GYKAL-
D4MP31      ------------------------------------------------------GYKAL-
G5HNC6      ------------------------------------------------------TYDQL-
A8RK86      ------------------------------------------------------TYGQL-
G5HTB1      ------------------------------------------------------SYTQL-
A8RSL0      ------------------------------------------------------TYKEL-
C5EN02      ------------------------------------------------------TYKEL-
G5HG46      ------------------------------------------------------TYKDL-
E7GL39      ------------------------------------------------------TYREL-
E7GL56      ------------------------------------------------------SYKEL-
G5F9B0      ------------------------------------------------------SYKEL-
D3AC81      ------------------------------------------------------SHEQL-
D3AE79      ------------------------------------------------------GYQQL-
D4YF14      ------------------------------------------------------TVPQL-
B1YMM6      ------------------------------------------------------SISAL-
D4LG05      ------------------------------------------------------DYEDL-
D4LTH3      ------------------------------------------------------DYNQL-
F3ATF6      ------------------------------------------------------NHHQL-
E0I7B6      ------------------------------------------------------SSDQL-
C9LAS2      ------------------------------------------------------PYEEL-
F7K8E8      ------------------------------------------------------SYEEM-
F7K9V0      ------------------------------------------------------SYEEM-
F7KL97      ------------------------------------------------------SYDEM-
D3FZP5      ------------------------------------------------------THGQL-
C0ZHV9      ------------------------------------------------------TMEEL-
D7WMM9      ------------------------------------------------------TPEVL-
A8U9F5      ------------------------------------------------------TTTEL-
F4BSE0      ------------------------------------------------------TTIEL-
E7RDR2      ------------------------------------------------------SVEQL-
I0JRK5      ------------------------------------------------------TSATL-
G2TR26      ------------------------------------------------------TTDEL-
D5DBK2      ------------------------------------------------------SAKSL-
D5DY80      ------------------------------------------------------SGQSL-
A7Z9K1      ------------------------------------------------------TSKEL-
I2CB17      ------------------------------------------------------TSKEL-
I2HW54      ------------------------------------------------------TSKEL-
G4P1M8      ------------------------------------------------------TSQEL-
E0TTZ7      ------------------------------------------------------TSQEL-
G4EQF2      ------------------------------------------------------TSQEL-
P96715      ------------------------------------------------------TSQEL-
I0F9R7      ------------------------------------------------------TSQEL-
G9QKR5      ------------------------------------------------------TTDTL-
B5UQ74      ------------------------------------------------------PVQEL-
B7HFH2      ------------------------------------------------------TVQAL-
Q72XH7      ------------------------------------------------------TIQEL-
C2V4M3      ------------------------------------------------------ATQEL-
C2YZB3      ------------------------------------------------------TTQEL-
C2P8H2      ------------------------------------------------------TVQEL-
C2Y451      ------------------------------------------------------TVQEL-
C3EBC1      ------------------------------------------------------TVQEL-
C3H980      ------------------------------------------------------TVQEL-
C2PN23      ------------------------------------------------------TAQDL-
B9IRQ7      ------------------------------------------------------TIQDL-
A0RL71      ------------------------------------------------------TAQAL-
C2XJI0      ------------------------------------------------------TAQEL-
Q3EV65      ------------------------------------------------------TAQEL-
C2T8T7      ------------------------------------------------------TAQAL-
C2RG50      ------------------------------------------------------TAQAL-
Q814Y9      ------------------------------------------------------TAQAL-
B3ZRD5      ------------------------------------------------------TAQAL-
F0PU65      ------------------------------------------------------TAQAL-
Q6HB08      ------------------------------------------------------TAQAL-
C2NQN7      ------------------------------------------------------TAQAL-
C3GRR1      ------------------------------------------------------TAQAL-
C2ULR7      ------------------------------------------------------TAQAL-
C3GBJ9      ------------------------------------------------------TMQEL-
C2WVG7      ------------------------------------------------------TAQAL-
G9QCG2      ------------------------------------------------------TAQAL-
C2QJY6      ------------------------------------------------------TAQSL-
C2SSX9      ------------------------------------------------------TAQAL-
B7IQS9      ------------------------------------------------------TSQAL-
A9VRC4      ------------------------------------------------------TAQAL-
C2MTG4      ------------------------------------------------------TAQAL-
B7HXB5      ------------------------------------------------------TAQAL-
C2SBU5      ------------------------------------------------------TAQAL-
Q2BFS6      ------------------------------------------------------TTSQL-
I3EBB4      ------------------------------------------------------TTEEL-
A4ITF4      ------------------------------------------------------TLDEL-
C5D962      ------------------------------------------------------TVDEL-
G8MZ94      ------------------------------------------------------TLDEL-
Q5KUM4      ------------------------------------------------------TLDEL-
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------SVKQL-
D9ST43      ------------------------------------------------------STKDI-
H7F5T7      ------------------------------------------------------TASQL-
G9WIR0      ------------------------------------------------------PDISSS
D3LB11      ------------------------------------------------------PSLTST
A0NKF7      ------------------------------------------------------PTLTST
Q04DV7      ------------------------------------------------------PTLTST
F6BI63      ------------------------------------------------------TTDQL-
G2MWC1      ------------------------------------------------------TVDQL-
B0K4N2      ------------------------------------------------------TVDQL-
C7ISF8      ------------------------------------------------------TVDQL-
B0KAR6      ------------------------------------------------------TVDQL-
E8UV30      ------------------------------------------------------TVDQL-
C0GGR6      ------------------------------------------------------SVNQL-
A4J8V1      ------------------------------------------------------TYEQL-
C8VYQ7      ------------------------------------------------------TPEAF-
C8W5K3      ------------------------------------------------------TPDQF-
B1BNH4      ------------------------------------------------------NQEDIK
B1V1Z3      ------------------------------------------------------NQEDIK
B1R3V2      ------------------------------------------------------NQKDIK
Q0SVR9      ------------------------------------------------------NQNEIK
Q8XN47      ------------------------------------------------------NQKEIK
G7M0Q2      ------------------------------------------------------KPNDV-
G7M565      ------------------------------------------------------SSDKI-
A6M2M0      ------------------------------------------------------NSENV-
G7M1R8      ------------------------------------------------------NSQDV-
A5V0I4      ------------------------------------------------------TPEWL-
A7NQ70      ------------------------------------------------------TPEWL-
Q4JZ56      ------------------------------------------------------TLESL-
Q7X554      ------------------------------------------------------SEAQL-
Q7X550      ------------------------------------------------------TEAEL-
Q7X562      ------------------------------------------------------TEAEL-
Q7X556      ------------------------------------------------------SEAKL-
Q7X552      ------------------------------------------------------SEAEL-
Q7X558      ------------------------------------------------------SEAEL-
C5NWJ9      ------------------------------------------------------TARQL-
F3A498      ------------------------------------------------------TAKQL-
Q9AHD3      ------------------------------------------------------TPKGL-
Q4K2E2      ------------------------------------------------------PTKNL-
Q4K2F8      ------------------------------------------------------PTKNL-
Q4K046      ------------------------------------------------------PAKTL-
Q4K0R8      ------------------------------------------------------PARAL-
Q4JYY0      ------------------------------------------------------PAKTL-
Q4JZW8      ------------------------------------------------------PAKTL-
I0J9C8      ------------------------------------------------------PTKTL-
Q4K0M4      ------------------------------------------------------PTKTL-
Q4JZS4      ------------------------------------------------------PAKTL-
Q4JZK2      ------------------------------------------------------PAKTL-
Q9AHA5      ------------------------------------------------------PAKTL-
Q9X9A0      ------------------------------------------------------PAKTL-
Q4JYK9      ------------------------------------------------------PAKTL-
Q4K006      ------------------------------------------------------PAKTL-
Q4JZG8      ------------------------------------------------------PAKTL-
A6YIA7      ------------------------------------------------------PAKTL-
E5F5C4      ------------------------------------------------------PAKTL-
Q9AHB8      ------------------------------------------------------PAKTL-
Q4JZL8      ------------------------------------------------------PAKTL-
Q4K1B8      ------------------------------------------------------PAKTL-
Q8VU32      ------------------------------------------------------PAKAL-
D2ERX9      ------------------------------------------------------PAKTL-
G6C7Z0      ------------------------------------------------------PVKTL-
Q4K2A9      ------------------------------------------------------PAKAL-
D6ZQI7      ------------------------------------------------------PAKTL-
Q9ZFT9      ------------------------------------------------------PAKTL-
Q4K255      ------------------------------------------------------PAKTL-
F9HJP7      ------------------------------------------------------TTADL-
E8JWI4      ------------------------------------------------------SPSDL-
A8AZR4      ------------------------------------------------------TTAEI-
D0RXH3      ------------------------------------------------------TTAEL-
Q83YR6      ------------------------------------------------------TTAEL-
F1Z125      ------------------------------------------------------TPEEL-
Q3K0S9      ------------------------------------------------------PSSQL-
P0C0T8      ------------------------------------------------------PSSQL-
Q67AY5      ------------------------------------------------------PSSQL-
Q04662      ------------------------------------------------------PSSQL-
Q8GP93      ------------------------------------------------------TEAEL-
Q8GPF7      ------------------------------------------------------SETEL-
E3CP61      ------------------------------------------------------TEAEL-
E8KUY7      ------------------------------------------------------TEAEL-
C2LSE5      ------------------------------------------------------TEAEL-
E9DM16      ------------------------------------------------------TEADL-
I0QIK5      ------------------------------------------------------TEADL-
Q7X560      ------------------------------------------------------TEAEL-
Q8GMA6      ------------------------------------------------------SEAEL-
Q55204      ------------------------------------------------------TEAEL-
Q8GPC4      ------------------------------------------------------TEAEL-
Q8GPA9      ------------------------------------------------------TEAEL-
G6ERT2      ------------------------------------------------------SEAEL-
O87930      ------------------------------------------------------SEAEL-
Q8GP55      ------------------------------------------------------SETEL-
F8HDC4      ------------------------------------------------------SEAEL-
F8LJ76      ------------------------------------------------------SEAEL-
F8LXJ5      ------------------------------------------------------TEAEL-
Q1WCR2      ------------------------------------------------------TEAEL-
G3G7C0      --------------------------------------------------------ENL-
G3G7J8      --------------------------------------------------------ENL-
G7SNU7      --------------------------------------------------------ESL-
G8DU30      --------------------------------------------------------ESL-
A4VTU2      --------------------------------------------------------ESL-
D5AGQ4      --------------------------------------------------------ESL-
Q9X4U6      --------------------------------------------------------ESL-
G3G7G5      --------------------------------------------------------ESL-
G7SG35      --------------------------------------------------------ENL-
G8DU06      --------------------------------------------------------ENL-
G8DUA9      --------------------------------------------------------ENL-
G8DTY9      --------------------------------------------------------ENL-
G3G7I7      --------------------------------------------------------ESL-
G3G7J3      --------------------------------------------------------EDI-
E0PD82      ------------------------------------------------------STSEL-
F5X651      ------------------------------------------------------STSEL-
G5JTD6      ------------------------------------------------------SSDEL-
Q2KM75      ------------------------------------------------------SPEEL-
G5KAJ3      ------------------------------------------------------TPEQL-
B9DUJ5      ------------------------------------------------------SPDTL-
G5KD12      ------------------------------------------------------TPEQL-
E8JMT8      ------------------------------------------------------STSEL-
F5X0J8      ------------------------------------------------------STSEL-
H2A601      ------------------------------------------------------STSEL-
E7S8W2      ------------------------------------------------------TPAEL-
F8DFF5      ------------------------------------------------------TPAEL-
I1ZPH8      ------------------------------------------------------TPAEL-
E3CBR9      ------------------------------------------------------TPAEL-
E8K787      ------------------------------------------------------TPAEL-
F9M365      ------------------------------------------------------TPAEL-
A3CQY3      ------------------------------------------------------SPREL-
E8KLZ0      ------------------------------------------------------SPREL-
F0FHA9      ------------------------------------------------------SPREL-
F0FQQ4      ------------------------------------------------------SPREL-
F0I4H6      ------------------------------------------------------SPREL-
F0IAY2      ------------------------------------------------------SPREL-
F0IJI1      ------------------------------------------------------SPREL-
F0IS52      ------------------------------------------------------SPREL-
F2C9N1      ------------------------------------------------------SPREL-
F2CH54      ------------------------------------------------------SPREL-
F3UDW8      ------------------------------------------------------SPREL-
F3UNJ5      ------------------------------------------------------SPREL-
F3SM33      ------------------------------------------------------SPRKL-
F9HC66      ------------------------------------------------------TVKEL-
E1LQJ6      ------------------------------------------------------TVREL-
Q4JYU0      ------------------------------------------------------TVKEL-
Q4JZY2      ------------------------------------------------------TVKEL-
F9Q346      ------------------------------------------------------PSKGL-
Q6L5R1      ------------------------------------------------------PSKGL-
E9FEC6      ------------------------------------------------------PPKGL-
E0Q2S9      ------------------------------------------------------PPKDL-
F5VSH0      ------------------------------------------------------PPKDL-
A5YTV6      ------------------------------------------------------PPKGL-
Q6L5T1      ------------------------------------------------------PPKGL-
E0PPH8      ------------------------------------------------------PPKDL-
A5YTT8      ------------------------------------------------------PPKGL-
E6KKR9      ------------------------------------------------------PPKGL-
A1ILY0      ------------------------------------------------------PPKGL-
F2QF91      ------------------------------------------------------PPKGL-
Q4K0I3      ------------------------------------------------------PVKTL-
Q8KWQ1      ------------------------------------------------------PAKTL-
Q4K238      ------------------------------------------------------PAKTL-
B1I966      ------------------------------------------------------PAKTL-
G6J8A3      ------------------------------------------------------PAKTL-
G6LKG4      ------------------------------------------------------PAKTL-
F9LZC3      ------------------------------------------------------PAKTL-
F9P1W9      ------------------------------------------------------AAKTL-
A5LJR9      ------------------------------------------------------PAKTL-
Q9ZII7      ------------------------------------------------------PAKTL-
Q4K1K7      ------------------------------------------------------TPKGL-
E1LPE6      ------------------------------------------------------TPKGL-
F9MJW6      ------------------------------------------------------TPKGL-
Q4K0V3      ------------------------------------------------------TPKDL-
Q54519      ------------------------------------------------------TPKDL-
C1CBD0      ------------------------------------------------------TPKGL-
Q7WVX1      ------------------------------------------------------TPKGL-
Q4K0E2      ------------------------------------------------------TPKGL-
Q9AH96      ------------------------------------------------------TPKGL-
A5M4L2      ------------------------------------------------------TPKGL-
B2ILP4      ------------------------------------------------------TPKGL-
C1CCB8      ------------------------------------------------------TPKGL-
P72511      ------------------------------------------------------TPKGL-
Q4K1S8      ------------------------------------------------------TPKGL-
P96474      ------------------------------------------------------MPKGL-
Q4K196      ------------------------------------------------------TPKGL-
Q4K0Z7      ------------------------------------------------------TPKGL-
Q4JZ85      ------------------------------------------------------TPKGL-
Q4JYH6      ------------------------------------------------------TPKGL-
Q4JZ19      ------------------------------------------------------TPKGL-
Q4K0A1      ------------------------------------------------------TPKGL-
Q4K1M5      ------------------------------------------------------TPKGL-
Q4K2Q8      ------------------------------------------------------TPKGL-
Q4K1G0      ------------------------------------------------------TPKGL-
Q4K0T6      ------------------------------------------------------TPKGL-
Q4K0K3      ------------------------------------------------------TPKGL-
Q4K0X6      ------------------------------------------------------TPKGL-
E8KDN1      ------------------------------------------------------DAKAL-
F9PEU3      ------------------------------------------------------DAKTL-
E8K321      ------------------------------------------------------DAKTL-
F9PZP6      ------------------------------------------------------DAKTL-
D6R2T7      ------------------------------------------------------SPAEL-
F3UUQ1      ------------------------------------------------------SPAEL-
E6IZC3      ------------------------------------------------------QPSAL-
G6A746      ------------------------------------------------------QPSAL-
B1V0N8      ------------------------------------------------------PTNYV-
B1BNK2      ------------------------------------------------------PTNYV-
B1R3X7      ------------------------------------------------------PTNYV-
Q8XN77      ------------------------------------------------------PTNYV-
A3ICA4      ------------------------------------------------------SPETL-
B1HR40      ------------------------------------------------------SPETL-
H1BJT0      ------------------------------------------------------VDGTC-
F8FCE3      ------------------------------------------------------TPEQM-
I0BSG5      ------------------------------------------------------TPEQM-
A8YPQ6      ------------------------------------------------------SPSKL-
P95695      ------------------------------------------------------SPSKL-
Q2G1K8      ------------------------------------------------------SPSKL-
C5QNG5      ------------------------------------------------------SADKL-
Q4L9H8      ------------------------------------------------------SSDEI-
Q2FUV1      ------------------------------------------------------STAEL-
P39850      ------------------------------------------------------SRSEI-
D7UYE3      ------------------------------------------------------SSSEI-
Q4A121      ------------------------------------------------------SSEEI-
E3HB17      ------------------------------------------------------EPEEI-
C9AAE4      ------------------------------------------------------DVAEL-
H7F6C7      ------------------------------------------------------DTAEL-
F0SX23      ------------------------------------------------------QTKKI-
Q38VG4      ------------------------------------------------------SNDEI-
F2I4B6      ------------------------------------------------------NPDQL-
Q8RBS6      ------------------------------------------------------SVEDL-
D9SR42      ------------------------------------------------------SSGAL-
D9SVC8      ------------------------------------------------------SPSAL-
E7RG09      ------------------------------------------------------SYQEM-
D4G2E2      ------------------------------------------------------TSQEL-
Q8EME7      ------------------------------------------------------TSSQL-
D6Y035      ------------------------------------------------------SHRSL-
Q5WBB3      ------------------------------------------------------TYGDL-
Q9K6Q9      ------------------------------------------------------TYSQL-
Q97EP7      ------------------------------------------------------TIDQV-
Q97ER4      ------------------------------------------------------TADQV-
E4S7Y7      ------------------------------------------------------SIDQL-
E4Q5T6      ------------------------------------------------------TTEEL-
E4SDX3      ------------------------------------------------------TPEEL-
G2FWX3      ------------------------------------------------------TVEGL-
G7WJV2      ------------------------------------------------------TVEGL-
G7W774      ------------------------------------------------------TVSEL-
G2FM60      ------------------------------------------------------TVDEL-
H5XZD5      ------------------------------------------------------TVEGL-
I4DBG9      ------------------------------------------------------TVEAL-
G2FWT7      ------------------------------------------------------TVGEL-
H5XZG8      ------------------------------------------------------TVAEF-
G0V448      ------------------------------------------------------TYDEF-
A0PZ01      ------------------------------------------------------TTKEL-
B1B737      ------------------------------------------------------TTKEL-
                                                                        

G7EJX5      -------------------------------------------------QTKAVSFE-EV
G9RSY8      -------------------------------------------------EDQAAA-----
F3CAY8      -------------------------------------------------KIGIEG-----
I0UTA4      --------------------TDKL---------------------MNSTKVVPTSQT-AV
B7B948      LLFQS---------------GLQA-------------------------TLASKTATI--
G8AU95      QIVQQ---------------ATALFRADDGPVARDPNQARLLTIDTLLRRIEARNDDRSF
G5IFS2      VANPQ---------------DTRI------------------------------------
F0G6H6      YDKSF---------------ALTVGRGGAYTLQRTGLFGRKGPVWQGRIGEPLHAETPDG
F6CNF6      SDMIK---------------ATVV-----------------KD--------------SNL
A3W0H6      HQLRI---------------SARI-----------------TPITVGVPGMGPAT-TPSG
A3K8W6      YMMRQ---------------AARI-----------------TPITRPGPTFSAAAQAPSG
Q0FMP1      FRMRE---------------AVSI-----------------QEIRTNSNSFAAQQEMPSG
S9QRP2      YQMRM---------------AARI-----------------EEIRSNSGSFQASQEVPSG
D0D9W1      FQMRK---------------AVQI-----------------EEIRAAGNSYQPMRDAPSG
I1AYC4      FHMRE---------------AVRI-----------------DEIRSNPDAYAATQEAPSG
E9TE87      NQLQN---------------SLTV-------------------------TENGKDA--GV
E6PYQ4      NVFLG---------------SLKI-------------------------ARVPQT---EL
C0QCJ1      EAMRK---------------RIKV-------------------------TLSSARSGADA
I5B297      EALRK---------------RIKV-------------------------KIEHSRGGSEA
B8D0N1      KYLIT---------------NLNI-------------------------EIIPDT---RL
D9QTC7      RN-KI---------------SISG-------------------------GQEGSG---NL
C7LPS4      KDLRE---------------RISI-------------------------RLDEKR---GI
Q314L4      TSVRR---------------KVSV-------------------------GLDEKR---GL
G0VNK5      SYVKK---------------HIVT-------------------------KPYKDT---EI
D2RIR1      DYVKS---------------HIVT-------------------------KPYKDT---EI
I0GRR3      GYIKS---------------HVTT-------------------------KPFKDT---EI
Q39U16      EDFQK---------------RTQI-------------------------SIKGN----DL
F0JCB9      KSLRG---------------RIKI-------------------------GLDEKR---GV
G7QCG0      KDLQR---------------RIMV-------------------------NLNERQ---GL
I2Q342      KDLQR---------------RIMV-------------------------NLNERQ---GL
Q74BQ7      RAIQQ---------------NITI-------------------------KLKGD----NI
B5EA80      KQLQL---------------STKV-------------------------KVKDK----NL
C6DZX6      KQLQL---------------NTKV-------------------------KVKDK----NL
A1ARV9      LTLQK---------------NTVV-------------------------KVKDK----NL
E8WSZ4      RDLQK---------------NLTV-------------------------KVKEKN---NL
A5G425      AKFQK---------------NTVI-------------------------KLKNDE---NF
B9M2X7      SQFQK---------------DTKV-------------------------ELRDKE---NL
C2MBF7      KQSPV---------------SIRF-------------------------VNADPDE---K
H8YYB8      SADVI---------------DPR---------------------------SGRPSEATIA
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      --------------------VKRV-------------------------SASNATDT-RI
E3H7M4      --------------------ARKV-------------------------EVAPVGMT-EL
C2EWM2      --------------------KKAI-------------------------SVQTQQNS-QV
D0DSJ3      --------------------KGSL-------------------------KVSTQTNS-QV
B2GF32      --------------------KGLL-------------------------TVSTQNNS-QV
C0WW25      --------------------KGLL-------------------------TVSTQNNS-QV
F8KGP2      --------------------KKAI-------------------------SVKTQQNS-QV
B3XL22      --------------------KKAI-------------------------SVSTQQNS-QV
F8DRU3      --------------------KEAI-------------------------SVQTQQNS-QV
B1MZT2      --------------------KKMV-------------------------SISNQQNS-QV
H1WR07      --------------------KKMV-------------------------SISNQQNS-QV
Q03W94      --------------------KSMI-------------------------SISNQTNS-QV
C2KHF2      --------------------KSMV-------------------------TISSQQNS-QV
H1X4N3      --------------------KSMV-------------------------TITSQQNS-QV
C2JZS0      --------------------ASKV-------------------------TVSSSQNS-QV
C1J9I2      --------------------TKMV-------------------------SVSTQQNS-QV
Q58Z11      --------------------DKMI-------------------------SVSNAQNS-QV
F0K0J8      --------------------ASAV-------------------------SVTTTDSS-QV
G6F8H0      --------------------ASAV-------------------------SVTTTTSS-QV
Q1G8E3      --------------------ASAV-------------------------SVTTTDSS-QV
D8FLF7      --------------------ASAV-------------------------SVTTTTSS-QV
F0HVF2      --------------------ASAV-------------------------SVTTTTSS-QV
Q5FIC6      --------------------AKSI-------------------------SVGTQQQS-QV
E4SMV6      --------------------AKSI-------------------------SVGTQQQS-QV
F0TGY3      --------------------AKSI-------------------------SVGTQQQS-QV
F2M2M7      --------------------AKSI-------------------------SVDTQQQS-QV
C4VP07      --------------------SKAI-------------------------SVKTQQQS-QV
D6S4X3      --------------------SKAI-------------------------SVSTQQQS-QV
A4ZGZ7      --------------------AKNI-------------------------SVNTQQQS-QV
C2EPK4      --------------------AKNI-------------------------SVNTQQQS-QV
C7XKF2      --------------------AKSV-------------------------SVNTQQQS-QV
E3R265      --------------------AKSV-------------------------SVNTQQQS-QV
D0DJG9      --------------------AKSV-------------------------SVNTQQQS-QV
D5GZJ9      --------------------AKSV-------------------------SVNTQQQS-QV
A8YX90      --------------------AKDI-------------------------SVNTQQQS-QI
F0NWJ8      --------------------AKNI-------------------------SVNTQQQS-QV
C6CW36      --------------------SKIL-------------------------QVYSYENS-QV
A8SQS9      --------------------AKMI-------------------------SLVNPTDT-RV
D5HFS3      --------------------AKMI-------------------------TLENPSDT-RV
A5Z5P8      --------------------NGMI-------------------------DISTVEDT-RI
G2KUP2      ---------------------TNI-------------------------SVFSQQNS-QV
G8PE07      --------------------KKAI-------------------------SISSQQNS-QV
E0NHP5      --------------------KSSI-------------------------SISSQQNS-QV
Q03GL9      --------------------KGSL-------------------------SVNSQQNS-QV
C6CSC7      --------------------TKKI-------------------------SVSSVNGT-QV
C6CS79      --------------------MHNI-------------------------RFSSVNGT-QV
F5LM70      --------------------MRRI-------------------------QFSSVSDT-QI
G0LYN8      --------------------KSEV-------------------------SVTSTANS-QV
F6ITB3      --------------------KSEV-------------------------SVTSTTNS-QV
G0M1Y0      --------------------KSEV-------------------------SVTSTTNS-QV
D7VC12      --------------------KSEV-------------------------SVTSTTNS-QV
F9UMZ5      --------------------KSEV-------------------------SVTSTTNS-QV
D4JI68      --------------------GGRV-------------------------TLDNPSNS-RV
D6E329      --------------------GGRV-------------------------TLDNPSNS-RV
Q1AUN7      --------------------LGNL-------------------------RVEQRPGT-MF
H4GK02      --------------------KDAL-------------------------SVSTQTNS-QV
F6IR92      --------------------KQAV-------------------------SVTSTANS-QV
G0M0G0      --------------------KQAV-------------------------SVTSTANS-QV
D7VBW5      --------------------KQTV-------------------------SVTSTANS-QV
F9UQ55      --------------------KQTV-------------------------SVTSTANS-QV
B9Y883      --------------------QKIV-------------------------KISSVKDT-EV
D4YHG8      --------------------AENV-------------------------TVSMDSDS-LL
F7V793      --------------------QGMI-------------------------DITNVSDT-RV
C3WFM8      --------------------AKLV-------------------------TITPVDST-EL
H7F1R6      --------------------SNMI-------------------------NVSNASDS-QV
H7F570      --------------------SEMV-------------------------DVSSTSDS-QV
C6LCS6      --------------------ADKI-------------------------SVSTATDG-RI
A7VF43      --------------------ADMI-------------------------TLENPTDT-RV
A7Z922      --------------------KAKI-------------------------TTSSETDS-EI
I2CAF3      --------------------KAKI-------------------------TTSSETDS-EI
I2HVL3      --------------------KAKI-------------------------TTSSETDS-EI
E0U2Z4      --------------------KGKV-------------------------ITSSENES-EM
D4G1R3      --------------------KGKV-------------------------VTSSENES-EI
G4EQZ6      --------------------KGKV-------------------------VTSSENES-EI
P71050      --------------------KGKV-------------------------VTSSENES-EI
G4P115      --------------------KGKV-------------------------ITSSENES-EI
A8FHM0      --------------------KHKI-------------------------ATSTENES-EV
C0EBA5      --------------------RSML-------------------------SFSAVGET-EI
F4FXQ8      --------------------QGAI-------------------------SVTNQQNS-QV
C0WV34      --------------------QGAI-------------------------SVTNQQNS-QV
H1LCW2      --------------------QGAI-------------------------SVTNQQNS-QV
B7BDT7      DNE-----------------SVAF-------------------------TINPSQNG-QV
H6LKR9      --------------------QKNT-------------------------EIEAINNS-RL
F5LE49      --------------------AGMT-------------------------KVTSIADT-QV
F3AHH1      --------------------ASKV-------------------------EIGNTTDT-RI
F3Y921      --------------------RNSI-------------------------EITQSQDS-QM
G4L593      --------------------KDSM-------------------------EVEQSEES-QM
E6LD65      --------------------KKLI-------------------------SVEQSQNS-QM
C9ALZ8      --------------------KDAI-------------------------SVNQSQNS-QM
C9BUG6      --------------------KDAI-------------------------SVNQAENS-QM
Q3XYS7      --------------------KDAI-------------------------SVNQSENS-QM
C9B453      --------------------KDAI-------------------------SVNQSENS-QM
D4RJF5      --------------------KDAI-------------------------SVNQSQNS-QM
F0EKB8      --------------------KESI-------------------------SINQSQNS-QM
C9A6V4      --------------------KESI-------------------------SINQSQNS-QM
C9CHY7      --------------------KESI-------------------------SINQSQNS-QM
C8ZXT8      --------------------KDAI-------------------------SVNQSQNS-QM
G5IRQ5      --------------------KDAI-------------------------AVNQSQNS-QM
E6UHY5      NYFTISVDEKGNEYIPYGQIKRLI-------------------------NISAVNNT-EV
E9SAU2      NYFTVATDEKGKEYIPTGQIKRLI-------------------------TIAAVNNT-EV
F7K0U2      --------------------SGEI-------------------------TVSNTADT-RI
O06029      --------------------QKQV-------------------------TAANQTNS-QV
G8P3D6      --------------------QKQV-------------------------TAANQTNS-QV
A9QSJ3      --------------------QKQV-------------------------TAANQTNS-QV
F9VC43      --------------------QKQV-------------------------TAANQTNS-QV
G6FD41      --------------------QKQV-------------------------TAGNQTNS-QV
G9M881      --------------------QKQV-------------------------TAANQTNS-QV
Q3ZK51      --------------------QKQV-------------------------TAANQTNS-QV
Q83VG0      --------------------QKQV-------------------------TAANQTNS-QV
C6LDI9      --------------------EKAI-------------------------EVTNTTDT-HI
G5F9H3      --------------------EKKL-------------------------TIDNPNNT-RI
C0CZV8      --------------------KKKI-------------------------TIDNPADT-RI
G5GFW1      --------------------KKKL-------------------------TVDNPNDT-RI
I5AV00      --------------------RGMI-------------------------RVSVADNT-RV
H6NE44      --------------------AEML-------------------------EVKQSSDS-QV
F4BS20      --------------------QQKV-------------------------EVITQDDS-QI
E0RZL4      --------------------YDVL-------------------------KVDTPSDT-RI
C0CK72      --------------------QARI-------------------------ELSNPTDT-RI
D9S1J8      --------------------KSRI-------------------------KVNLVKNT-EI
C2EFR7      --------------------SKKV-------------------------NAENKDET-QI
Q1WTC7      --------------------SKKV-------------------------NAENKDET-QI
B0P2G1      --------------------EKKI-------------------------TVENPSDT-RI
D4MW28      --------------------EKKI-------------------------TVENPSDT-RI
E5VMX9      --------------------ENKI-------------------------TVENPSDT-RI
F2I6Z8      --------------------SENI-------------------------HLEADQQS-AV
E6U7N3      --------------------AKNI-------------------------SVEGVNQT-QV
C4Z8M6      --------------------GGRV-------------------------TLDNPSNS-RV
D4JMC3      --------------------SKRV-------------------------SIENPTDT-RV
D6E0V3      --------------------SKRV-------------------------SIENPTDT-RV
E3GPC7      --------------------SKMI-------------------------DVTTVNDT-EL
A6BIG6      --------------------EEMI-------------------------TTETPTET-RI
C2CI43      --------------------SSKV-------------------------SIEPVKDT-QI
D4RX68      --------------------KGMV-------------------------SASIVNNT-RM
D4J4T5      --------------------LEKV-------------------------EVTNPTSS-RI
I5ASF9      --------------------KKYL-------------------------TITNENDT-RI
C0C0F9      --------------------EETI-------------------------TAETPVDT-RI
B6W7H3      --------------------SQKV-------------------------SIEPVKDT-QI
C7RGH5      --------------------SSKV-------------------------SIEPVKDT-QI
F0GT82      --------------------SKKV-------------------------SIEPVKDT-QI
F3AH93      --------------------KGMV-------------------------SITNPANT-RI
B0GAL4      --------------------KNMI-------------------------TVTNQDDT-RI
G1WUK1      --------------------KDMI-------------------------TVANQDDT-RI
D4M2S1      --------------------KERI-------------------------TVENPSDT-RI
E7GL80      --------------------AEKL-------------------------KLENPKDT-RI
G5F9E3      --------------------AEKL-------------------------KLENPKDT-RI
D4CG07      --------------------REKL-------------------------TIDNPKDT-RI
D4MP31      --------------------REKL-------------------------TIDNPKDT-RI
G5HNC6      --------------------KEKI-------------------------TITNPTDT-RI
A8RK86      --------------------KARI-------------------------RISNPADT-RI
G5HTB1      --------------------KNMI-------------------------RISNPADT-RI
A8RSL0      --------------------VEKV-------------------------TIDNPQDT-RI
C5EN02      --------------------LEKV-------------------------TIDNPQDT-RI
G5HG46      --------------------KEKV-------------------------TIDNPQDT-RI
E7GL39      --------------------EKKL-------------------------TIDNPNNT-RI
E7GL56      --------------------AGKL-------------------------TVENPQNT-RI
G5F9B0      --------------------AGKL-------------------------TVENPQNT-RI
D3AC81      --------------------VRKI-------------------------KVDNPTDT-RI
D3AE79      --------------------NGKI-------------------------TVNNPTDT-RI
D4YF14      --------------------RNAL-------------------------RVEQSTDS-QA
B1YMM6      --------------------NNMI-------------------------TVESEQNS-QV
D4LG05      --------------------AKLY-------------------------TLNNPSDT-RV
D4LTH3      --------------------KQLY-------------------------TLNNPTDT-RV
F3ATF6      --------------------RGSI-------------------------TITNPEGT-HI
E0I7B6      --------------------ISGV-------------------------SVSSSNES-QI
C9LAS2      --------------------KEKI-------------------------SVENPEGT-RI
F7K8E8      --------------------KKKV-------------------------SVTTPTDT-RI
F7K9V0      --------------------KKKV-------------------------SVTTPTDT-RI
F7KL97      --------------------KKKV-------------------------SVTTPTDT-RI
D3FZP5      --------------------NGQL-------------------------NVSQEGQS-QV
C0ZHV9      --------------------LLQT-------------------------KVEPVKDS-QV
D7WMM9      --------------------MDQI-------------------------TVSSANNS-QV
A8U9F5      --------------------SEKI-------------------------EITTQENS-QV
F4BSE0      --------------------SEKI-------------------------EITTQENS-QV
E7RDR2      --------------------NSKI-------------------------TVATAQNS-QV
I0JRK5      --------------------SDKI-------------------------QVSNAEQS-QV
G2TR26      --------------------NSKI-------------------------EVSTEQNS-QV
D5DBK2      --------------------SGQI-------------------------QVTSSENS-QV
D5DY80      --------------------SGKI-------------------------QVINAKDS-QV
A7Z9K1      --------------------ESKI-------------------------TVSSEQDS-QV
I2CB17      --------------------ESKI-------------------------TVSSEQDS-QV
I2HW54      --------------------ESKI-------------------------TVSSEQDS-QV
G4P1M8      --------------------NDKI-------------------------TVSSEQDS-QV
E0TTZ7      --------------------NDKI-------------------------TVSSEQDS-QV
G4EQF2      --------------------NDKI-------------------------TVSSEQDS-QV
P96715      --------------------NDKI-------------------------TVSSEQDS-QV
I0F9R7      --------------------NDKI-------------------------TVSSEQDS-QV
G9QKR5      --------------------NQKI-------------------------TVDSEQNS-QV
B5UQ74      --------------------NKRI-------------------------EVTNEKDS-QV
B7HFH2      --------------------TGKI-------------------------NVMNEKDS-QV
Q72XH7      --------------------NKKI-------------------------EVVNEKDS-QV
C2V4M3      --------------------NKQI-------------------------EVTNEKDS-QV
C2YZB3      --------------------NQKI-------------------------EVANEKDS-QV
C2P8H2      --------------------NNKI-------------------------EVANEKDS-QV
C2Y451      --------------------NNKI-------------------------EVANEKDS-QV
C3EBC1      --------------------NKKI-------------------------EVANEKDS-QV
C3H980      --------------------NNKI-------------------------EVANEKDS-QV
C2PN23      --------------------TGKI-------------------------NVANEKDS-QV
B9IRQ7      --------------------NKKI-------------------------EVANEKDS-QV
A0RL71      --------------------TKKI-------------------------NVANEKDS-QV
C2XJI0      --------------------TKKV-------------------------NVANEKDS-QV
Q3EV65      --------------------TKKV-------------------------NVANEKDS-QV
C2T8T7      --------------------TKKI-------------------------NIANEKDS-QV
C2RG50      --------------------TKKI-------------------------NIANEKDS-QV
Q814Y9      --------------------TKKI-------------------------NIANEKDS-QV
B3ZRD5      --------------------TKKI-------------------------NVANEKDS-QV
F0PU65      --------------------TKKI-------------------------NVANEKDS-QV
Q6HB08      --------------------TKKI-------------------------NVANEKDS-QV
C2NQN7      --------------------TKKI-------------------------NVANEKDS-QV
C3GRR1      --------------------TKKV-------------------------NVANEKDS-QV
C2ULR7      --------------------TGKI-------------------------NVANEKDS-QV
C3GBJ9      --------------------TKKI-------------------------NVANEKDS-QV
C2WVG7      --------------------MGKI-------------------------NVANEKDS-QV
G9QCG2      --------------------TGKI-------------------------NVANEKDS-QV
C2QJY6      --------------------AGKI-------------------------NVANEKDS-QV
C2SSX9      --------------------TGKI-------------------------NVANEKDS-QV
B7IQS9      --------------------TGKI-------------------------NVANEKDS-QV
A9VRC4      --------------------TGKI-------------------------NVANEKDS-QV
C2MTG4      --------------------TGKI-------------------------NVANEKDS-QV
B7HXB5      --------------------TGKI-------------------------NVANEKDS-QV
C2SBU5      --------------------TGKI-------------------------NVANEKDS-QV
Q2BFS6      --------------------DSKI-------------------------TVGSQKDS-QV
I3EBB4      --------------------NEKI-------------------------NVQSEKDS-QV
A4ITF4      --------------------NEQI-------------------------QVSSEKDS-QV
C5D962      --------------------NEQI-------------------------QVSSEKDS-QV
G8MZ94      --------------------NEQI-------------------------QVSSEKDS-QV
Q5KUM4      --------------------NEQI-------------------------QVSSEKDS-QV
G5SDT9      -----------------------L-------------------------DIAVTKNTFPL
G5LQM7      -----------------------L-------------------------DIAVTKNTFPL
G5Q4J1      -----------------------L-------------------------DIAVTKNTFPL
G2Z8Q4      --------------------KQQI-------------------------TIENVANS-QV
D9ST43      --------------------LDSI-------------------------IVIPKEDT-QL
H7F5T7      --------------------SEMI-------------------------QPSTEENS-QV
G9WIR0      SL------------------ASMV-------------------------TVSSVQNS-QI
D3LB11      AL------------------SKMI-------------------------TVSSTTNS-QI
A0NKF7      AL------------------AKMI-------------------------TVSSTTNS-QI
Q04DV7      AL------------------AKMI-------------------------TVSSTTNS-QI
F6BI63      --------------------KKNI-------------------------DVAEEGDT-EV
G2MWC1      --------------------KNSV-------------------------DVAAKDNT-EI
B0K4N2      --------------------KNSV-------------------------DVAAKGNT-EI
C7ISF8      --------------------KNSV-------------------------DVAAKGNT-EI
B0KAR6      --------------------KNSV-------------------------DVAAKGNT-EI
E8UV30      --------------------KNSV-------------------------DVAAKGNT-EI
C0GGR6      --------------------RGMI-------------------------NVRQVSDT-EI
A4J8V1      --------------------SQSI-------------------------DVKPVKDT-QL
C8VYQ7      --------------------SAKI-------------------------NVEPVRDT-QL
C8W5K3      --------------------IGKV-------------------------SVQPVKES-QL
B1BNH4      AI------------------LKNL-------------------------NATPSAET-QI
B1V1Z3      AI------------------LKNL-------------------------NATPSAET-QI
B1R3V2      AI------------------LKNL-------------------------NATPSAET-QI
Q0SVR9      GV------------------LNNL-------------------------NVTPSADT-QI
Q8XN47      GI------------------LNNL-------------------------NVTPSADT-QI
G7M0Q2      --------------------LKNL-------------------------TVTPTVDT-QI
G7M565      --------------------LSTL-------------------------SVTPRSDT-QI
A6M2M0      --------------------LDNL-------------------------SVTPRTDT-QI
G7M1R8      --------------------LDNL-------------------------TVTPTANT-QI
A5V0I4      --------------------LKRV-------------------------AIQPRPDE-RK
A7NQ70      --------------------LKRV-------------------------AIQPRPDE-RK
Q4JZ56      --------------------ASKI-------------------------KISIPAET-RI
Q7X554      --------------------AKMI-------------------------SVNIPTDT-RL
Q7X550      --------------------AKMI-------------------------SVDIPTDT-RL
Q7X562      --------------------DKMI-------------------------SVDIPTDT-RL
Q7X556      --------------------SKMV-------------------------SVNIPTDT-RL
Q7X552      --------------------SKMV-------------------------SVNIPTDT-RL
Q7X558      --------------------SKMV-------------------------SVNIPTDT-RL
C5NWJ9      --------------------AGKV-------------------------SVDAPKDT-RI
F3A498      --------------------AGKV-------------------------SVDAPKDT-RI
Q9AHD3      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K2E2      --------------------ASKI-------------------------QVTVPVDT-RI
Q4K2F8      --------------------ASKI-------------------------QVTVPVDT-RI
Q4K046      --------------------TSKV-------------------------QVTVPADT-RV
Q4K0R8      --------------------ASKV-------------------------QVTVPADT-RI
Q4JYY0      --------------------ASKV-------------------------QVTVPADT-RI
Q4JZW8      --------------------ASKV-------------------------QVTVPADT-RI
I0J9C8      --------------------ASKV-------------------------KVTVPTDT-RI
Q4K0M4      --------------------ASKV-------------------------KVTVPTDT-RI
Q4JZS4      --------------------TRKV-------------------------QVTVPVDT-RI
Q4JZK2      --------------------ASKV-------------------------QVTVPADT-RI
Q9AHA5      --------------------ASKV-------------------------QVTVPTDT-RI
Q9X9A0      --------------------ASKV-------------------------QVTVPTDT-RI
Q4JYK9      --------------------ASKV-------------------------QVAVPADT-RI
Q4K006      --------------------ASKV-------------------------QVTVPADT-RI
Q4JZG8      --------------------ASKV-------------------------QVTVPADT-RI
A6YIA7      --------------------ASKV-------------------------QVAVPADT-RI
E5F5C4      --------------------ASKV-------------------------QVAVPADT-RI
Q9AHB8      --------------------ASKV-------------------------QVAVPADT-RI
Q4JZL8      --------------------ASKV-------------------------QVTVPADT-RI
Q4K1B8      --------------------ASKV-------------------------QVTVPADT-RI
Q8VU32      --------------------TSKV-------------------------QVTVPTDT-RI
D2ERX9      --------------------ASKV-------------------------QVTVPTDT-RI
G6C7Z0      --------------------ASKV-------------------------QVTVPADT-RI
Q4K2A9      --------------------TSKV-------------------------QVIVPADT-RI
D6ZQI7      --------------------TSKV-------------------------QVTVPADT-RI
Q9ZFT9      --------------------TSKV-------------------------QVTVPADT-RI
Q4K255      --------------------TSKV-------------------------QVTVPADT-RI
F9HJP7      --------------------AGKV-------------------------AVSVPTDT-RI
E8JWI4      --------------------ASKV-------------------------TVTVPTDT-RI
A8AZR4      --------------------SKSV-------------------------SVSVPTDT-RI
D0RXH3      --------------------SKSV-------------------------SVSVPTDT-RI
Q83YR6      --------------------SKSV-------------------------SVSVPTDT-RI
F1Z125      --------------------SKMI-------------------------AVTIPADT-RV
Q3K0S9      --------------------LQKI-------------------------TVSILKDT-RV
P0C0T8      --------------------LQKI-------------------------TVSILKDT-RV
Q67AY5      --------------------LQKI-------------------------TVSILKDT-RV
Q04662      --------------------LQKI-------------------------TVSILKDT-RV
Q8GP93      --------------------AKMI-------------------------SVDIPTDT-RL
Q8GPF7      --------------------SKMV-------------------------SVNIPTDT-RL
E3CP61      --------------------AKKI-------------------------SVNIPTDT-RL
E8KUY7      --------------------AKKI-------------------------SVNIPTDT-RL
C2LSE5      --------------------AKMI-------------------------SVNIPTDT-RL
E9DM16      --------------------AKMI-------------------------SVNIPTDT-RL
I0QIK5      --------------------AKMI-------------------------SVNIPTDT-RL
Q7X560      --------------------AKMI-------------------------SVNIPTDT-RL
Q8GMA6      --------------------SKMV-------------------------SVNIPTDT-RL
Q55204      --------------------AKMI-------------------------SVNIPTDT-RL
Q8GPC4      --------------------AKMI-------------------------SVNIPTDT-RL
Q8GPA9      --------------------DKMI-------------------------SVDIPTDT-RL
G6ERT2      --------------------AKMI-------------------------SVNIPTDT-RL
O87930      --------------------AKMI-------------------------SVNIPTDT-RL
Q8GP55      --------------------SKMV-------------------------SVNIPTDT-RL
F8HDC4      --------------------SKMV-------------------------SVNIPTDT-RL
F8LJ76      --------------------SKMV-------------------------SVNIPTDT-RL
F8LXJ5      --------------------AKMI-------------------------SVDIPTDT-RL
Q1WCR2      --------------------AKMI-------------------------SVDIPTDT-RL
G3G7C0      --------------------KEKV-------------------------SVSIPVDT-RI
G3G7J8      --------------------KEKV-------------------------SVSIPVDT-RI
G7SNU7      --------------------KEKI-------------------------SVSIPVDT-RI
G8DU30      --------------------KEKI-------------------------SVSIPVDT-RI
A4VTU2      --------------------KEKI-------------------------SVSIPVDT-RI
D5AGQ4      --------------------KEKI-------------------------SVSIPVDT-RI
Q9X4U6      --------------------KEKI-------------------------SVSIPVDT-RI
G3G7G5      --------------------KEKI-------------------------SVSIPVDT-RI
G7SG35      --------------------KEKV-------------------------SVSIPVDT-RI
G8DU06      --------------------KEKV-------------------------SVSIPVDT-RI
G8DUA9      --------------------KEKV-------------------------SVSIPVDT-RI
G8DTY9      --------------------KEKV-------------------------SVSIPVDT-RI
G3G7I7      --------------------KEKI-------------------------SVSIPVDT-RI
G3G7J3      --------------------SNKI-------------------------SVSIPVDT-RI
E0PD82      --------------------SDMI-------------------------TVDIPTDT-RV
F5X651      --------------------SDMI-------------------------TVDIPTDT-RV
G5JTD6      --------------------AKKV-------------------------SVQVPTDT-RL
Q2KM75      --------------------SQMI-------------------------TVTVPADT-RV
G5KAJ3      --------------------SKMI-------------------------AVTVPADT-RV
B9DUJ5      --------------------SKMI-------------------------SVTIPADT-RV
G5KD12      --------------------SKMI-------------------------TVTIPADT-RV
E8JMT8      --------------------SDMI-------------------------SVDIPTDT-RV
F5X0J8      --------------------SNMI-------------------------SVNIPTDT-RV
H2A601      --------------------SNMI-------------------------SVNIPTDT-RV
E7S8W2      --------------------AKKV-------------------------SVAVPTDT-RI
F8DFF5      --------------------SKKI-------------------------NVSVPTDT-RI
I1ZPH8      --------------------SKKI-------------------------NVSVPTDT-RI
E3CBR9      --------------------SKKI-------------------------SVSVPTDT-RI
E8K787      --------------------SKKI-------------------------SVSVPTDT-RI
F9M365      --------------------SKKI-------------------------SVSVPTDT-RI
A3CQY3      --------------------TRHI-------------------------TVSVPADT-RI
E8KLZ0      --------------------TRHI-------------------------TVSVPADT-RI
F0FHA9      --------------------TRHI-------------------------TVSVPADT-RI
F0FQQ4      --------------------TRHI-------------------------TVSVPADT-RI
F0I4H6      --------------------TRHI-------------------------TVSVPADT-RI
F0IAY2      --------------------TRHI-------------------------TVSVPADT-RI
F0IJI1      --------------------TRHI-------------------------TVSVPADT-RI
F0IS52      --------------------TRHI-------------------------TVSVPADT-RI
F2C9N1      --------------------TRHI-------------------------TVSVPADT-RI
F2CH54      --------------------TRHI-------------------------TVSVPADT-RI
F3UDW8      --------------------TRHI-------------------------TVSVPADT-RI
F3UNJ5      --------------------TRHI-------------------------TVSVPADT-RI
F3SM33      --------------------TRHI-------------------------TVSVPADT-RI
F9HC66      --------------------TKKI-------------------------QVTVPVDT-RI
E1LQJ6      --------------------SKKI-------------------------QVTVPVDT-RI
Q4JYU0      --------------------SKKI-------------------------QVTVPVDT-RI
Q4JZY2      --------------------SKKI-------------------------QVTVPVDT-RI
F9Q346      --------------------ASKI-------------------------KVTVPADT-RI
Q6L5R1      --------------------ASKI-------------------------KVTVPADT-RI
E9FEC6      --------------------ASKI-------------------------KVTVPVDT-RI
E0Q2S9      --------------------AGKI-------------------------KVTVPADT-RI
F5VSH0      --------------------AGKI-------------------------KVTVPADT-RI
A5YTV6      --------------------AGKI-------------------------KVTVPVDT-RI
Q6L5T1      --------------------ASKI-------------------------KVTVPVDT-RI
E0PPH8      --------------------AIKI-------------------------KVTVPVDT-RI
A5YTT8      --------------------ASKI-------------------------KVTVPVDT-RI
E6KKR9      --------------------ASKI-------------------------KVTVPVDT-RI
A1ILY0      --------------------ASKI-------------------------KVTVPVDT-RI
F2QF91      --------------------ASKI-------------------------KVTVPVDT-RI
Q4K0I3      --------------------TSKV-------------------------QVTVPADT-RI
Q8KWQ1      --------------------ASKV-------------------------QVTVPDDT-RI
Q4K238      --------------------TSKV-------------------------QVTVPADT-RI
B1I966      --------------------TSKV-------------------------QVTVPADT-RI
G6J8A3      --------------------TSKV-------------------------QVTVPADT-RI
G6LKG4      --------------------TSKV-------------------------QVTVPADT-RI
F9LZC3      --------------------ASKV-------------------------QVTVPADT-RI
F9P1W9      --------------------ASKV-------------------------QVTVPADT-RI
A5LJR9      --------------------ASKV-------------------------QVAVPADT-RI
Q9ZII7      --------------------ASKV-------------------------QVTVPTDT-RI
Q4K1K7      --------------------ANKI-------------------------KVTVPVDT-RI
E1LPE6      --------------------ANKI-------------------------KVTVPVDT-RI
F9MJW6      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K0V3      --------------------ANKI-------------------------KVTVPVDT-RI
Q54519      --------------------ANKI-------------------------KVTVPVDT-RI
C1CBD0      --------------------ANKI-------------------------KVAVPVDT-RI
Q7WVX1      --------------------ANKI-------------------------KVAVPVDT-RI
Q4K0E2      --------------------ANKI-------------------------KVTVPVDT-RI
Q9AH96      --------------------ANKI-------------------------KVTVPVDT-RI
A5M4L2      --------------------ANKI-------------------------KVTVPVDT-RI
B2ILP4      --------------------ANKI-------------------------KVTVPVDT-RI
C1CCB8      --------------------ANKI-------------------------KVTVPVDT-RI
P72511      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K1S8      --------------------ANKI-------------------------KVTVPVDT-RI
P96474      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K196      --------------------ANKI-------------------------EVTVPVDT-RI
Q4K0Z7      --------------------ANKI-------------------------KVTVPVDT-RI
Q4JZ85      --------------------ANKI-------------------------KVTVPVDT-RI
Q4JYH6      --------------------ANKI-------------------------KVTVPVDT-RI
Q4JZ19      --------------------ANKI-------------------------KVIVPIDT-RI
Q4K0A1      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K1M5      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K2Q8      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K1G0      --------------------ASKI-------------------------KVTVPADT-RI
Q4K0T6      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K0K3      --------------------ANKI-------------------------KVTVPVDT-RI
Q4K0X6      --------------------ANKI-------------------------KVTVPVDT-RI
E8KDN1      --------------------AKKI-------------------------QVTVPADT-RI
F9PEU3      --------------------GRKV-------------------------SVTVPADT-RI
E8K321      --------------------GKKV-------------------------SVTVPADT-RI
F9PZP6      --------------------GRKV-------------------------SVTVPADT-RI
D6R2T7      --------------------AKNI-------------------------SVSVPVDT-RI
F3UUQ1      --------------------AKNI-------------------------SVSVPVDT-RI
E6IZC3      --------------------AKKI-------------------------TVTVPTDT-RI
G6A746      --------------------AKKI-------------------------TVTVPTDT-RI
B1V0N8      --------------------RSGL-------------------------SFIPGSGSIPT
B1BNK2      --------------------RSGL-------------------------SFIPGNGSIPT
B1R3X7      --------------------RSGL-------------------------SFIPGNGSIPT
Q8XN77      --------------------RSGL-------------------------SFIPGNGSIPT
A3ICA4      --------------------MKQI-------------------------EVSSANNS-QV
B1HR40      --------------------MKQI-------------------------EVSSANNS-QV
H1BJT0      --------------------SKAI-------------------------QTNVEDNS-NI
F8FCE3      --------------------AEML-------------------------EVKQSSDS-QV
I0BSG5      --------------------AEML-------------------------EVKQSSDS-QV
A8YPQ6      --------------------SSML-------------------------TITNQENT-QL
P95695      --------------------SSML-------------------------TITNQENT-QL
Q2G1K8      --------------------SSML-------------------------TITNQENT-QL
C5QNG5      --------------------SKMI-------------------------DVNTEADS-QI
Q4L9H8      --------------------NNML-------------------------SIDAESDS-QI
Q2FUV1      --------------------NSFL-------------------------KVTNQTNS-QI
P39850      --------------------SSML-------------------------TVTNQAES-QV
D7UYE3      --------------------LSML-------------------------TVNNQSQS-QI
Q4A121      --------------------AGML-------------------------TVSNQAES-QI
E3HB17      --------------------AKLV-------------------------KVTPVDET-EF
C9AAE4      --------------------SEIL-------------------------SVTNATNS-QI
H7F6C7      --------------------AEMI-------------------------QVKNATNS-QV
F0SX23      --------------------REMV-------------------------STNTIYDT-EV
Q38VG4      --------------------ADML-------------------------SITNNQNS-QV
F2I4B6      --------------------REKI-------------------------SVESKNNS-QV
Q8RBS6      --------------------KGKI-------------------------DVTSKDNT-EI
D9SR42      --------------------LGSM-------------------------SVSSSTDT-EF
D9SVC8      --------------------LGSV-------------------------AVVTPSET-EF
E7RG09      --------------------VEKV-------------------------NVEVTENS-QL
D4G2E2      --------------------NDKI-------------------------TVSSEQDS-QV
Q8EME7      --------------------SEKI-------------------------SVASEENS-QV
D6Y035      --------------------NTAL-------------------------NVQQEGGS-QV
Q5WBB3      --------------------EAAV-------------------------SVGSQSNS-QV
Q9K6Q9      --------------------NERL-------------------------QINSENNS-QV
Q97EP7      --------------------SKVV-------------------------SVTPETGT-QI
Q97ER4      --------------------LGLV-------------------------SVTPQTGT-QI
E4S7Y7      --------------------KSMV-------------------------SVQLKNDT-RI
E4Q5T6      --------------------SNMV-------------------------SVQLKNDT-RI
E4SDX3      --------------------GSMV-------------------------SVQLKNDT-RI
G2FWX3      --------------------DKLI-------------------------SVNPVKDT-EI
G7WJV2      --------------------DPMI-------------------------SINPVKAT-EI
G7W774      --------------------DKLI-------------------------TINPVKTT-EI
G2FM60      --------------------NSLI-------------------------AINPVKTT-EI
H5XZD5      --------------------DRLI-------------------------SINQVKTT-EI
I4DBG9      --------------------DKLI-------------------------TVDQVKTT-EI
G2FWT7      --------------------DKLI-------------------------SINPVKTT-EI
H5XZG8      --------------------DKMI-------------------------TINPVKTT-EI
G0V448      --------------------ISSI-------------------------TVTPQPDT-QI
A0PZ01      --------------------DKMI-------------------------EVTPQQDT-QI
B1B737      --------------------DKMI-------------------------EVTPQQDT-QI
                                                                        

G7EJX5      ----------------------------------------------YGLDSNKKEYYLTQ
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ----------------------------------------------LDIEVSDSNAKRSA
B7B948      ----------------------------------------------INLTLQDVSIPRAE
G8AU95      T---------------------------------------------IIIEASSVDPAKAA
G5IFS2      ----------------------------------------------LTISVEDNDPYMAK
F0G6H6      NIDLLVRGIDGEPGARFDLTRHGEAETTAWLQKNVLISERGKQSNIIGATLDGSDAAHIS
F6CNF6      ----------------------------------------------IDVKVQNSDPVLAA
A3W0H6      ----------------------------------------------LSVTVNLNDPVKAA
A3K8W6      ----------------------------------------------LMISVMLPDPEKAA
Q0FMP1      ----------------------------------------------LRISVVLPDPQKAA
S9QRP2      ----------------------------------------------LTITVRLGDPQKAA
D0D9W1      ----------------------------------------------LLITVTLDDPQKAA
I1AYC4      ----------------------------------------------LLISVTLGDPQKAA
E9TE87      ----------------------------------------------LSLTYTGEDREQIR
E6PYQ4      ----------------------------------------------ISVTFRSRNPVLSA
C0QCJ1      ----------------------------------------------FTISYKGSDPDKVM
I5B297      ----------------------------------------------FSISFTGSEPQRVM
B8D0N1      ----------------------------------------------IKISIKHTDPVIAR
D9QTC7      ----------------------------------------------ITITVNYSDPVVAK
C7LPS4      ----------------------------------------------FFISFQDSDPRYAR
Q314L4      ----------------------------------------------FFISYESSNPVLAR
G0VNK5      ----------------------------------------------LEVDVTGKSPEQAQ
D2RIR1      ----------------------------------------------LEVDVTGKSPEQAQ
I0GRR3      ----------------------------------------------LQVDVTGKSPEQAQ
Q39U16      ----------------------------------------------FIVSIRDKDPKLAT
F0JCB9      ----------------------------------------------FDIRFADTDPVLAR
G7QCG0      ----------------------------------------------IVLNFSDKDPRFAR
I2Q342      ----------------------------------------------IVLNFSDKDPRFAR
Q74BQ7      ----------------------------------------------FTISYVDKDPRVAR
B5EA80      ----------------------------------------------FTISFTHTNPRIAR
C6DZX6      ----------------------------------------------FTISFTHTNPSIAR
A1ARV9      ----------------------------------------------FTISYTDKNPQMAR
E8WSZ4      ----------------------------------------------FTISFVHTDPRIAR
A5G425      ----------------------------------------------FIISFTNENPRLAR
B9M2X7      ----------------------------------------------FTISYTGENPKRAR
C2MBF7      ----------------------------------------------ITLRVKPDKGSDSQ
H8YYB8      ----------------------------------------------FSLSFESESPTVAQ
E7T802      ----------------------------------------------------NSSPESAP
F4SM98      ----------------------------------------------------DSQPQSAP
C4Z673      ----------------------------------------------IAITVTDPEPEQAQ
E3H7M4      ----------------------------------------------IKISYEDENPQKAA
C2EWM2      ----------------------------------------------FTLNAKTNNAEESA
D0DSJ3      ----------------------------------------------FSLSAEAGNPTEAK
B2GF32      ----------------------------------------------FSLSAEAGNPTEAK
C0WW25      ----------------------------------------------FSLSAEAGNPTEAK
F8KGP2      ----------------------------------------------FSLQVKTDDPQESA
B3XL22      ----------------------------------------------FSLQVKTDDPQESA
F8DRU3      ----------------------------------------------FSLQVKTDDPQESA
B1MZT2      ----------------------------------------------FAINVTSKDPKQAA
H1WR07      ----------------------------------------------FAINVTSKDPKQAA
Q03W94      ----------------------------------------------FSINVKAKDSKLAA
C2KHF2      ----------------------------------------------FSINVKSKDPKLAA
H1X4N3      ----------------------------------------------FSINVKSKDPKLAA
C2JZS0      ----------------------------------------------FTISVTDTSPTRAR
C1J9I2      ----------------------------------------------FTVNVKDTSPVRAR
Q58Z11      ----------------------------------------------FTVNVRDTDPVRAK
F0K0J8      ----------------------------------------------FTLSATAETPAKAQ
G6F8H0      ----------------------------------------------FTLSATAETPAKAQ
Q1G8E3      ----------------------------------------------FTLSATAETPAKAQ
D8FLF7      ----------------------------------------------LTLSATAETPAKAQ
F0HVF2      ----------------------------------------------FTLSATAETPAKAQ
Q5FIC6      ----------------------------------------------FSISAEADTPAKAK
E4SMV6      ----------------------------------------------FSISAKADTPAKAK
F0TGY3      ----------------------------------------------FSISAKADTPAKAK
F2M2M7      ----------------------------------------------FSISAKADTPAKAK
C4VP07      ----------------------------------------------FSITATADTPEKAE
D6S4X3      ----------------------------------------------FSIKATSDTPEKAQ
A4ZGZ7      ----------------------------------------------FSVSATADTPEKAK
C2EPK4      ----------------------------------------------FSISAESNTPAKAR
C7XKF2      ----------------------------------------------FSISATADTPEKAK
E3R265      ----------------------------------------------FSISATADTPEKAK
D0DJG9      ----------------------------------------------FSISATADTPEKAK
D5GZJ9      ----------------------------------------------FSISATADTPEKAK
A8YX90      ----------------------------------------------FSVSATADTPEKAK
F0NWJ8      ----------------------------------------------FSVSAEADTPEKAK
C6CW36      ----------------------------------------------LNLTYQATSYESAA
A8SQS9      ----------------------------------------------LQIVVTSTDKQQAC
D5HFS3      ----------------------------------------------LKITVTSTDKQQAC
A5Z5P8      ----------------------------------------------LKISATSIKPEEAK
G2KUP2      ----------------------------------------------FSVSATANNPYTAS
G8PE07      ----------------------------------------------FSITAKSTNPEMAA
E0NHP5      ----------------------------------------------FSINAKSTNPNTAA
Q03GL9      ----------------------------------------------FSITAKSTNPNTAA
C6CSC7      ----------------------------------------------MTLAVQDVSYQQAA
C6CS79      ----------------------------------------------VTISYLDTDYKRAA
F5LM70      ----------------------------------------------FTLSLEDASYSKAA
G0LYN8      ----------------------------------------------FSISVTDTNAKASA
F6ITB3      ----------------------------------------------FSIAVTDADAKASA
G0M1Y0      ----------------------------------------------FSIAVTDADAKASA
D7VC12      ----------------------------------------------FSIAVTDANAKASA
F9UMZ5      ----------------------------------------------FSIAVTDADAKASA
D4JI68      ----------------------------------------------LNITVTDPDPQMAK
D6E329      ----------------------------------------------LNITVTDPDPQMAK
Q1AUN7      ----------------------------------------------VEVRYRDPDPQRAQ
H4GK02      ----------------------------------------------FTLNAEASNPTEAK
F6IR92      ----------------------------------------------FSIVVRDHNASASA
G0M0G0      ----------------------------------------------FSIVVRDHNASASA
D7VBW5      ----------------------------------------------FSIVVRDKNAKASA
F9UQ55      ----------------------------------------------FSIGVRDKNAKASA
B9Y883      ----------------------------------------------ITIAVTSKDPKEAA
D4YHG8      ----------------------------------------------FTISVENESPYVAA
F7V793      ----------------------------------------------LKITVRSENPEEAK
C3WFM8      ----------------------------------------------ISLTYKNSDPQLAA
H7F1R6      ----------------------------------------------IRIQVESKNPKDAV
H7F570      ----------------------------------------------ITISVEGENAKDIV
C6LCS6      ----------------------------------------------ISIRATDENPQEAK
A7VF43      ----------------------------------------------LKITVTSTDPEEAM
A7Z922      ----------------------------------------------ITIAVQDENPKQAA
I2CAF3      ----------------------------------------------ITVAVQDENPKQAA
I2HVL3      ----------------------------------------------ITVAVQDENPKQAA
E0U2Z4      ----------------------------------------------ITVAVQDHDPAKAA
D4G1R3      ----------------------------------------------INVAVQDHDPAKAA
G4EQZ6      ----------------------------------------------INVAVQDHDPAKAA
P71050      ----------------------------------------------INVAVQDHDPAKAA
G4P115      ----------------------------------------------ITVAVQDHDPAKAA
A8FHM0      ----------------------------------------------INISVQDEDRAKAV
C0EBA5      ----------------------------------------------MRITATSEDPELAA
F4FXQ8      ----------------------------------------------FALNVESDDPQKSA
C0WV34      ----------------------------------------------FALNVESDDPQKSA
H1LCW2      ----------------------------------------------FALNVKSDDPQKSA
B7BDT7      ----------------------------------------------LLTDFSRNGEDVAG
H6LKR9      ----------------------------------------------FTVGFKDPDPEIAK
F5LE49      ----------------------------------------------MTITATADNYATAA
F3AHH1      ----------------------------------------------VTIKVTDADPYQAR
F3Y921      ----------------------------------------------FTIIATAKQATTAE
G4L593      ----------------------------------------------FSIVATGESAADAE
E6LD65      ----------------------------------------------FSIIVTTTKSVEAA
C9ALZ8      ----------------------------------------------FSIQATSTNAVTAQ
C9BUG6      ----------------------------------------------FSIQAISTNAVAAQ
Q3XYS7      ----------------------------------------------FSIQAISTNAVTAQ
C9B453      ----------------------------------------------FSIQAISTNAVTAQ
D4RJF5      ----------------------------------------------FSIQAISTNAVTAQ
F0EKB8      ----------------------------------------------FSIQATSTNAVSAQ
C9A6V4      ----------------------------------------------FSIQATSTNAVSAQ
C9CHY7      ----------------------------------------------FSIQATSTNAVSAQ
C8ZXT8      ----------------------------------------------FSIQATNPNAVTAQ
G5IRQ5      ----------------------------------------------FSIQATNPNAVTAQ
E6UHY5      ----------------------------------------------LQVTVTSQVPKFSA
E9SAU2      ----------------------------------------------LQVTVTSEVPNFSA
F7K0U2      ----------------------------------------------LSISVENESPKLAK
O06029      ----------------------------------------------IMLTVKYSNPYIAK
G8P3D6      ----------------------------------------------ITLTVKYSNPYIAQ
A9QSJ3      ----------------------------------------------ITLTVKYSNPYIAQ
F9VC43      ----------------------------------------------ITLTVKYSNPYIAQ
G6FD41      ----------------------------------------------ITLTVKYSNPYVAQ
G9M881      ----------------------------------------------ITLTVKYSNPYIAQ
Q3ZK51      ----------------------------------------------ITLTVKYSNPYIAQ
Q83VG0      ----------------------------------------------ITLTVKYSNPYIAQ
C6LDI9      ----------------------------------------------LKITVSDSDAERAK
G5F9H3      ----------------------------------------------LTLTIKDPNPYLAK
C0CZV8      ----------------------------------------------LSISVMDPDPQMAK
G5GFW1      ----------------------------------------------LSLSIVDEDPAMAK
I5AV00      ----------------------------------------------ITIYITDFDPFRAC
H6NE44      ----------------------------------------------MTLVIRDTDYRRAA
F4BS20      ----------------------------------------------FGIKVTDTDPNRAA
E0RZL4      ----------------------------------------------VAITVRDKDPLMAM
C0CK72      ----------------------------------------------LKVEYKDKDPKMAS
D9S1J8      ----------------------------------------------IEIRVSDHDPVMAA
C2EFR7      ----------------------------------------------ISISVTDPNPVVAQ
Q1WTC7      ----------------------------------------------ISISVTDPNPVVAQ
B0P2G1      ----------------------------------------------MQITITDKDAALAQ
D4MW28      ----------------------------------------------MQITITDKDAALAQ
E5VMX9      ----------------------------------------------MQITITDKDAALAQ
F2I6Z8      ----------------------------------------------FNVIVTDDNASQAQ
E6U7N3      ----------------------------------------------LKITVKDTNPQVAK
C4Z8M6      ----------------------------------------------LNITVTDPDPQMAK
D4JMC3      ----------------------------------------------LKIVVTDTDLEASK
D6E0V3      ----------------------------------------------LKIVVTDTDLEASK
E3GPC7      ----------------------------------------------IKITVTDEDPVEAA
A6BIG6      ----------------------------------------------MSIYVQSTSPKQAK
C2CI43      ----------------------------------------------ISVKVVDTIPERAM
D4RX68      ----------------------------------------------ISIKVTDKDPILAK
D4J4T5      ----------------------------------------------LQVTVNDPNPQTAA
I5ASF9      ----------------------------------------------LQLSVEQPNPKLAK
C0C0F9      ----------------------------------------------LTIIVENQDPKLAK
B6W7H3      ----------------------------------------------ISVKVVDTVAERAM
C7RGH5      ----------------------------------------------ISVKVVDTIPERAM
F0GT82      ----------------------------------------------ISVNVVDSVPTRAM
F3AH93      ----------------------------------------------LNVSVTSTDPKQAK
B0GAL4      ----------------------------------------------LQLSVEYSDAKQAK
G1WUK1      ----------------------------------------------LQLSVEYSDAKQAK
D4M2S1      ----------------------------------------------LSITATDKDPEMAK
E7GL80      ----------------------------------------------LYLTVTDPNPYMAK
G5F9E3      ----------------------------------------------LYLTVTDPNPYMAK
D4CG07      ----------------------------------------------LTLSVEDPDPILAA
D4MP31      ----------------------------------------------LTLSVEDPDPILAA
G5HNC6      ----------------------------------------------LNMTVSDEDPVRAR
A8RK86      ----------------------------------------------LNMTVSDTDPVRAK
G5HTB1      ----------------------------------------------LNMSVSDTDPVRAK
A8RSL0      ----------------------------------------------LSISVEDPDPAMAK
C5EN02      ----------------------------------------------LSISVEDPAPDMAK
G5HG46      ----------------------------------------------LSISVEDPDPNMAK
E7GL39      ----------------------------------------------LTLTIKDPNPYLAK
E7GL56      ----------------------------------------------LSLTVRDENPYMAK
G5F9B0      ----------------------------------------------LSLTVRDENPYMAK
D3AC81      ----------------------------------------------LTISVEDTDPYMAK
D3AE79      ----------------------------------------------LTISAKDTNPETAR
D4YF14      ----------------------------------------------FNISATMDTPGDAQ
B1YMM6      ----------------------------------------------INVSVQNTDAALAS
D4LG05      ----------------------------------------------LQITATTTDPQLSM
D4LTH3      ----------------------------------------------LQITATTTDPQLSM
F3ATF6      ----------------------------------------------MEVTARSSDPETAK
E0I7B6      ----------------------------------------------MDITFASTSYPQAA
C9LAS2      ----------------------------------------------LNITVEDSEPKMAQ
F7K8E8      ----------------------------------------------LAITVTDTDPVMAM
F7K9V0      ----------------------------------------------LAITVEDTDPVMAM
F7KL97      ----------------------------------------------LAITVTDTDPVMAM
D3FZP5      ----------------------------------------------VTIRVEDANPAMAV
C0ZHV9      ----------------------------------------------ISITVEDPDQGRAV
D7WMM9      ----------------------------------------------VNINVVDKQAELAV
A8U9F5      ----------------------------------------------FSLTVTDESPYEAS
F4BSE0      ----------------------------------------------FSLTVTDESPYESA
E7RDR2      ----------------------------------------------VDITVQDENPAQAV
I0JRK5      ----------------------------------------------VNVVATDEDPQQAA
G2TR26      ----------------------------------------------FTLTVKDTNPYMAT
D5DBK2      ----------------------------------------------AQITVQDTNAKRAT
D5DY80      ----------------------------------------------VQIVVQDTNAKRAT
A7Z9K1      ----------------------------------------------VTIAVRDTDAKRAA
I2CB17      ----------------------------------------------VTIAVRDTDAKRAA
I2HW54      ----------------------------------------------VTIAVRDTDAKRAA
G4P1M8      ----------------------------------------------VNISVKDENAETAA
E0TTZ7      ----------------------------------------------VNISVKDESAETAA
G4EQF2      ----------------------------------------------VNISVRDENAETAA
P96715      ----------------------------------------------VNISVRDENAETAA
I0F9R7      ----------------------------------------------VNISVRDENAETAA
G9QKR5      ----------------------------------------------LNVSVQDPDPDKAV
B5UQ74      ----------------------------------------------VTVTAQDNDPKVAR
B7HFH2      ----------------------------------------------ISVMAEDKDPKLAR
Q72XH7      ----------------------------------------------VTLMAQDQDPRLAR
C2V4M3      ----------------------------------------------VSVTTQDKDPKLAR
C2YZB3      ----------------------------------------------VAVTAKDKDPNLAR
C2P8H2      ----------------------------------------------VAVTAQDKDPKLAR
C2Y451      ----------------------------------------------VAVTAQDKDPKLAR
C3EBC1      ----------------------------------------------VALTAQDKDPKLAR
C3H980      ----------------------------------------------VAVTAQDKDPKLAR
C2PN23      ----------------------------------------------ISITVEDKNPKLAR
B9IRQ7      ----------------------------------------------VTVTAQDKSPSLAR
A0RL71      ----------------------------------------------ISVTAEDKDPKVAR
C2XJI0      ----------------------------------------------IAVTAEDKDPKIAR
Q3EV65      ----------------------------------------------IAVTAEDKDPKIAR
C2T8T7      ----------------------------------------------ISVTAEDKDPKLAR
C2RG50      ----------------------------------------------ISVTAEDKDPKLAR
Q814Y9      ----------------------------------------------ISVTAEDKDPKLAR
B3ZRD5      ----------------------------------------------ISVTAEDKDPKVAR
F0PU65      ----------------------------------------------ISVTADDKDPKVAR
Q6HB08      ----------------------------------------------ISVTADDKDPKVAR
C2NQN7      ----------------------------------------------ISVTAEDKDPKVAR
C3GRR1      ----------------------------------------------ISVTAEDKDPKVAR
C2ULR7      ----------------------------------------------ISVTAEDKDPKLAR
C3GBJ9      ----------------------------------------------ISVTAEDKDPKLAR
C2WVG7      ----------------------------------------------ISVTATDKDPKLAR
G9QCG2      ----------------------------------------------ISVTAEDKDPKLAR
C2QJY6      ----------------------------------------------ISVTAEDKNPKLAR
C2SSX9      ----------------------------------------------ISVTAEDKDPKLAR
B7IQS9      ----------------------------------------------ISVTAEDKDPKLAR
A9VRC4      ----------------------------------------------ISVTAEDKDPKLAR
C2MTG4      ----------------------------------------------ISVTAEDKDPKLAR
B7HXB5      ----------------------------------------------ISVTAEDKDPKLAR
C2SBU5      ----------------------------------------------ISVTAEDKDPKLAR
Q2BFS6      ----------------------------------------------LAITVQDPDPNMAA
I3EBB4      ----------------------------------------------VNISVQDPDPYQAA
A4ITF4      ----------------------------------------------FSVTVQDPDPAMAA
C5D962      ----------------------------------------------FSVTVQDPDPAMAA
G8MZ94      ----------------------------------------------FSVTVQDPDPAMAA
Q5KUM4      ----------------------------------------------FSVTVQDPDPAMAA
G5SDT9      ----------------------------------------------FGAGWERLMGRHNE
G5LQM7      ----------------------------------------------FGAGWERLMGRHNE
G5Q4J1      ----------------------------------------------FGAGWERLMGRHNE
G2Z8Q4      ----------------------------------------------ITIKVTDSSAEKAT
D9ST43      ----------------------------------------------IEFKVQNENPQEAY
H7F5T7      ----------------------------------------------INITATTDSPEEAA
G9WIR0      ----------------------------------------------FSISARSNDPVESR
D3LB11      ----------------------------------------------FSIAVRSTNSQESK
A0NKF7      ----------------------------------------------FSIAVRSTSSQEAK
Q04DV7      ----------------------------------------------FSIAVRSTSSQEAK
F6BI63      ----------------------------------------------INISVKDNDPKIAA
G2MWC1      ----------------------------------------------IEISVENSDPSKAA
B0K4N2      ----------------------------------------------IEISVKNSDPRKAA
C7ISF8      ----------------------------------------------IEISVKNSDPRKAA
B0KAR6      ----------------------------------------------IEISVKNSDPRKAA
E8UV30      ----------------------------------------------IEISVKNSDPRKAA
C0GGR6      ----------------------------------------------ISISVSDNSPDRAA
A4J8V1      ----------------------------------------------IQITVEDIDPERAA
C8VYQ7      ----------------------------------------------ISISIEDASPDKAA
C8W5K3      ----------------------------------------------INITVVDPNPNTAA
B1BNH4      ----------------------------------------------LDLSFKGGNPKEVL
B1V1Z3      ----------------------------------------------LDLSFKGGNPKEVL
B1R3V2      ----------------------------------------------LDLSFKGGNPKEVL
Q0SVR9      ----------------------------------------------LDLSFKGKNPKEVL
Q8XN47      ----------------------------------------------LDLSYKGGNPKDVL
G7M0Q2      ----------------------------------------------LEIKYVNQDKVIAK
G7M565      ----------------------------------------------LEISYISPHKSEAG
A6M2M0      ----------------------------------------------LEISYVSANQALAG
G7M1R8      ----------------------------------------------LEIKYVSKNKNQSE
A5V0I4      ----------------------------------------------MIVQVDYPDPATAQ
A7NQ70      ----------------------------------------------MIVQVDYPDPATAQ
Q4JZ56      ----------------------------------------------ISISVTNTNSDEAA
Q7X554      ----------------------------------------------ISISANAKTGQDAQ
Q7X550      ----------------------------------------------ISISVKAKTGQDAQ
Q7X562      ----------------------------------------------ISISVNAKTGQDAQ
Q7X556      ----------------------------------------------ISISVNAKTGQDAQ
Q7X552      ----------------------------------------------ISISVNAKTGQDAQ
Q7X558      ----------------------------------------------ISISVNAKTGQDAQ
C5NWJ9      ----------------------------------------------ISITVRDKDPQVAS
F3A498      ----------------------------------------------ISITVRDKDPQVAS
Q9AHD3      ----------------------------------------------VSISVNDRVPEEAS
Q4K2E2      ----------------------------------------------VSISVKDKQPEEAS
Q4K2F8      ----------------------------------------------VSISVKDKQPEEAS
Q4K046      ----------------------------------------------VSISVKDKQPEEAS
Q4K0R8      ----------------------------------------------VSISVKDKQPEEAS
Q4JYY0      ----------------------------------------------VSISVKDKQPEEAS
Q4JZW8      ----------------------------------------------VSISVKDKQPEEAS
I0J9C8      ----------------------------------------------VSISVKDKQPEEAS
Q4K0M4      ----------------------------------------------VSISVKDKQPEEAS
Q4JZS4      ----------------------------------------------VSISVKDKQPEEAS
Q4JZK2      ----------------------------------------------VSISVKDKQPEEAS
Q9AHA5      ----------------------------------------------VSISVKDKQPEEAS
Q9X9A0      ----------------------------------------------VSISVKDKQPEEAS
Q4JYK9      ----------------------------------------------VSISVKDKQPEEAS
Q4K006      ----------------------------------------------VSISVKDKQPEEAS
Q4JZG8      ----------------------------------------------VSISVKDKQPEEAS
A6YIA7      ----------------------------------------------VSISVKDKQPEEAS
E5F5C4      ----------------------------------------------VSISVKNKQPEEAS
Q9AHB8      ----------------------------------------------VSISVKDKQPEEAS
Q4JZL8      ----------------------------------------------VSISVKDKQPEEAS
Q4K1B8      ----------------------------------------------VSISVKDKQPEEAS
Q8VU32      ----------------------------------------------VSISVKDKEPEEAS
D2ERX9      ----------------------------------------------VSISVKNKQPEEAS
G6C7Z0      ----------------------------------------------VSISVKDKQPEEAS
Q4K2A9      ----------------------------------------------VSISVKDKQPEEAS
D6ZQI7      ----------------------------------------------VSISVKDKQPEEAS
Q9ZFT9      ----------------------------------------------VSISVKDKQPEEAS
Q4K255      ----------------------------------------------VSISVKDKQPEEAS
F9HJP7      ----------------------------------------------VSITVTNGDPNQAS
E8JWI4      ----------------------------------------------VSITVTHADPAEAS
A8AZR4      ----------------------------------------------VSITVKNSDPNQAS
D0RXH3      ----------------------------------------------VSITVKNSDPNQAS
Q83YR6      ----------------------------------------------VSITVKNSDPNQAS
F1Z125      ----------------------------------------------ISIAVTNHDPQAAK
Q3K0S9      ----------------------------------------------ISISVEDANPKMSQ
P0C0T8      ----------------------------------------------ISISVEDANPKMSQ
Q67AY5      ----------------------------------------------ISISVEDANPKMSQ
Q04662      ----------------------------------------------ISISVEDANPKMSQ
Q8GP93      ----------------------------------------------ISISVNAKTGQDAQ
Q8GPF7      ----------------------------------------------ISISVNAKTGQDAQ
E3CP61      ----------------------------------------------ISISVSAKTGQDAQ
E8KUY7      ----------------------------------------------ISISVSAKTGQDAQ
C2LSE5      ----------------------------------------------ISISVNAKTGQDAQ
E9DM16      ----------------------------------------------ISISVNAKTGQDAQ
I0QIK5      ----------------------------------------------ISISVNAKTGQDAQ
Q7X560      ----------------------------------------------ISISVNAKTGQDAQ
Q8GMA6      ----------------------------------------------ISISVNAKTGQDAQ
Q55204      ----------------------------------------------ISISVNAKTGQDAQ
Q8GPC4      ----------------------------------------------ISISVNAKTGQDAQ
Q8GPA9      ----------------------------------------------ISISVNAKTGQDAQ
G6ERT2      ----------------------------------------------ISISVNAKTGQDAQ
O87930      ----------------------------------------------ISISVNAKTGQDAQ
Q8GP55      ----------------------------------------------ISISVKAKTGQDAQ
F8HDC4      ----------------------------------------------ISISVKAKTGQDAQ
F8LJ76      ----------------------------------------------ISISVKAKTGQDAQ
F8LXJ5      ----------------------------------------------ISISVKAKTGQDAQ
Q1WCR2      ----------------------------------------------ISISVKAKTGQDAQ
G3G7C0      ----------------------------------------------VSISVRDADPNEAA
G3G7J8      ----------------------------------------------VSISVRDADPNEAA
G7SNU7      ----------------------------------------------VSISVRDADPNEAA
G8DU30      ----------------------------------------------VSISVRDADPNEAA
A4VTU2      ----------------------------------------------VSISVRDADPNEAA
D5AGQ4      ----------------------------------------------VSISVRDADPNEAA
Q9X4U6      ----------------------------------------------VSISVRDADPNEAA
G3G7G5      ----------------------------------------------VSISVRDADPNEAA
G7SG35      ----------------------------------------------VSISVRDADPNEAA
G8DU06      ----------------------------------------------VSISVRDADPNEAA
G8DUA9      ----------------------------------------------VSISVRDADPNEAA
G8DTY9      ----------------------------------------------VSISVRDADPNEAA
G3G7I7      ----------------------------------------------VSISVRDADPNEAA
G3G7J3      ----------------------------------------------VSISVRDADPNEAA
E0PD82      ----------------------------------------------ISISVEDTDAQEAA
F5X651      ----------------------------------------------ISISVEDTDGQEAA
G5JTD6      ----------------------------------------------ITIAVQDRSPQEAS
Q2KM75      ----------------------------------------------ISISVNNHEPQKAK
G5KAJ3      ----------------------------------------------ISISVTNHHPQEAK
B9DUJ5      ----------------------------------------------ISITVTNHDPQQAK
G5KD12      ----------------------------------------------ISISVTNHDPQQAK
E8JMT8      ----------------------------------------------ISISVEDTDAQEAA
F5X0J8      ----------------------------------------------ISISVEDTDAQEAS
H2A601      ----------------------------------------------ISISVEDTDAKEAS
E7S8W2      ----------------------------------------------LSITASDPDPQEAA
F8DFF5      ----------------------------------------------LSITAKDGDPKEAA
I1ZPH8      ----------------------------------------------LSITAKDGDPKEAA
E3CBR9      ----------------------------------------------LSITAKDGDPKEAA
E8K787      ----------------------------------------------LSITAKDGDPKEAA
F9M365      ----------------------------------------------LSITAKDGDPKEAA
A3CQY3      ----------------------------------------------VSITVKDDNPEEAA
E8KLZ0      ----------------------------------------------VSITVKDDNPEEAA
F0FHA9      ----------------------------------------------VSITVKDDNPEEAA
F0FQQ4      ----------------------------------------------VSITVKDDNPEEAA
F0I4H6      ----------------------------------------------VSITVKDDNPEEAA
F0IAY2      ----------------------------------------------VSITVKDDNPEEAA
F0IJI1      ----------------------------------------------VSITVKDDNPEEAA
F0IS52      ----------------------------------------------VSITVKDDNPEEAA
F2C9N1      ----------------------------------------------VSITVKDDNPEEAA
F2CH54      ----------------------------------------------VSITVKDDNPEEAA
F3UDW8      ----------------------------------------------VSITVKDDNPEEAA
F3UNJ5      ----------------------------------------------VSITVKDDNPEEAA
F3SM33      ----------------------------------------------VSITVKDDNPEEAA
F9HC66      ----------------------------------------------VSIVVKDDQPEEAS
E1LQJ6      ----------------------------------------------VSITVKNAQPEEAS
Q4JYU0      ----------------------------------------------VSITVKNAQPEEAS
Q4JZY2      ----------------------------------------------VSITVKNAQPEEAS
F9Q346      ----------------------------------------------VSISVTDRAPEEAS
Q6L5R1      ----------------------------------------------VSISVTDRAPEEAS
E9FEC6      ----------------------------------------------VSISVTDRLPEEAS
E0Q2S9      ----------------------------------------------VSISVTDRLPEEAS
F5VSH0      ----------------------------------------------VSISVTDRLPEEAS
A5YTV6      ----------------------------------------------VSISVTDRVPEEAS
Q6L5T1      ----------------------------------------------VSISVTDRAPEEAS
E0PPH8      ----------------------------------------------VSISVTDRAPEEAS
A5YTT8      ----------------------------------------------VSISVTDRAPEEAS
E6KKR9      ----------------------------------------------VSISVTDRAPEEAS
A1ILY0      ----------------------------------------------VSISVTDRAPEEAS
F2QF91      ----------------------------------------------VSISVTDRAPEEAS
Q4K0I3      ----------------------------------------------VSISVKDKQPEEAS
Q8KWQ1      ----------------------------------------------VSISVKDKQPEEAS
Q4K238      ----------------------------------------------VSISVKDKQPEEAS
B1I966      ----------------------------------------------VSISVKDKQPEEAS
G6J8A3      ----------------------------------------------VSISVKDKQPEEAS
G6LKG4      ----------------------------------------------VSISVKDKQPEEAS
F9LZC3      ----------------------------------------------VSISVKDKQPEEAS
F9P1W9      ----------------------------------------------VSISVKDKQPEEAS
A5LJR9      ----------------------------------------------VSISVKDKQPEEAS
Q9ZII7      ----------------------------------------------VSISVKDKQPEEAS
Q4K1K7      ----------------------------------------------VSISVKDKQPEEAS
E1LPE6      ----------------------------------------------VSISVNNRVPEEAS
F9MJW6      ----------------------------------------------VSISVNDRVPEEAS
Q4K0V3      ----------------------------------------------VSVSVSDRVPEEAS
Q54519      ----------------------------------------------VSVSVSDRVPEEAS
C1CBD0      ----------------------------------------------VSISVNDQVPEGAS
Q7WVX1      ----------------------------------------------VSISVNDQVPEGAS
Q4K0E2      ----------------------------------------------VSISVNDRVPEEAS
Q9AH96      ----------------------------------------------VSISVNDRVPEEAS
A5M4L2      ----------------------------------------------VSVSVNDRVPEEAS
B2ILP4      ----------------------------------------------VSVSVNDRVPEEAS
C1CCB8      ----------------------------------------------VSVSVNDRVPEEAS
P72511      ----------------------------------------------VSVSVNDRVPEEAS
Q4K1S8      ----------------------------------------------VSVSVNDRVPEEAS
P96474      ----------------------------------------------VSVSVSDRVPEEAS
Q4K196      ----------------------------------------------VSVSVNDRVPEEAS
Q4K0Z7      ----------------------------------------------VSVSVNDRVPEEAS
Q4JZ85      ----------------------------------------------VSVSVNDRVPEEAS
Q4JYH6      ----------------------------------------------VSISVNDRVSEEAS
Q4JZ19      ----------------------------------------------VSVSVNDRVPEEAS
Q4K0A1      ----------------------------------------------VSVSVNDRVPEEAS
Q4K1M5      ----------------------------------------------VSVSVNDRVPEEAS
Q4K2Q8      ----------------------------------------------VSVSVNDRVPEEAS
Q4K1G0      ----------------------------------------------VSVSVNDRVPEEAS
Q4K0T6      ----------------------------------------------VSVSVNDRVPEEAS
Q4K0K3      ----------------------------------------------VSVSVNDRVPEEAS
Q4K0X6      ----------------------------------------------VSVSVNDRVPEEAS
E8KDN1      ----------------------------------------------VSISVKDGNPEEAS
F9PEU3      ----------------------------------------------VSISVRDGKPEEAS
E8K321      ----------------------------------------------VSISVRDGKPEEAS
F9PZP6      ----------------------------------------------VSISVRDGNPEEAS
D6R2T7      ----------------------------------------------VSITVKNKSPEEAA
F3UUQ1      ----------------------------------------------VSITVKNKSPEEAA
E6IZC3      ----------------------------------------------VSIAVSDGDAKEAA
G6A746      ----------------------------------------------VSIAVSDGDAKEAA
B1V0N8      ----------------------------------------------LEISYRSYNKEEVD
B1BNK2      ----------------------------------------------LEISYRSYNKEEVD
B1R3X7      ----------------------------------------------LEISYRSYNKEEVD
Q8XN77      ----------------------------------------------LEISYRSYNKEEVD
A3ICA4      ----------------------------------------------VNIRVQDENEARAV
B1HR40      ----------------------------------------------VNIRVQDEDEARAV
H1BJT0      ----------------------------------------------ITIRANSEDPYLSQ
F8FCE3      ----------------------------------------------MTLVIRDTDYRRAA
I0BSG5      ----------------------------------------------MTLVIRDTDYRRAA
A8YPQ6      ----------------------------------------------INIQVKSGHKQDSE
P95695      ----------------------------------------------INIQVKSGHKQDSE
Q2G1K8      ----------------------------------------------INIQVKSGHKQDSE
C5QNG5      ----------------------------------------------LNVGVRSKSEKESE
Q4L9H8      ----------------------------------------------LNVNVESKNKKDSE
Q2FUV1      ----------------------------------------------ITVSVTTGNKSESD
P39850      ----------------------------------------------LNIDVESKSGSNSE
D7UYE3      ----------------------------------------------LNISVRSNSRATSK
Q4A121      ----------------------------------------------LNIAVENESREAAG
E3HB17      ----------------------------------------------IKISYTDINARKAT
C9AAE4      ----------------------------------------------IEINAYHQSPKIAA
H7F6C7      ----------------------------------------------IDISVEHPDPKVAA
F0SX23      ----------------------------------------------FAVSVTAANPDEAA
Q38VG4      ----------------------------------------------FSVTAKADNAYTAA
F2I4B6      ----------------------------------------------FSIIVNDPNPERAA
Q8RBS6      ----------------------------------------------IEISVRDNNPERAA
D9SR42      ----------------------------------------------MTIRFSSKDPELAA
D9SVC8      ----------------------------------------------MTIRVTLRNPEEAA
E7RG09      ----------------------------------------------LTIFVTDPDPAVAV
D4G2E2      ----------------------------------------------VNISVRDENAETAA
Q8EME7      ----------------------------------------------VTVTATDPDPLLAT
D6Y035      ----------------------------------------------VTISIEDTDPSMAV
Q5WBB3      ----------------------------------------------VTITVESESPADAT
Q9K6Q9      ----------------------------------------------VNITVKHEKPAMAV
Q97EP7      ----------------------------------------------IDITANAKSPEEAA
Q97ER4      ----------------------------------------------IDITANGKSPDKAA
E4S7Y7      ----------------------------------------------LMINIESKDPKYAA
E4Q5T6      ----------------------------------------------LMINIESKDPKFAA
E4SDX3      ----------------------------------------------LMINIESKDPKFAA
G2FWX3      ----------------------------------------------LEITVSNTTPELAA
G7WJV2      ----------------------------------------------LEIRVRNTSPEQAA
G7W774      ----------------------------------------------LEIQVLNTDPQLAT
G2FM60      ----------------------------------------------LEIQVTNTNSELAA
H5XZD5      ----------------------------------------------LEIQVSNTNSELAA
I4DBG9      ----------------------------------------------LEIKVSNNDPKLAA
G2FWT7      ----------------------------------------------LEIQVSNTDPKLAA
H5XZG8      ----------------------------------------------LEIQVLNKDPELAA
G0V448      ----------------------------------------------MDIKVQSKDPKDAM
A0PZ01      ----------------------------------------------MDIKVQSKDPEKAR
B1B737      ----------------------------------------------MDIKVQNKDPERAR
                                                                        

G7EJX5      FEVMKSDS------IAREVITKLNLKT-------TPIL----------------------
G9RSY8      -----QAP------ITNDQLT---------------------------------------
F3CAY8      -----TPE------VRRQAIVSVAGDH---------------------------------
I0UTA4      QYANAIAK------AYLEVRQNNL--KETITDS-VKKL----------------------
B7B948      DVINTLIS------AYNTDAINDK--N-QIVMN-TSNF----INDRLIVIEKELGDVDSD
G8AU95      AIANAFGQ------AYLDYRTEMN--R-DMTER-VNQW----LGGRLIEAREAVRGAEEA
G5IFS2      AIADEMAS------VAASRMAEIM--D-TAPPN-IVEE----GYVPTRQTSPSLVKNTAI
F0G6H6      SILNAVGD------AYLAQNTQRK--S-EAADK-LIRF----MDAQLPQLKAQLEAAEGR
F6CNF6      RIANTLSR------EYLQLISEKN--Q-EQMTR-SVSF----LKQQREATEKELQKAVEA
A3W0H6      EVANDFVE------TVIAENRERR--M-ALVRE-TFDF----FSAEETRVSARIAEVEGV
A3K8W6      VVANDLMT------KVIAESRDRS--A-EQASE-TLAF----YQTEEARVDAEIVALEDR
Q0FMP1      DVANEMMY------QVINQSRDRS--L-SSARD-TLAF----FESEEARVETEIEAMEAK
S9QRP2      DVANELMT------TVIEQSRSRS--A-SSARD-TLEF----FEKEEARIGAEISEQESR
D0D9W1      DLANELME------TVIRQSRDRS--V-DRARD-TLAF----FEEEAARVEASIEAQELR
I1AYC4      DLANELMN------TVIEQSRDRS--V-SRARE-TLDF----FESEEARVEAEIQAKEAE
E9TE87      DILNSIAR------NYQEQNIERK--S-AEASK-SLAF----LAQQLPEVRSRLDVAENK
E6PYQ4      IVVNTLVD------EYFEESFEQR--Y-KSTQD-ISRY----LTTRLESLESKIQNEQNE
C0QCJ1      RITNTLTS------FFMDENLKLR--E-AQAIG-TSEF----LDAELEKTRKKLVDREEQ
I5B297      RIANTLAS------YFMDENLKVR--E-AQAIG-TSEF----LDSELEKTKKRLEEKEQK
B8D0N1      QIISYLIE------EFIINNRNLK--K-SATVN-ARNY----VARQLEKVSRDLKNIEAE
D9QTC7      RIANTLVD------KFQQMNQAMN--Q-SDLQG-AAGF----VSKQLKEVKTRLANLEEK
C7LPS4      DFVNTITQ------VYIESNTASK--R-DESLE-ATRF----LSEQIESFKKRLDAVEDE
Q314L4      DFVNTLTR------HYIEQSTSDK--R-EESFE-ATRF----LADQIEVFRKRIEAVQAE
G0VNK5      QANNLIVQ------GFMNRLTELS--H-DEQKR-TREF----LEQRLGASKDELSQAEDK
D2RIR1      EANQLLVQ------GFLDRLAQLS--H-AESSA-TREF----LEQRVKSSKKELDDAETK
I0GRR3      EANQLIVD------GFLSRLAELS--H-AEQGA-TRAF----LEERVESSKKELSDAEDK
Q39U16      DYVNTLVR------KYVEENVSSK--R-QDSFG-ADRF----ISEQLKTFKDKLDESENK
F0JCB9      DVVNTLTR------VYIEDSVSNK--R-KESYE-ATRF----LADQIEVFKKRIDEAKKE
G7QCG0      DFINTMAR------VYIERNTSTK--R-EESTE-ATKF----LAEQIETFKKRVDAADEA
I2Q342      DFINTMAR------VYIERNTSTK--R-EESTE-ATKF----LADQIETFKKRVDTADEA
Q74BQ7      DFVNTLVR------RYVEENISSK--R-EESYG-AIKF----LSEQIDTFRGKLEEAEGE
B5EA80      DYVNTLVR------LYIEGNISSK--R-GESYD-ATKF----LSEQIDTFNAKLQKVESE
C6DZX6      DYVNTLVR------LYIEGNISSK--R-GESYD-ATKF----LSEQIDTFNEKLQKAENE
A1ARV9      DFVNTLVR------LYIEENTSSK--R-GESYD-ATKF----LGEQIDTFREKLEKAEKE
E8WSZ4      DLVNTLVR------LYVEQSTSSK--R-GESYD-ATKF----LSEQIQAFNRKLQSAEAE
A5G425      DYVNTLVR------RYIEENVSSK--R-EESYG-ATKF----LSEQIEVYKEKMDKAEAE
B9M2X7      DYVNTLVR------RYIEENSSSI--R-AESYG-ASKF----LSEQITVLKEKMDKAEAE
C2MBF7      VILYDIKS------SLVGKVQEPI--T-APLGD-TIATPIGQVVVEATPYYSNFPSYEVL
H8YYB8      RVANDITS------LFLSENLKDR--Q-ESAKE-TTAF----LQKELAKLTDKLSLLEAR
E7T802      EIQLLQSR------MILGKTIAELNLHDIVEQKYFPIV----------------------
F4SM98      EIALLQSR------MILGKTVDDLNLQAIAEKNYFPIF----------------------
C4Z673      KIANSVRD------LAAKHITEVM--D-I--EA-VNVV----------------------
E3H7M4      LIVNHVSE------EFMIKIKSVM--R-F--DN-LKII----------------------
C2EWM2      AIANTVAS------VFKQQIKHIM--S-V--NN-VTII----------------------
D0DSJ3      VIANTVAK------VFKKQIRSMM--N-V--NN-VTIV----------------------
B2GF32      VIANTVAK------VFKKQIRSMM--N-V--NN-VTIV----------------------
C0WW25      VIANTVAK------VFKKQIRSMM--N-V--NN-VTIV----------------------
F8KGP2      VVANTVAN------VFKQQIKKIM--S-V--NN-VTIV----------------------
B3XL22      VVANTVAN------VFKQQIKKIM--S-V--NN-VTIV----------------------
F8DRU3      VVANTVAN------VFKQQIKKIM--S-V--NN-VTIV----------------------
B1MZT2      LVANTVAD------SFKAKIGGFM--K-I--NN-VSII----------------------
H1WR07      LVANTVAD------SFKAKIGGFM--K-I--NN-VSII----------------------
Q03W94      DVANEVAD------AFKDKIGGFM--K-I--NN-VSIV----------------------
C2KHF2      DVANEVAD------VFKDKIGGFM--K-I--NN-VSII----------------------
H1X4N3      DVANEVAA------VFKDKIGGFM--K-I--NN-VSII----------------------
C2JZS0      DIANEIAR------VFKTKIATIM--S-I--SN-VSIV----------------------
C1J9I2      DIANEIAK------VFEKKIAKIM--S-I--SN-VSVV----------------------
Q58Z11      DVANEIAK------VFKAKIASIM--S-V--SN-VSIV----------------------
F0K0J8      AIANAVAK------EFKEQIPKIM--N-V--NN-VTIV----------------------
G6F8H0      AIANAVAK------EFKEQIPKIM--D-V--NN-VTIV----------------------
Q1G8E3      AIANAVAK------EFKEQIPKIM--N-V--NN-VTIV----------------------
D8FLF7      AIANAVAK------EFKEQIPKIM--D-V--NN-VTIV----------------------
F0HVF2      AIANAVAK------EFKEQIPKIM--D-V--NN-VTIV----------------------
Q5FIC6      AEVNAVAE------TFRKEIPTIM--S-V--NN-VTIV----------------------
E4SMV6      AEVNAVAE------TFRKEIPNIM--S-V--NN-VTIV----------------------
F0TGY3      AEVNAVAE------TFSKEIPNIM--S-V--NN-VTIV----------------------
F2M2M7      AEVNAVAE------TFRKEIPTIM--S-V--NN-VTIV----------------------
C4VP07      AEANAVAE------TFKNEIPKIM--N-V--NN-ITII----------------------
D6S4X3      AEANAVAQ------TFKTEIPEIM--S-V--NN-VTVI----------------------
A4ZGZ7      AEANAVAR------SFRDQIPNIM--N-I--DN-VTIF----------------------
C2EPK4      AEVNAVAE------TFSKEIPNIM--S-V--NN-VTIV----------------------
C7XKF2      VEANAVAR------SFRDQIPNIM--N-I--NN-VTIV----------------------
E3R265      VEANAVAR------SFRDQIPNIM--N-I--NN-VTIV----------------------
D0DJG9      VEANAVAR------SFRDQIPNIM--N-I--NN-VTIV----------------------
D5GZJ9      VEANAVAR------SFRDQIPNIM--N-I--NN-VTIV----------------------
A8YX90      AEANAVAR------SFRDQIPNIM--N-I--DN-VTIV----------------------
F0NWJ8      AEANAVAR------SFRDQIPNIM--N-I--DN-VTIV----------------------
C6CW36      ETVNAISL------VFKEEIPKIM--N-V--DN-ITIL----------------------
A8SQS9      DIANTLAN------VAIDYLPDTMSTN-A-----PNIA----------------------
D5HFS3      DIANTLAN------VSIEYLPDTMSTS-A-----PNIA----------------------
A5Z5P8      TIANALAE------KAVTEIPKLM--G-TSS---PNIA----------------------
G2KUP2      DIANETAK------VFQNKIKKMM--D-INS---VTIV----------------------
G8PE07      KIANKTAS------VFKNKIGKIM--S-VNN---VSMV----------------------
E0NHP5      KMANETAK------VFKRKVVKIM--S-INN---VSIV----------------------
Q03GL9      KMANETAT------TFKNKVVKIM--S-INN---VSIV----------------------
C6CSC7      KIVNAISL------VFQQEIPNIF--Q-VEN---VSIL----------------------
C6CS79      QVVNTVSY------VFQQQIPLIM--K-VDN---VYIL----------------------
F5LM70      QMINTVAQ------MFQKQIPNIM--K-IDN---VFVL----------------------
G0LYN8      TIANQIAR------SFKNQVQKII--K-VNN---VTIV----------------------
F6ITB3      TIANQIAR------SFKNQVKKII--K-VNN---VTIV----------------------
G0M1Y0      TIANQIAR------SFKNQVKKII--K-VNN---VTIV----------------------
D7VC12      TIANQIAR------SFKNQVQKII--K-VNN---VTIV----------------------
F9UMZ5      TIANQIAR------SFKNQVQKII--K-VNN---VTIV----------------------
D4JI68      TIADEIAK------VASAYIAEKM--K-QDP---PTII----------------------
D6E329      TIADEIAK------VASAYIAEKM--K-QDP---PTII----------------------
Q1AUN7      RVANAVGE------VFSERVSEVS--P-GANAITATVW----------------------
H4GK02      AMANTVAS------VFKKRVKKIM--D-VNN---VTIV----------------------
F6IR92      VIANQIAT------TFKSQVKQII--K-VNN---VTIV----------------------
G0M0G0      VIANQIAT------TFKSQVKQII--K-VNN---VTIV----------------------
D7VBW5      MIANQIAA------TFKDQVQHII--R-VNN---VTIV----------------------
F9UQ55      MIANQIAA------TFKDQVQHII--K-VNN---VTIV----------------------
B9Y883      VIANEIVD------VFRDKIYSIM--N-I--EN-VTVL----------------------
D4YHG8      NLANAIAV------SFSEVVQQVL--Q-V--EN-VSIV----------------------
F7V793      EIANTLAY------KAVNYLPKLT--K-T--LK-PTIV----------------------
C3WFM8      MVTNEIAN------EFMDKVVQVM--R-V--RN-VNIV----------------------
H7F1R6      KIANETVR------VFKKEIPKIM--K-I--DN-ISVL----------------------
H7F570      KIANDVVQ------TFRNEIPKIM--K-V--DN-VYIL----------------------
C6LCS6      AIADEVRN------AVSAQIIKVM--D-V--EA-VNVV----------------------
A7VF43      NIANTLAE------ISVKYLPETM--S-T--NA-PNIA----------------------
A7Z922      AIANTLMK------TFKKEVRDRM--N-I--KG-VIVL----------------------
I2CAF3      AIANTLMK------TFKKEVRDRM--N-I--KG-VIVL----------------------
I2HVL3      AIANTLMK------TFKKEVRDRM--N-I--KG-VIVL----------------------
E0U2Z4      DIANTLVN------KFEKEVDERM--N-V--QG-VHIL----------------------
D4G1R3      EIANTLVN------KFEKEVDERM--N-V--QG-VHIL----------------------
G4EQZ6      EIANTLVN------KFEKEVDERM--N-V--QG-VHIL----------------------
P71050      EIANTLVN------KFEKEVDERM--N-V--QG-VHIL----------------------
G4P115      EIANTLVN------KFEKEVDERM--N-V--QG-VHIL----------------------
A8FHM0      AIANTATE------VLQEEIKKTM--N-M--DR-INVL----------------------
C0EBA5      NLANAVTE------FAPAVIKSVI--G-IGEDS-VSVL----------------------
F4FXQ8      AIANTVAK------VFKQKIRRIM--S-I--NN-VTIV----------------------
C0WV34      AIANTVAK------VFKQKIRRIM--S-I--NN-VTIV----------------------
H1LCW2      AIANTVAK------VFKQKIRRIM--S-I--NN-VTIV----------------------
B7BDT7      NITATLND------TVDAPIGRLV----------VKVA----------------------
H6LKR9      KVSDELAK------QLTIAVSQIV--G-V--EN-IRIL----------------------
F5LE49      KLANAVSD------VFKAEISGIM--K-V--DN-VTIL----------------------
F3AHH1      DIANTLRD------TAAEHIKNVM--N-I--EA-VNVV----------------------
F3Y921      KIANLTAN------TFQQKAKHTL--N-V--DK-VIII----------------------
G4L593      HIANTAAE------VFQDTVQDVLT-N-V--DK-ITIV----------------------
E6LD65      HIANTVAK------TFQDNAKDVL--N-V--DR-ITIT----------------------
C9ALZ8      QIANTTSQ------VFQENAKDVM--N-V--DK-ISII----------------------
C9BUG6      QIANTTSQ------VFQENAKDVM--N-V--DK-ISII----------------------
Q3XYS7      QIANTTSQ------VFQENAKDVM--N-V--DK-ISII----------------------
C9B453      QIANTTSQ------VFQENAKDVM--N-V--DK-ISII----------------------
D4RJF5      QIANTTSQ------VFQENAKDVM--N-V--DK-ISII----------------------
F0EKB8      NIANTTAL------VFQENAQDVM--N-V--DK-ISII----------------------
C9A6V4      NIANTTAL------VFQENAQDVM--N-V--DK-ISII----------------------
C9CHY7      NIANTTAL------VFQENAQDVM--N-V--DK-ISII----------------------
C8ZXT8      KIANTTAL------VFQENAKDVM--N-V--DK-ISII----------------------
G5IRQ5      KIANTTAL------VFQENAKDVM--N-V--DK-ISII----------------------
E6UHY5      DICSYISE------LAQEVITRTT--K-A--GS-VETV----------------------
E9SAU2      DICSYISE------IAPDMIIRTT--K-A--GY-VETV----------------------
F7K0U2      EIADAVRE------SASVQITQIT--D-A--DA-VNMV----------------------
O06029      KIADETAK------IFSSDAAKLL--N-V--TN-VNIL----------------------
G8P3D6      KIADETAK------IFSSDAAKLL--N-V--TN-VNIL----------------------
A9QSJ3      KIADETAK------IFSSDAAKLL--N-V--TN-VNIL----------------------
F9VC43      KIADETAK------IFSSDAPKLL--N-V--TN-VNIL----------------------
G6FD41      KIADETAK------IFSSDAAKLL--N-V--TN-VNIL----------------------
G9M881      KIADETAK------IFSSDAAKLL--N-V--TN-VNIL----------------------
Q3ZK51      KIADETAK------IFSSDAAKLL--N-V--TN-VNIL----------------------
Q83VG0      KIADETAK------IFSSDAEKLL--N-V--TN-VNIL----------------------
C6LDI9      RIVDELTV------ILIDTAAEVM--D-S--AK-PNII----------------------
G5F9H3      SIVDEVAN------TASDYIGEIM--E-M--VP-PKLI----------------------
C0CZV8      AIADKVAA------TASDYVGDIM--E-M--VP-PKLI----------------------
G5GFW1      KIVDEVAN------TASDYIGDLM--E-M--VP-PKLI----------------------
I5AV00      DIANCVRE------EAAKHITNVM--D-A--EA-VNVV----------------------
H6NE44      ETVNAISY------TFQKEIENVM--K-V--SN-ITTL----------------------
F4BS20      EMANLMAA------TFQENIDGII--N-V--EN-VAIL----------------------
E0RZL4      KIANCIRE------VASEHITNVM--D-I--DA-INIA----------------------
C0CK72      KVVNTLVQ------VSMDSVKEI---D-A--KE-PYLV----------------------
D9S1J8      TIANAVSE------SFSRQVIRIM--N-V--EN-VQVI----------------------
C2EFR7      RLANSIRD------ESIKHVTKVM--K-V--IS-VGVV----------------------
Q1WTC7      RLANSIRD------ESIKHVTKVM--K-V--IS-VGVV----------------------
B0P2G1      SITQDLAE------VTAKTVAEKM--D-V--KS-PTII----------------------
D4MW28      SITQDLAE------VTAKTVAEKM--D-V--KS-PTII----------------------
E5VMX9      SITQDLAE------VTAKTVAEKM--D-V--KS-PTII----------------------
F2I6Z8      GLASDISK------EFIQQLPQVL--A-V--DK-VTLL----------------------
E6U7N3      NIANDIAR------VAPSIIIQTV--K-A--GS-VEVV----------------------
C4Z8M6      TIADEIAK------VASAYIAEKM--K-Q--DP-PTII----------------------
D4JMC3      TVADEIAK------VSSQYIADNM--E-Q--SQ-PKII----------------------
D6E0V3      TVADEIAK------VSSQYIADNM--E-Q--SQ-PKII----------------------
E3GPC7      SIANETAK------VFMSNIGELM--K-I--SN-LQVV----------------------
A6BIG6      QIADAVRN------AVSVQIKQIM--N-V--DS-VNTV----------------------
C2CI43      DIANETAN------IFKGSIGDIM--K-V--DN-VQIL----------------------
D4RX68      EITDDIAT------VTSERICEVM--K-V--ENMVSLV----------------------
D4J4T5      DIANEMAS------VAESKLKEIT--G-M--QA-IKIY----------------------
I5ASF9      KVVDTLAA------VSSAYIADKM--E-V--QA-PKIV----------------------
C0C0F9      EIADALRE------SVSIQITEIM--D-A--DS-VNTF----------------------
B6W7H3      DIANATSM------VFKDSVTKIM--K-V--DN-VQIL----------------------
C7RGH5      DIANETAN------IFKSSIGEIM--N-V--DN-VQIL----------------------
F0GT82      DIANETAN------IFKSSIGDIM--K-V--DN-VQIL----------------------
F3AH93      ILVDELAV------VSSEYVGDKM--E-V--IP-PKII----------------------
B0GAL4      EIVDKLSE------VASEYIGDKM--E-V--TP-PKII----------------------
G1WUK1      EIVDKLSE------VASEYIGDKM--E-V--TP-PKII----------------------
D4M2S1      KIADTLAK------TSADFIGDKM--E-V--TP-PKII----------------------
E7GL80      AIVDEIAN------AASDYIGEIM--E-M--TP-PKLI----------------------
G5F9E3      AIVDEIAN------AASDYIGEIM--E-M--TP-PKLI----------------------
D4CG07      DIVNTVAE------CSSEYIGEIM--E-M--IP-PKIV----------------------
D4MP31      DIVNTVAE------CSSEYIGEIM--E-M--IP-PKIV----------------------
G5HNC6      AIVDEVAR------ASSDYIGDIM--E-M--IP-PKII----------------------
A8RK86      AIADEVAN------ASSDYIGDIM--E-M--VP-PKII----------------------
G5HTB1      AIVDAVAK------ASSDYIGDIM--E-M--IP-PKII----------------------
A8RSL0      LIADKIAV------TSSDYIGDIM--E-M--VP-PKLI----------------------
C5EN02      LIADKIAT------VSSDYIGDIM--E-M--VP-PKLI----------------------
G5HG46      MIADKIAT------VSSDYIGDIM--E-M--VP-PKLI----------------------
E7GL39      SIVDEVAN------TASDYIGEIM--E-M--VP-PKLI----------------------
E7GL56      QIVDDIAN------TASDYIGEIM--E-M--VP-PKMI----------------------
G5F9B0      QIVDDIAN------TASDYIGEIM--E-M--VP-PKMI----------------------
D3AC81      SIADEFAS------VASARMAEIM--D-S--AP-PNIV----------------------
D3AE79      AIADEVAS------VSVARIAEIM--D-S--VP-PKIV----------------------
D4YF14      NIVNSVIT------EFEKTLISIYGDD-V--SN-LYVV----------------------
B1YMM6      NVANSVAK------VFSDDITDLM--N-V--DN-VKVL----------------------
D4LG05      DLAETMAE------EAVSYLPDTM--S-T--KA-PNIA----------------------
D4LTH3      DLAETMAV------EAVSYLPDTM--S-T--KA-PNIA----------------------
F3ATF6      KIADTMAV------VSAQYIKEKM--E-V--AP-PKII----------------------
E0I7B6      KAVNAIAK------IFKGQNPSIM--K-V--DN-VTVL----------------------
C9LAS2      KIVNEVAS------ISSQFIGDKM--E-V--KA-PKII----------------------
F7K8E8      QLANAIRE------AAAVHIMNVM--D-I--QA-VNVS----------------------
F7K9V0      QLANSIRE------AAAVHIMNVM--D-I--QA-VNVS----------------------
F7KL97      QLANAIRE------AAAVHIMNVM--D-I--QA-VNVS----------------------
D3FZP5      NLANATAA------VFQREIANLL--R-V--DN-VVIL----------------------
C0ZHV9      LIANTIAK------TFQEEVVKML--S-M--NN-VHIL----------------------
D7WMM9      DIANTIAD------VFQEEIQVLM--T-V--DN-VNIL----------------------
A8U9F5      EIANAVAE------IFQSEIGNIM--N-V--EN-VTII----------------------
F4BSE0      EIANSVAT------TFQDGIGNIM--N-V--EN-VTII----------------------
E7RDR2      DIANTTAK------VFEGEIQNLM--N-V--DN-VSIL----------------------
I0JRK5      AIANTTVQ------VFKEDIPQLM--N-V--DN-VNVL----------------------
G2TR26      KIANKIGE------VFKKEVKNIM--K-V--DN-VTVI----------------------
D5DBK2      EIANTTAS------VFQKEVPKIM--N-I--DN-VSIL----------------------
D5DY80      DIANTTAS------VFQKEVPKIM--N-V--DN-VKVL----------------------
A7Z9K1      VMANAVAA------VFQDKITAIM--N-V--DN-VSIL----------------------
I2CB17      VMANAVAA------VFQDKITAIM--N-V--DN-VSIL----------------------
I2HW54      VMANAVAA------VFQDKITAIM--N-V--DN-VSIL----------------------
G4P1M8      HIANTIAS------VFKTKITSIM--N-V--DN-VSIL----------------------
E0TTZ7      HIANTIAS------VFKDKITSIM--N-V--DN-VSIL----------------------
G4EQF2      HIANTIAS------VFQDKITSIM--N-V--DN-VSIL----------------------
P96715      HIANTIAS------VFQDKITSIM--N-V--DN-VSIL----------------------
I0F9R7      HIANTIAS------VFQDKITSIM--N-V--DN-VSIL----------------------
G9QKR5      LIANKIAE------VFKQEIVKIM--N-V--DN-VSIL----------------------
B5UQ74      DIANTIAE------IFKSEVAKIM--S-V--DN-VTVL----------------------
B7HFH2      DIANATAE------VFQAEVAKIM--S-V--DN-VTVL----------------------
Q72XH7      DIANTTAE------VFKGEIAKIM--N-V--DN-VTVL----------------------
C2V4M3      DIANTTAE------VFKSEVAKIM--S-V--DN-VTVL----------------------
C2YZB3      DIANTTAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2P8H2      DIANTTAE------VFKGEVAKIM--S-V--DN-VTVL----------------------
C2Y451      DIANMTAE------VFKGEVAKIM--S-V--DN-VTVL----------------------
C3EBC1      DIANTTAE------VFKGEVAKIM--S-V--DN-VTVL----------------------
C3H980      DIANTTAE------VFQGEVAKIM--S-V--DN-VTVL----------------------
C2PN23      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
B9IRQ7      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
A0RL71      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2XJI0      DIANATAD------VFKGEVAKIM--N-V--DN-VTVI----------------------
Q3EV65      DIANATAD------VFKGEVAKIM--N-V--DN-VTVI----------------------
C2T8T7      DIANATAD------VFKDEVAKIM--N-V--DN-VTVL----------------------
C2RG50      DIANATAD------VFKDEVAKIM--N-V--DN-VTVL----------------------
Q814Y9      DIANATAD------VFKDEVAKIM--N-V--DN-VTVL----------------------
B3ZRD5      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
F0PU65      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
Q6HB08      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2NQN7      DVANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C3GRR1      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2ULR7      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C3GBJ9      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2WVG7      NIANATAD------VFKDEVAKIM--S-I--DN-VTVL----------------------
G9QCG2      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2QJY6      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2SSX9      DIANATAD------VFKGEVAKIM--N-I--DN-VTVL----------------------
B7IQS9      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
A9VRC4      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2MTG4      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
B7HXB5      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
C2SBU5      DIANATAD------VFKGEVAKIM--N-V--DN-VTVL----------------------
Q2BFS6      DIANTTAN------VFKREIVEIM--N-I--DN-VKIL----------------------
I3EBB4      KIANKTAE------VFKREIVKIM--N-V--DN-VSIL----------------------
A4ITF4      KIANKTAE------VFKNEIVKIM--N-I--DN-VTIL----------------------
C5D962      KIANKTAD------VFKNEIVKIM--N-I--DN-VTIL----------------------
G8MZ94      KIANKTAE------VFKNEIVKIM--N-I--DN-VTIL----------------------
Q5KUM4      KIANKTAE------VFKNEIVKIM--N-I--DN-VTIL----------------------
G5SDT9      MVKVTTFTRPE---TMSGQIFTLK--V-LGDKR-YQLV----------------------
G5LQM7      RVKVTTFTRPE---TMSGQIFTLK--V-LGDKR-YQLV----------------------
G5Q4J1      RVKVTTFTRPE---TMSGQIFTLK--V-LGDKR-YQLV----------------------
G2Z8Q4      LIANKVTT------VFKDNIKNIM--D-Q--QN-VSIL----------------------
D9ST43      RILNAVCN------AFMEEGERIY--S-G--QN-IKVI----------------------
H7F5T7      KIANITAK------EFVKTTPEIM--R-I--NN-VQLL----------------------
G9WIR0      DIANMTAD------VFKTKAVQVM--G-KSISN-VSIV----------------------
D3LB11      DIANETAS------VFKNEAVKLM--G-KTISN-VTVV----------------------
A0NKF7      DIANETAS------VFKNEAVKLM--G-KTISN-VTIV----------------------
Q04DV7      DIANETAS------VFKNEAVKLM--G-KTISN-VTIV----------------------
F6BI63      DIANAVAG------SFVDNIVKIM--K-V--DN-VSVI----------------------
G2MWC1      EMANAIAD------SFMENIVKIM--K-I--DN-VQVI----------------------
B0K4N2      EIANAIAD------SFVENIVKIM--N-I--DN-VQVI----------------------
C7ISF8      EIANAIAD------SFVENIVKIM--N-I--DN-VQVI----------------------
B0KAR6      EIANAIAD------SFVENIVKIM--N-I--DN-VQVI----------------------
E8UV30      EIANAIAD------SFVENIVKIM--N-I--DN-VQVI----------------------
C0GGR6      FLANSVAN------TFITKVGTIM--N-L--DN-VSII----------------------
A4J8V1      RLANFTAV------VFIRKVTEIM--K-V--DN-VNII----------------------
C8VYQ7      RLANISGQ------VFMKKVVEVM--K-L--DN-VNIV----------------------
C8W5K3      HLANITSR------VFVEIIVDIM--E-LNTNG-AKVI----------------------
B1BNH4      KLTEALTN------EFISESKELI--P-N--GN-VQVI----------------------
B1V1Z3      KLTEAITN------EFISESKELI--P-N--GN-VQVI----------------------
B1R3V2      KLTEALTN------EFISESKELI--P-N--GN-VQVI----------------------
Q0SVR9      KVTEAITD------EFISESKELI--P-N--GN-VQVI----------------------
Q8XN47      KVTEAITS------EFISESKELI--P-N--GN-IQVI----------------------
G7M0Q2      NILDSITN------QFIVESKQLI--P-N--GN-IKII----------------------
G7M565      DVVKTVTD------EFMRSSKELI--P-N--GN-VKTI----------------------
A6M2M0      DVVNSVTN------EFIRSSREFI--P-N--GN-VKVV----------------------
G7M1R8      EILQAISD------QFIKTATELI--P-N--GN-VKVV----------------------
A5V0I4      RLADAIGNNMVALVSARNNFLEGT--D-R--IS-MTVL----------------------
A7NQ70      RLADAIGNNMVALVSARNNFLEGT--D-R--IS-MTVL----------------------
Q4JZ56      RIANGIRK------VAALKIKEVT--Q-V--TD-VTTL----------------------
Q7X554      TLANKVRK------VASEKIKNVT--K-V--ED-VTTL----------------------
Q7X550      VLANKVRE------VASKKIKNVT--K-V--ED-VTTL----------------------
Q7X562      TLANKVRE------VALEKIKNVT--K-V--ED-VTTL----------------------
Q7X556      TLANKVRE------VASKKIKKVT--K-V--ED-VTTL----------------------
Q7X552      TLANKVRE------VASKKIKKVT--K-V--EN-VTTL----------------------
Q7X558      TLANKVRE------VASKKIKKVT--K-V--ED-VTTL----------------------
C5NWJ9      DLANTVKE------VSADQIKDVT--K-I--ED-VTTL----------------------
F3A498      DLANTVKS------VSADQIKDVT--K-I--DD-VTTL----------------------
Q9AHD3      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K2E2      RIANSLRK------IAAKKIISVT--R-V--SD-VTTL----------------------
Q4K2F8      RIANSLRK------IAAKKIISVT--R-V--SD-VTTL----------------------
Q4K046      RIANSLRE------VATEKIVAVT--R-V--SD-VTTL----------------------
Q4K0R8      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4JYY0      RIANSLRE------VAAEKIVTVT--R-V--SD-VTTL----------------------
Q4JZW8      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
I0J9C8      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4K0M4      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4JZS4      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4JZK2      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q9AHA5      RIANSLRE------VAVERIVAVT--R-V--SD-VTTL----------------------
Q9X9A0      RIANSLRE------VAVEKIVAVT--R-V--SD-VTTL----------------------
Q4JYK9      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4K006      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4JZG8      RIANFLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
A6YIA7      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
E5F5C4      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q9AHB8      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4JZL8      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4K1B8      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q8VU32      RIANSLRE------VAAGKIVAVT--R-V--SD-VTTL----------------------
D2ERX9      RIANSLRE------AAAEKIIAVT--R-V--SD-VTTL----------------------
G6C7Z0      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
Q4K2A9      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
D6ZQI7      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
Q9ZFT9      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
Q4K255      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
F9HJP7      RIANTLRE------VAAEKIIAVT--K-V--SD-VTTL----------------------
E8JWI4      RIANTLRE------VAAEKIIAVT--K-V--SD-VTTL----------------------
A8AZR4      RIANTLRE------VAAEKIIAVT--K-V--SD-VTTL----------------------
D0RXH3      RIANTLRE------VAAEKIIAVT--K-V--SD-VTTL----------------------
Q83YR6      RIANTLRE------VAAEKIIAVT--K-V--SD-VTTL----------------------
F1Z125      DLANSVRD------VASEKIKSVT--K-V--QD-VTPL----------------------
Q3K0S9      KLANSVRE------AAVSKIKAVT--Q-V--ED-ITTL----------------------
P0C0T8      KLANSVRE------AAVSKIKAVT--Q-V--ED-ITTL----------------------
Q67AY5      KLANSVRE------AAVSKIKAVT--Q-V--ED-ITTL----------------------
Q04662      KLANSVRE------AAVSKIKAVT--Q-V--ED-ITTL----------------------
Q8GP93      TLANKVRE------AASEKIKNVI--K-D--ED-VTTL----------------------
Q8GPF7      TLANKVRE------VASEKIKNVI--K-D--ED-VTTL----------------------
E3CP61      LLANKVRE------VASEKIKNVT--K-V--ED-VTTL----------------------
E8KUY7      LLANKVRE------VASEKIKNVT--K-V--ED-VTTL----------------------
C2LSE5      TLANKVRE------VASEKIKNVT--K-V--ED-VTTL----------------------
E9DM16      SLANKVRD------VAAEKIKKVT--K-V--ED-VTTL----------------------
I0QIK5      SLANKVRD------VAAEKIKKVT--K-V--ED-VTTL----------------------
Q7X560      TLANKVRE------VASEKIKKVT--K-V--ED-VTTL----------------------
Q8GMA6      TLANKVRE------VASKKIKKVT--K-V--ED-VTML----------------------
Q55204      TPANKVRE------VASEKIKKVT--K-V--ED-VTTL----------------------
Q8GPC4      TLANKVRE------VASEKIKKVT--K-V--ED-VTTL----------------------
Q8GPA9      TLANKVRE------VALEKIKNVT--K-V--ED-VTTL----------------------
G6ERT2      TLANKVRK------VASEKIKKVT--K-V--ED-VTTL----------------------
O87930      TLANKVRK------VASEKIKKVT--K-V--ED-VTTL----------------------
Q8GP55      VLANKVRE------VASKKIKNVT--K-V--DD-ITTL----------------------
F8HDC4      VLANKVRE------VASKKIKTVT--K-V--ED-VTTL----------------------
F8LJ76      VLANKVRE------VASKKIKTVT--K-V--ED-VTTL----------------------
F8LXJ5      VLANKVRE------VASKKIKNVT--K-V--DD-VTTL----------------------
Q1WCR2      VLANKVRE------VASKKIKNVT--K-V--DD-VTTL----------------------
G3G7C0      RIANSLRT------FAAQKIVEVT--K-V--SE-VTTL----------------------
G3G7J8      RIANSLRT------FAAQKIVEVT--K-V--SE-VTTL----------------------
G7SNU7      RIANSLRT------FAAQKVAEVT--K-G--SD-VTTL----------------------
G8DU30      RIANSLRT------FAAQKVAEVT--K-G--SD-VTTL----------------------
A4VTU2      RIANSLRT------FAVQKVVEVT--K-V--SD-VTTL----------------------
D5AGQ4      RIANSLRT------FAVQKVVEVT--K-V--SD-VTTL----------------------
Q9X4U6      RIANSLRT------FAVQKVVEVT--K-V--SD-VTTL----------------------
G3G7G5      RIANSLRT------FAAQKIVEVT--K-V--SD-VTTL----------------------
G7SG35      RIANSLRT------FAAQKIVEVT--K-V--SD-VTTL----------------------
G8DU06      RIANSLRT------FAAQKIVEVT--K-V--SD-VTTL----------------------
G8DUA9      RIANSLRT------FAAQKIVEVT--K-V--SD-VTTL----------------------
G8DTY9      RIANSLRT------FAAQKIVEVT--K-V--SD-VTTL----------------------
G3G7I7      RIANSLRT------FAAQKVVEVT--K-V--SD-VTTL----------------------
G3G7J3      RIANSLRT------FAAQKIVEVT--K-V--SD-VTTL----------------------
E0PD82      DIANAVRE------IAAEKIKAVT--K-V--DD-VTTL----------------------
F5X651      DIANAVRE------IAAEKIKAVT--K-V--DD-VTTL----------------------
G5JTD6      RLANAVRE------VAIQKIKDVT--R-V--DD-VTTA----------------------
Q2KM75      DLANAVRE------VASEKIKDVT--K-V--QD-VTAL----------------------
G5KAJ3      DLANSIRE------AASEKIKKVT--K-V--QD-VTPL----------------------
B9DUJ5      DLANSIRE------VASEKIKSVT--K-V--QD-VTPL----------------------
G5KD12      TLANSVRE------VASEKIKSVT--K-V--QD-VTPL----------------------
E8JMT8      DIANTIRE------VAAEKIKSVT--K-V--DD-VTTL----------------------
F5X0J8      DIANTIRE------VAAEKIKSVT--K-V--DD-VTTL----------------------
H2A601      DIANTIRE------VAAEKIKSVT--K-V--DD-VTTL----------------------
E7S8W2      RIANGLKD------VAAERIIAVT--K-V--SD-VTTL----------------------
F8DFF5      RIANGLRN------VAAEKITSVT--K-V--SD-VTTL----------------------
I1ZPH8      RIANGLRN------VAAEKITSVT--K-V--SD-VTTL----------------------
E3CBR9      RIANGLRN------VAAEKIISVT--K-V--SD-VTTL----------------------
E8K787      RIANGLRN------VAAEKIIAVT--K-V--SD-VTTL----------------------
F9M365      RIANGLRN------VAAAKIISVT--K-V--SD-VTTL----------------------
A3CQY3      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
E8KLZ0      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F0FHA9      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F0FQQ4      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F0I4H6      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F0IAY2      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F0IJI1      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F0IS52      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F2C9N1      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F2CH54      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F3UDW8      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F3UNJ5      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F3SM33      RIANAFRN------IAAEKIIEVT--K-V--SD-VTTL----------------------
F9HC66      RIANALRE------VAAEKIIKVT--R-V--SD-VTTL----------------------
E1LQJ6      RIANALRE------VAAEKIISVT--R-V--SD-VTTL----------------------
Q4JYU0      RIANALRE------VAAEKIISVT--R-V--SD-VTTL----------------------
Q4JZY2      RIANALRE------VAAEKIISVT--R-V--SD-VTTL----------------------
F9Q346      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
Q6L5R1      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
E9FEC6      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
E0Q2S9      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
F5VSH0      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
A5YTV6      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
Q6L5T1      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
E0PPH8      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
A5YTT8      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
E6KKR9      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
A1ILY0      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
F2QF91      RIANSLRE------VAAQKIISVT--R-V--SD-VTTL----------------------
Q4K0I3      RIANSIRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
Q8KWQ1      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q4K238      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
B1I966      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
G6J8A3      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
G6LKG4      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
F9LZC3      RIANSLRE------AAAEKIIAVT--R-V--SD-VTTL----------------------
F9P1W9      RIANSLRE------VAAEKIIAVT--R-V--SD-VTTL----------------------
A5LJR9      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
Q9ZII7      RIANSLRE------VAVEKIVAVT--R-V--SD-VTTL----------------------
Q4K1K7      RIANSLRE------VAAEKIVAVT--R-V--SD-VTTL----------------------
E1LPE6      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
F9MJW6      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K0V3      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q54519      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
C1CBD0      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q7WVX1      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K0E2      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q9AH96      RIANSLRK------VAAQKIISIT--R-V--SD-VTTL----------------------
A5M4L2      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
B2ILP4      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
C1CCB8      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
P72511      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K1S8      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
P96474      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K196      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K0Z7      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4JZ85      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4JYH6      RIANSLRE------VAGQKIISIT--R-V--SD-VTTL----------------------
Q4JZ19      RIANSLRE------VAAKKIISIT--R-V--SD-VTTL----------------------
Q4K0A1      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K1M5      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K2Q8      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K1G0      RIANSLRE------VAAKKIISIT--R-V--SD-VTTL----------------------
Q4K0T6      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K0K3      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
Q4K0X6      RIANSLRE------VAAQKIISIT--R-V--SD-VTTL----------------------
E8KDN1      RIANGLRE------VAAQKIISVT--K-V--SD-VTTL----------------------
F9PEU3      RIANALRE------VAAQKIISVT--R-V--SD-VTTL----------------------
E8K321      RIANALRE------VAAQKIISVT--R-V--SD-VTTL----------------------
F9PZP6      RIANALRE------VAAQKIISVT--R-V--SD-VTTL----------------------
D6R2T7      RIANSLRN------VAAEKIIEVT--K-V--PD-VTTL----------------------
F3UUQ1      RIANSLRN------VAAEKIIEVT--K-V--PD-VTTL----------------------
E6IZC3      RIANSLRQ------VAAEKIIAVT--K-V--AD-VTTL----------------------
G6A746      RVANSLRQ------VAAEKIIAVT--K-V--AD-VTTL----------------------
B1V0N8      QIIKVMTD------GFESTVGEYI--V-N--SN-IEIL----------------------
B1BNK2      QIIKVMTD------EFESTVGEYI--V-N--SN-IEIL----------------------
B1R3X7      QIIKVMTD------EFESTVGEYI--V-N--SN-IEIL----------------------
Q8XN77      QIIKVMTD------EFESIVGEYI--V-N--SN-IEIL----------------------
A3ICA4      KIANTIAE------IFKEEIPVLM--H-V--DN-INIL----------------------
B1HR40      KIANTIAE------IFKEEIPILM--H-V--DN-INIL----------------------
H1BJT0      NIVKETIA------VFTQEMMKIS--E-I--DN-ITVI----------------------
F8FCE3      ETVNAISY------TFQKEIENVM--K-V--SN-ITTL----------------------
I0BSG5      ETVNAISY------TFQKEIENVM--K-V--SN-ITTL----------------------
A8YPQ6      KIANSFAK------VTSKQIPKIM--S-V--DN-VSIL----------------------
P95695      KIANSFAK------VTSKQIPKIM--S-V--DN-VSIL----------------------
Q2G1K8      KIANSFAK------VTSKQIPKIM--S-V--DN-VSIL----------------------
C5QNG5      KIANDVAK------VFSKDVPDIM--S-V--DN-VSIL----------------------
Q4L9H8      KIANEIAK------VVSDEMPKIM--S-V--DN-VTIL----------------------
Q2FUV1      KIVNKISK------VFAHDMPKIM--S-V--DN-VTIL----------------------
P39850      KIANKIAE------VFSDEVPDIM--N-V--DN-VSVL----------------------
D7UYE3      KVANEVAK------VFSKDIKKIM--N-V--DN-VSIL----------------------
Q4A121      KVANEIAN------VFSKDVNKIM--N-V--DN-VSIL----------------------
E3HB17      LMVNEVSK------EFMLKIRDLM--N-F--EN-LKIV----------------------
C9AAE4      EIANTTAS------VFSEEIPKIM--N-I--DN-VTIL----------------------
H7F6C7      RIANATAR------TFTEEIPNIM--K-I--DN-VTTL----------------------
F0SX23      QIANTIAG------IVPNYIGEIV--Q-G--SS-VKVV----------------------
Q38VG4      DIANMTAT------TFQKKVPKIM--SGT--DN-VSII----------------------
F2I4B6      TIANTTAE------VFQKAIRKMM--N-I--DN-VSII----------------------
Q8RBS6      EIANAIAS------SFMDNIVKIM--K-I--DN-VQVI----------------------
D9SR42      KITNQWAA------SLKEISKKIK--G-S--DN-VQIL----------------------
D9SVC8      LIANQWAL------SLKEISKEIQ--G-T--DN-VKIL----------------------
E7RG09      GIANKVAE------VFETEIMELM--N-I--DN-VSIL----------------------
D4G2E2      HIANTIAS------VFQDKITSIM--N-V--DN-VSIL----------------------
Q8EME7      DIANTTVQ------VFQDEIPDIM--N-V--DN-VSVL----------------------
D6Y035      SKANATAE------VFRNEIETLL--N-I--DN-IHIL----------------------
Q5WBB3      LLTNSIAT------VFQEQIPDIM--S-I--DN-VSIL----------------------
Q9K6Q9      AIANEIAL------VFQNEIVEIM--N-V--DN-VSIL----------------------
Q97EP7      DLANDFSD------SFVAVSKEVY--T-A--GD-ARII----------------------
Q97ER4      DLANDFSD------SFVEVSKAVY--T-A--GD-ARII----------------------
E4S7Y7      LIANKLAE------VFIEAVQKIM--K-I--EN-VQIV----------------------
E4Q5T6      TVANKLAE------VFIEAVQRIM--K-I--EN-VQIV----------------------
E4SDX3      TIANKLAE------VFIEAVQRIM--K-I--EN-VQIV----------------------
G2FWX3      SIANEVAQ------EFSKAVIEIK--K-V--DS-VSIV----------------------
G7WJV2      AIANTMAQ------EFSKAVIDIK--K-V--DS-VSVV----------------------
G7W774      AIANTMAS------EFSKAVIEIK--K-V--DS-VSIV----------------------
G2FM60      LIANTMAQ------EFTKAVIEIK--K-V--DS-VSIV----------------------
H5XZD5      SIANTMAQ------EFSKAVIEIK--K-V--DS-VSIV----------------------
I4DBG9      SIANTMAK------EFSKAVIEIK--K-V--DS-VSIV----------------------
G2FWT7      SIANTMAQ------EFSKAVIEIK--K-V--DS-VSIV----------------------
H5XZG8      DIANSMAN------EFSKAVIEIK--K-V--DS-VSIV----------------------
G0V448      ITANTLSQ------IFLEESMRIY--P-T--GS-IQII----------------------
A0PZ01      KIAETLTP------IFIQKSKITI--P-N--GN-VQIL----------------------
B1B737      KIAETLTP------IFIQKSKITI--P-N--GN-VQIL----------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
B7B948      IESY------------KREHQLTDISSETGMY----------------------------
G8AU95      IRSF------------RKENSLLELPPDGRNM----------------------------
G5IFS2      GGMA------------GLFLAAV-IVLAVFVM----------------------------
F0G6H6      FNAY------------RASH-------GSVNT----------------------------
F6CNF6      LKKF------------Q-----A-QPRGVAVL----------------------------
A3W0H6      IADF------------KRANAES-LPTSITPV----------------------------
A3K8W6      IADY------------KKANSAQ-LPAGVAAL----------------------------
Q0FMP1      IATF------------KRENAEA-LPSGTGAL----------------------------
S9QRP2      LADF------------KRANAEA-LPGGITSL----------------------------
D0D9W1      IAGF------------KQDNAAA-LPNGLTAL----------------------------
I1AYC4      VARF------------KQDNGDA-LPAGLGSL----------------------------
E9TE87      LNAF------------RQDKDSVDLPLEAKAV-LDSM-----VNIDAQLNELTFK-----
E6PYQ4      LMTSGLKLGIIDIGSGSSSTSGT-SSIGTSTL-VVET-SGLLDQRVKAQADLYLAEAEYQ
C0QCJ1      LSSY------------RAKNMGG-LPDELDSN-LRTL-DRLQLQLTDKQAMLRDAKNAIN
I5B297      LAAF------------RAKYLGG-LPDELESN-LRTL-DRMQKQVTDKAMLLREVNNSIS
B8D0N1      VRHY------------KEENKSL-VLSNFTQK-IMQSMLDLEENLAEVEINIKTHRAALN
D9QTC7      LLEY------------KKEHDVI-LPEKQGED-LLEKLTKLETAKSKAEVELKQAEAGLK
C7LPS4      INQY------------RAEHGLQ-LATDETTI-RFEI-----ADAERKLEAIRARKLELE
Q314L4      IDSF------------KASRGQI-LNMSEPAL-RREI-----QMAQEELQALRIRKTDLL
G0VNK5      LQQY------------QAANKMY-STDDQMKQ-LTDKLNIVDKAKAENQLNLETAQAGLN
D2RIR1      LKNY------------QVKHKIF-STDNQMKS-LAERITDLDKAKAQNKLDMETAQAALG
I0GRR3      LQKF------------QVENKLF-STQDQIKQ-ITDKLSIIDKEKAANKLNLEQAQAALG
Q39U16      IVAF------------RQKRGVS-VGIDEALL-VNDI-----RQYQGELDSMRIKRNELT
F0JCB9      IEDY------------KVASGKV-LTTNEYAV-RREI-----EKGEDQIKDIDIRISTLE
G7QCG0      INAF------------RSERGML-LSSDGAFI-RSEI-----KAAEQKLEELSLRRAQLE
I2Q342      INAF------------RSERGMI-LSSDGAFI-RSEI-----KAAEQKLEELSLRRAQLE
Q74BQ7      LNRY------------KTEKGGV-IAIDEAKL-FEEI-----NVAQQKLYDIQLRRRHLE
B5EA80      VNAY------------KRDKGGV-IAIDEGKL-FQEI-----NVAQQKLYDLELRRHQLE
C6DZX6      VNAY------------KRDKGGI-IAIDEGKL-FEEI-----NIAQQKLYDLELRRRQLE
A1ARV9      LNDY------------KRDKGGV-IAVDEAKL-FEEI-----NVSQQKLYDLELRRRQLE
E8WSZ4      VNAY------------KRSKGGV-ISIDEGKL-FEEI-----NTAQQKLYDLELRRRQLE
A5G425      VNNF------------KIGKMGV-IATDPATL-QKEI-----NDAQQKIDDMRLKRAQLE
B9M2X7      VSRF------------RMEKGSV-ATADPAAL-EREI-----SGAQQRIDEIAFRKAQLE
C2MBF7      KVQK------------ENFHSIVDSYMRSLQVSLQQKDASVIKLTMQSSNPQLAEDFLST
H8YYB8      LAQF------------KEEHGQSLPELKSLNMQLIQRSEDQLRDTEQSIRTLVERKIYLE
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G7SNU7      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
G6LKG4      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
A3ICA4      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
H1BJT0      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
E3HB17      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      -----------------------------------------------DAQIKQLEDE---
B7B948      ------------------------------------------------------------
G8AU95      ----------------------------------------------VQQQMNELATQ---
G5IFS2      -----------------------------------------------NDTIKTPEDV---
F0G6H6      -----------------------------------------------SDEALALRQQ---
F6CNF6      -----------------------------------------------EQEFKKKSEDLAG
A3W0H6      -----------------------------------------------REELRTLNET---
A3K8W6      -----------------------------------------------RTELTTLRET---
Q0FMP1      -----------------------------------------------RSQLTTLEDS---
S9QRP2      -----------------------------------------------RSQLVTLEEN---
D0D9W1      -----------------------------------------------REQLTTLQDN---
I1AYC4      -----------------------------------------------RDQLTTLRDN---
E9TE87      -----------------------------------------------EAEISKLYTK---
E6PYQ4      NLLVHPDAVPPIDVPGSLEMSS-----LVTSLSTA------------NGQLASIEQR---
C0QCJ1      TLSAQIAQASKMGSQGMDDQ----FDFSDFGEEVGMGGEDEATLAEAEKRLDAMLLR---
I5B297      QLDSQISSMAATGGSGSGGDDFLSFDFDDSQE------GDDSALQAAQEKYDALLLR---
B8D0N1      HLYNKLQSSRELILSSKTLSKNPAYTELKNRLTEL------------EIELDSLTTV---
D9QTC7      EVRANYNDQDKDIISARTIAQNPMVQKYKEQLSNL------------EVELTGLKES---
C7LPS4      TKLQLMPS------GGG----------RSAHLADM------------ERQLATLLTA---
Q314L4      AQRGVMLR------N-----TP-----LRNRLETL------------EAQLAAMLVS---
G0VNK5      SVNEQLSS------AGVSIADSPAIQQYKTQLAQL------------EATKASYVGK---
D2RIR1      SINDQLAG------AGAALADSPSIQQAKNKLVDL------------ETQKAGYTGK---
I0GRR3      TINGQLDN------SGRGIADSAALQQYKVQLAQL------------AAEKAGYTGI---
Q39U16      ATRDALRR------QL----KS-----IKPTTVALSSRENSSEVEMLERRLKQLSAN---
F0JCB9      SSRTMLLS------N-----SP-----SRSRLRQQ------------EQLLDDMLAR---
G7QCG0      AQRKMLAS------GK----GP-----AKASRASSGGNPR-------EAELRRLLAV---
I2Q342      AQRKMLVS------GKGPARGP-----AKAGRASSGGNPR-------EAELRRLLAL---
Q74BQ7      GLRPVTRK------AG----DP-----LQVKLVAL------------QKQLEELRVS---
B5EA80      GMRQITRR------TG----DP-----LQSRLAGL------------QKRLDELLVE---
C6DZX6      GMRQITKR------TG----DP-----LQNRLAGL------------QKRLDELLVE---
A1ARV9      GMRRVTRK------SG----DP-----LQARLSAL------------QRRLDELRVQ---
E8WSZ4      GMRLVTRK------AN----DP-----LQAKLASL------------QKRLDDLRVQ---
A5G425      SLRIQIKK-------N----NP-----LQQKMLSL------------QKKLDEMLVE---
B9M2X7      ASRNQLKK-------H----NP-----AQMRLQTL------------EKKLEEMRVE---
C2MBF7      LILV----YTELEREDKVKVAESTQRFVDDRLAII------------SSELGQVDAE---
H8YYB8      GQLAQIDPYSELFSADGRRVLGPA-----DRLKAL------------EAEYATVAAR---
E7T802      -----------------------------------------------GRGWARLTKE---
F4SM98      -----------------------------------------------GRGWARLIGH---
C4Z673      -----------------------------------------------DQANL---PD---
E3H7M4      -----------------------------------------------ESSRV---PV---
C2EWM2      -----------------------------------------------SRANT---PK---
D0DSJ3      -----------------------------------------------SEATT---PT---
B2GF32      -----------------------------------------------SEATT---PT---
C0WW25      -----------------------------------------------SEATT---PT---
F8KGP2      -----------------------------------------------SRAST---PD---
B3XL22      -----------------------------------------------SRAST---PD---
F8DRU3      -----------------------------------------------SRAST---PD---
B1MZT2      -----------------------------------------------DSAKI---DN---
H1WR07      -----------------------------------------------DSAKI---DN---
Q03W94      -----------------------------------------------DAAKA---NK---
C2KHF2      -----------------------------------------------DSAKA---NK---
H1X4N3      -----------------------------------------------DSAKA---NK---
C2JZS0      -----------------------------------------------SDALA---NP---
C1J9I2      -----------------------------------------------SRATA---NT---
Q58Z11      -----------------------------------------------SRATA---DP---
F0K0J8      -----------------------------------------------AEAS----KG---
G6F8H0      -----------------------------------------------AEAA----KG---
Q1G8E3      -----------------------------------------------AEAS----KG---
D8FLF7      -----------------------------------------------AEAP----KG---
F0HVF2      -----------------------------------------------AEAP----KG---
Q5FIC6      -----------------------------------------------ANGT----NG---
E4SMV6      -----------------------------------------------ANGT----NG---
F0TGY3      -----------------------------------------------ANGT----NG---
F2M2M7      -----------------------------------------------ANGT----NG---
C4VP07      -----------------------------------------------ADAN----KG---
D6S4X3      -----------------------------------------------ADAN----NG---
A4ZGZ7      -----------------------------------------------APAT----NG---
C2EPK4      -----------------------------------------------ARGT----MG---
C7XKF2      -----------------------------------------------APAT----DG---
E3R265      -----------------------------------------------APAT----DG---
D0DJG9      -----------------------------------------------APAT----NG---
D5GZJ9      -----------------------------------------------APAT----NG---
A8YX90      -----------------------------------------------APAT----NG---
F0NWJ8      -----------------------------------------------APAT----NG---
C6CW36      -----------------------------------------------NEAKV-KDTR---
A8SQS9      -----------------------------------------------QVARV---AD---
D5HFS3      -----------------------------------------------QVARV---AD---
A5Z5P8      -----------------------------------------------ERAIT---PK---
G2KUP2      -----------------------------------------------SKATP---VL---
G8PE07      -----------------------------------------------SKAQA---DD---
E0NHP5      -----------------------------------------------SKAAP---DD---
Q03GL9      -----------------------------------------------SKATA---DD---
C6CSC7      -----------------------------------------------NEALL---DD---
C6CS79      -----------------------------------------------HTADS---ND---
F5LM70      -----------------------------------------------HEADP---AK---
G0LYN8      -----------------------------------------------APAET---PN---
F6ITB3      -----------------------------------------------APAET---PK---
G0M1Y0      -----------------------------------------------APAET---PK---
D7VC12      -----------------------------------------------APAET---PS---
F9UMZ5      -----------------------------------------------APAET---PN---
D4JI68      -----------------------------------------------QSGYD---DG---
D6E329      -----------------------------------------------QSGYD---DG---
Q1AUN7      -----------------------------------------------EEAVA---PE---
H4GK02      -----------------------------------------------SSATT---PK---
F6IR92      -----------------------------------------------APAET---PD---
G0M0G0      -----------------------------------------------APAET---PD---
D7VBW5      -----------------------------------------------APAET---PD---
F9UQ55      -----------------------------------------------APAET---PD---
B9Y883      -----------------------------------------------NSAKI---PE---
D4YHG8      -----------------------------------------------TPAEP---GQ---
F7V793      -----------------------------------------------DEAVT---PD---
C3WFM8      -----------------------------------------------EKAQV---PV---
H7F1R6      -----------------------------------------------SPAFY-DSAM---
H7F570      -----------------------------------------------SKATF-SDNM---
C6LCS6      -----------------------------------------------EEANL---PE---
A7VF43      -----------------------------------------------QVARI---PD---
A7Z922      -----------------------------------------------SEAKA--SES---
I2CAF3      -----------------------------------------------SEAKA--SES---
I2HVL3      -----------------------------------------------SEAKA--SES---
E0U2Z4      -----------------------------------------------SEAKA--SES---
D4G1R3      -----------------------------------------------SEAKA--SES---
G4EQZ6      -----------------------------------------------SEAKA--SES---
P71050      -----------------------------------------------SEAKA--SES---
G4P115      -----------------------------------------------SEAKA--SES---
A8FHM0      -----------------------------------------------SEAKL--SNT---
C0EBA5      -----------------------------------------------ESARP--SGS---
F4FXQ8      -----------------------------------------------SEATP---VK---
C0WV34      -----------------------------------------------SEATP---VK---
H1LCW2      -----------------------------------------------SEATP---VK---
B7BDT7      -----------------------------------------------NDSAI-QDAP---
H6LKR9      -----------------------------------------------DQSTL---PV---
F5LE49      -----------------------------------------------NEAKT-TDNV---
F3AHH1      -----------------------------------------------DEANI---PD---
F3Y921      -----------------------------------------------SPAFA---DM---
G4L593      -----------------------------------------------SRASA---SA---
E6LD65      -----------------------------------------------SSAVA---ES---
C9ALZ8      -----------------------------------------------SGAVA---NT---
C9BUG6      -----------------------------------------------SGAVA---NT---
Q3XYS7      -----------------------------------------------SGAVA---NT---
C9B453      -----------------------------------------------SGAVA---NT---
D4RJF5      -----------------------------------------------SGAVA---NT---
F0EKB8      -----------------------------------------------SIAVA---ST---
C9A6V4      -----------------------------------------------SSAVA---ST---
C9CHY7      -----------------------------------------------SSAVA---ST---
C8ZXT8      -----------------------------------------------SSAVA---ST---
G5IRQ5      -----------------------------------------------SSAVA---ST---
E6UHY5      -----------------------------------------------SPPKV---PT---
E9SAU2      -----------------------------------------------SPPRV---PT---
F7K0U2      -----------------------------------------------EEGNL---PK---
O06029      -----------------------------------------------SKAKA---QT---
G8P3D6      -----------------------------------------------SKAKA---QT---
A9QSJ3      -----------------------------------------------SKAKA---QT---
F9VC43      -----------------------------------------------SKAKA---QT---
G6FD41      -----------------------------------------------SKAKA---QT---
G9M881      -----------------------------------------------SKAKA---QT---
Q3ZK51      -----------------------------------------------SKAKA---QT---
Q83VG0      -----------------------------------------------SKAKA---QT---
C6LDI9      -----------------------------------------------QNGYV---SQ---
G5F9H3      -----------------------------------------------EDGEV---AS---
C0CZV8      -----------------------------------------------EDGEV---PL---
G5GFW1      -----------------------------------------------EDGEV---PI---
I5AV00      -----------------------------------------------DEASI---PM---
H6NE44      -----------------------------------------------GVANP-EKPA---
F4BS20      -----------------------------------------------SKAKV---NA---
E0RZL4      -----------------------------------------------ETANV---PT---
C0CK72      -----------------------------------------------EEAVA---DN---
D9S1J8      -----------------------------------------------DEAIP---IY---
C2EFR7      -----------------------------------------------DKANY---PQ---
Q1WTC7      -----------------------------------------------DKANY---PQ---
B0P2G1      -----------------------------------------------EKAYK---AD---
D4MW28      -----------------------------------------------EKAYK---AD---
E5VMX9      -----------------------------------------------EKAYK---AD---
F2I6Z8      -----------------------------------------------SPASY---NE---
E6U7N3      -----------------------------------------------SDAKL---EL---
C4Z8M6      -----------------------------------------------QSGYD---DG---
D4JMC3      -----------------------------------------------QTAYA---SK---
D6E0V3      -----------------------------------------------QTAYA---SK---
E3GPC7      -----------------------------------------------DAAEV---NS---
A6BIG6      -----------------------------------------------EEANL---PM---
C2CI43      -----------------------------------------------DGATL---PE---
D4RX68      -----------------------------------------------DSADL---PT---
D4J4T5      -----------------------------------------------EEAAV---PD---
I5ASF9      -----------------------------------------------EVGEV---PI---
C0C0F9      -----------------------------------------------EEGNL---PT---
B6W7H3      -----------------------------------------------DKANL---PE---
C7RGH5      -----------------------------------------------DGAIL---PE---
F0GT82      -----------------------------------------------DGATI---PV---
F3AH93      -----------------------------------------------EKGEI---PT---
B0GAL4      -----------------------------------------------EKGEV---PT---
G1WUK1      -----------------------------------------------EKGEV---PT---
D4M2S1      -----------------------------------------------EEGEV---PT---
E7GL80      -----------------------------------------------EDGMV---AT---
G5F9E3      -----------------------------------------------EDGMV---AT---
D4CG07      -----------------------------------------------EEGEA---AV---
D4MP31      -----------------------------------------------EEGEA---AV---
G5HNC6      -----------------------------------------------EGGVV---PD---
A8RK86      -----------------------------------------------EQGVV---PA---
G5HTB1      -----------------------------------------------ENGVV---PS---
A8RSL0      -----------------------------------------------EEGEV---PI---
C5EN02      -----------------------------------------------EEGEI---PI---
G5HG46      -----------------------------------------------EEGEV---PV---
E7GL39      -----------------------------------------------EDGEV---AS---
E7GL56      -----------------------------------------------EDGVV---AS---
G5F9B0      -----------------------------------------------EDGVV---AS---
D3AC81      -----------------------------------------------EEAYL---PT---
D3AE79      -----------------------------------------------ETGNL---PT---
D4YF14      -----------------------------------------------SSATF---NP---
B1YMM6      -----------------------------------------------SVSGI---PT---
D4LG05      -----------------------------------------------QHAKL-PEHK---
D4LTH3      -----------------------------------------------QHAKL-PEYK---
F3ATF6      -----------------------------------------------EEAEV---PS---
E0I7B6      -----------------------------------------------NEANVSATNP---
C9LAS2      -----------------------------------------------DEGQL-PTHK---
F7K8E8      -----------------------------------------------ETANM-PMEK---
F7K9V0      -----------------------------------------------ETANM-PMKK---
F7KL97      -----------------------------------------------ETANM-PMDK---
D3FZP5      -----------------------------------------------APAEL-SSNP---
C0ZHV9      -----------------------------------------------AEARN-NPAA---
D7WMM9      -----------------------------------------------SVAQL-DKEP---
A8U9F5      -----------------------------------------------SEAVP-VTDQ---
F4BSE0      -----------------------------------------------SEAVP-NTNQ---
E7RDR2      -----------------------------------------------SPAVL-KDNP---
I0JRK5      -----------------------------------------------SEAAV-GSTP---
G2TR26      -----------------------------------------------SKAQV-PG-----
D5DBK2      -----------------------------------------------SKADL-ATSK---
D5DY80      -----------------------------------------------SKATV-GESS---
A7Z9K1      -----------------------------------------------SKAEA-ADSQ---
I2CB17      -----------------------------------------------SKAEA-ADSQ---
I2HW54      -----------------------------------------------SKAEA-ADSQ---
G4P1M8      -----------------------------------------------SKAEV-SDHP---
E0TTZ7      -----------------------------------------------SKAEV-SEHP---
G4EQF2      -----------------------------------------------SKAEV-SEHP---
P96715      -----------------------------------------------SKAEV-SEHP---
I0F9R7      -----------------------------------------------SKAEV-SEHP---
G9QKR5      -----------------------------------------------SKADL-GKDM---
B5UQ74      -----------------------------------------------SKAEI-MENQ---
B7HFH2      -----------------------------------------------SKAEV-VENQ---
Q72XH7      -----------------------------------------------SKAEV-AENQ---
C2V4M3      -----------------------------------------------SKAEV-AENL---
C2YZB3      -----------------------------------------------SKAEI-AENQ---
C2P8H2      -----------------------------------------------SKAEL-SEEL---
C2Y451      -----------------------------------------------SKAEL-PEEL---
C3EBC1      -----------------------------------------------SKAEV-AENQ---
C3H980      -----------------------------------------------SKAEV-AENL---
C2PN23      -----------------------------------------------SKAEV-AENQ---
B9IRQ7      -----------------------------------------------SKAEV-TENQ---
A0RL71      -----------------------------------------------SKAEV-AENQ---
C2XJI0      -----------------------------------------------SKAEV-AENQ---
Q3EV65      -----------------------------------------------SKAEV-AENQ---
C2T8T7      -----------------------------------------------SKAEV-AENQ---
C2RG50      -----------------------------------------------SKAEV-AENQ---
Q814Y9      -----------------------------------------------SKAEV-AENQ---
B3ZRD5      -----------------------------------------------SKAEV-GENQ---
F0PU65      -----------------------------------------------SKAEV-AENQ---
Q6HB08      -----------------------------------------------SKAEV-AENQ---
C2NQN7      -----------------------------------------------SKAEV-AENQ---
C3GRR1      -----------------------------------------------SKAEV-AENQ---
C2ULR7      -----------------------------------------------SKAEV-VENQ---
C3GBJ9      -----------------------------------------------SKAEV-AENQ---
C2WVG7      -----------------------------------------------SKAEV-VENQ---
G9QCG2      -----------------------------------------------SKAEV-AENQ---
C2QJY6      -----------------------------------------------SKAEV-AENQ---
C2SSX9      -----------------------------------------------SKAEV-AENQ---
B7IQS9      -----------------------------------------------SKAEV-AENL---
A9VRC4      -----------------------------------------------SKAEV-AENQ---
C2MTG4      -----------------------------------------------SKAEV-AENQ---
B7HXB5      -----------------------------------------------SKAEV-AENQ---
C2SBU5      -----------------------------------------------SKAEV-AENQ---
Q2BFS6      -----------------------------------------------AKAEL-TDNP---
I3EBB4      -----------------------------------------------AKATV-TDNQ---
A4ITF4      -----------------------------------------------SKAEV-KEDQ---
C5D962      -----------------------------------------------SKAEV-KENQ---
G8MZ94      -----------------------------------------------SKAEV-KEHQ---
Q5KUM4      -----------------------------------------------SKAEV-KEHQ---
G5SDT9      -----------------------------------------------SDGGF-SAQ----
G5LQM7      -----------------------------------------------SDGGF-SAQ----
G5Q4J1      -----------------------------------------------SDGGF-SAQ----
G2Z8Q4      -----------------------------------------------SEAKA-DDNN---
D9ST43      -----------------------------------------------DGA---KIPE---
H7F5T7      -----------------------------------------------NEAYV-KTND---
G9WIR0      -----------------------------------------------SRG---LRQD---
D3LB11      -----------------------------------------------SSG---LKDN---
A0NKF7      -----------------------------------------------SSG---LKNN---
Q04DV7      -----------------------------------------------SSG---LKNN---
F6BI63      -----------------------------------------------DEA---IPPT---
G2MWC1      -----------------------------------------------DKA---IPPT---
B0K4N2      -----------------------------------------------DKA---IPPT---
C7ISF8      -----------------------------------------------DKA---IPPT---
B0KAR6      -----------------------------------------------DKA---IPPT---
E8UV30      -----------------------------------------------DKA---IPPT---
C0GGR6      -----------------------------------------------DEA---EPST---
A4J8V1      -----------------------------------------------DHA---VVPT---
C8VYQ7      -----------------------------------------------DPA---VPAP---
C8W5K3      -----------------------------------------------DIA---IPSN---
B1BNH4      -----------------------------------------------QKP---QLPE---
B1V1Z3      -----------------------------------------------QKP---QLPE---
B1R3V2      -----------------------------------------------QKP---QLPE---
Q0SVR9      -----------------------------------------------QKP---QLPE---
Q8XN47      -----------------------------------------------QKA---QLPE---
G7M0Q2      -----------------------------------------------ESV---KIPE---
G7M565      -----------------------------------------------ESV---KVTD---
A6M2M0      -----------------------------------------------ESV---KVPQ---
G7M1R8      -----------------------------------------------EQV---KLPE---
A5V0I4      -----------------------------------------------EPA---TPPV---
A7NQ70      -----------------------------------------------EPA---TPPV---
Q4JZ56      -----------------------------------------------QTA---RPPQ---
Q7X554      -----------------------------------------------EEE---QIPE---
Q7X550      -----------------------------------------------GEA---KLPE---
Q7X562      -----------------------------------------------EEA---KLPV---
Q7X556      -----------------------------------------------EEA---KLPV---
Q7X552      -----------------------------------------------EEA---KLPE---
Q7X558      -----------------------------------------------DEA---KLPE---
C5NWJ9      -----------------------------------------------EEA---KAAT---
F3A498      -----------------------------------------------EEA---KAAT---
Q9AHD3      -----------------------------------------------EEA---RPAI---
Q4K2E2      -----------------------------------------------EEA---RPAT---
Q4K2F8      -----------------------------------------------EEA---RPAT---
Q4K046      -----------------------------------------------EEA---RPAT---
Q4K0R8      -----------------------------------------------EEA---RPAT---
Q4JYY0      -----------------------------------------------EEA---RPAT---
Q4JZW8      -----------------------------------------------EEA---RPVT---
I0J9C8      -----------------------------------------------EEA---RPAT---
Q4K0M4      -----------------------------------------------EEA---RPAT---
Q4JZS4      -----------------------------------------------EEA---RPAT---
Q4JZK2      -----------------------------------------------EEA---RPAT---
Q9AHA5      -----------------------------------------------EEA---RPAT---
Q9X9A0      -----------------------------------------------EEA---RPAT---
Q4JYK9      -----------------------------------------------EEA---RPAT---
Q4K006      -----------------------------------------------EEA---RPAT---
Q4JZG8      -----------------------------------------------EEA---RPAT---
A6YIA7      -----------------------------------------------EEA---RPAT---
E5F5C4      -----------------------------------------------EEA---RPAT---
Q9AHB8      -----------------------------------------------EEA---RPAT---
Q4JZL8      -----------------------------------------------EEA---RPAT---
Q4K1B8      -----------------------------------------------EEA---RPAT---
Q8VU32      -----------------------------------------------EEA---RPAT---
D2ERX9      -----------------------------------------------EEA---RPAT---
G6C7Z0      -----------------------------------------------EEA---RPAT---
Q4K2A9      -----------------------------------------------EEA---RPAT---
D6ZQI7      -----------------------------------------------EEA---RPAM---
Q9ZFT9      -----------------------------------------------EEA---RPAM---
Q4K255      -----------------------------------------------EEA---RPAT---
F9HJP7      -----------------------------------------------EEA---EAPK---
E8JWI4      -----------------------------------------------EEA---ETPK---
A8AZR4      -----------------------------------------------EEA---EVPK---
D0RXH3      -----------------------------------------------EEA---EVPK---
Q83YR6      -----------------------------------------------EEA---EVPK---
F1Z125      -----------------------------------------------EKA---VMPT---
Q3K0S9      -----------------------------------------------EKG---NLPK---
P0C0T8      -----------------------------------------------EKG---NLPK---
Q67AY5      -----------------------------------------------EKG---NLPK---
Q04662      -----------------------------------------------EKG---NLPK---
Q8GP93      -----------------------------------------------EEA---KLPE---
Q8GPF7      -----------------------------------------------EEA---KLPE---
E3CP61      -----------------------------------------------EDA---KLPE---
E8KUY7      -----------------------------------------------EDA---KLPE---
C2LSE5      -----------------------------------------------EEA---KLPE---
E9DM16      -----------------------------------------------EDA---KLPD---
I0QIK5      -----------------------------------------------EDA---KLPD---
Q7X560      -----------------------------------------------EEA---KLPE---
Q8GMA6      -----------------------------------------------EEA---KLPE---
Q55204      -----------------------------------------------EEA---KLPE---
Q8GPC4      -----------------------------------------------EEA---KLPE---
Q8GPA9      -----------------------------------------------EEA---KLPE---
G6ERT2      -----------------------------------------------EEA---KLPE---
O87930      -----------------------------------------------EEA---KLPE---
Q8GP55      -----------------------------------------------GEA---KLPS---
F8HDC4      -----------------------------------------------EEA---KLPS---
F8LJ76      -----------------------------------------------EEA---KLPS---
F8LXJ5      -----------------------------------------------GEA---KLPS---
Q1WCR2      -----------------------------------------------GEA---KLPS---
G3G7C0      -----------------------------------------------EEA---VPAE---
G3G7J8      -----------------------------------------------EEA---VPAE---
G7SNU7      -----------------------------------------------EEA---VPAE---
G8DU30      -----------------------------------------------EEA---VPAE---
A4VTU2      -----------------------------------------------EEA---VPAE---
D5AGQ4      -----------------------------------------------EEA---VPAE---
Q9X4U6      -----------------------------------------------EEA---VPAE---
G3G7G5      -----------------------------------------------EEA---VPAE---
G7SG35      -----------------------------------------------EEA---VPAE---
G8DU06      -----------------------------------------------EEA---VPAE---
G8DUA9      -----------------------------------------------EEA---VPAE---
G8DTY9      -----------------------------------------------EEA---VPAE---
G3G7I7      -----------------------------------------------EEA---VPAE---
G3G7J3      -----------------------------------------------EEA---VPAE---
E0PD82      -----------------------------------------------EAA---ATPK---
F5X651      -----------------------------------------------EAA---ATPK---
G5JTD6      -----------------------------------------------ETA---KVPT---
Q2KM75      -----------------------------------------------EKA---QLPT---
G5KAJ3      -----------------------------------------------EKA---QLPT---
B9DUJ5      -----------------------------------------------EKA---QLPS---
G5KD12      -----------------------------------------------ENA---ELPT---
E8JMT8      -----------------------------------------------EAA---EVAS---
F5X0J8      -----------------------------------------------EAA---EVAS---
H2A601      -----------------------------------------------EAA---EVAS---
E7S8W2      -----------------------------------------------DEA---VVPQ---
F8DFF5      -----------------------------------------------DEA---EVPQ---
I1ZPH8      -----------------------------------------------DEA---EVPQ---
E3CBR9      -----------------------------------------------DEA---EVPQ---
E8K787      -----------------------------------------------DEA---EVPQ---
F9M365      -----------------------------------------------DEA---EVPQ---
A3CQY3      -----------------------------------------------EEA---TVPA---
E8KLZ0      -----------------------------------------------EEA---TVPA---
F0FHA9      -----------------------------------------------EEA---TVPA---
F0FQQ4      -----------------------------------------------EEA---TVPA---
F0I4H6      -----------------------------------------------EEA---TVPA---
F0IAY2      -----------------------------------------------EEA---TVPA---
F0IJI1      -----------------------------------------------EEA---TVPA---
F0IS52      -----------------------------------------------EEA---TVPA---
F2C9N1      -----------------------------------------------EEA---TVPA---
F2CH54      -----------------------------------------------EEA---TVPA---
F3UDW8      -----------------------------------------------EEA---TVPA---
F3UNJ5      -----------------------------------------------EEA---TVPA---
F3SM33      -----------------------------------------------EEA---TVPA---
F9HC66      -----------------------------------------------EEA---RPAI---
E1LQJ6      -----------------------------------------------EEA---RPAL---
Q4JYU0      -----------------------------------------------EEA---RAAL---
Q4JZY2      -----------------------------------------------EEA---RPAL---
F9Q346      -----------------------------------------------EEA---RPAT---
Q6L5R1      -----------------------------------------------EEA---RPAT---
E9FEC6      -----------------------------------------------EEA---RPAT---
E0Q2S9      -----------------------------------------------EEA---RPAT---
F5VSH0      -----------------------------------------------EEA---RPAT---
A5YTV6      -----------------------------------------------EEA---RPAT---
Q6L5T1      -----------------------------------------------EEA---RPAT---
E0PPH8      -----------------------------------------------EEA---RPAT---
A5YTT8      -----------------------------------------------EEA---RPAT---
E6KKR9      -----------------------------------------------EEA---RPAT---
A1ILY0      -----------------------------------------------EEA---RPAT---
F2QF91      -----------------------------------------------EEA---RPAT---
Q4K0I3      -----------------------------------------------EEA---RPAT---
Q8KWQ1      -----------------------------------------------EEA---RPAT---
Q4K238      -----------------------------------------------EEA---RPAT---
B1I966      -----------------------------------------------EEA---RPAT---
G6J8A3      -----------------------------------------------EEA---RPAM---
G6LKG4      -----------------------------------------------EEA---RPAM---
F9LZC3      -----------------------------------------------EEA---RPAT---
F9P1W9      -----------------------------------------------EEA---RPAT---
A5LJR9      -----------------------------------------------EEA---RPAT---
Q9ZII7      -----------------------------------------------EEA---RPAT---
Q4K1K7      -----------------------------------------------EEA---RPAT---
E1LPE6      -----------------------------------------------EEA---RPAI---
F9MJW6      -----------------------------------------------EEA---RPAI---
Q4K0V3      -----------------------------------------------EEA---RPAT---
Q54519      -----------------------------------------------EEA---RPAT---
C1CBD0      -----------------------------------------------EEA---RPAI---
Q7WVX1      -----------------------------------------------EEA---RPAI---
Q4K0E2      -----------------------------------------------EEA---RPAI---
Q9AH96      -----------------------------------------------EEA---RPAI---
A5M4L2      -----------------------------------------------EEA---RPAI---
B2ILP4      -----------------------------------------------EEA---RPAI---
C1CCB8      -----------------------------------------------EEA---RPAI---
P72511      -----------------------------------------------EEA---RPAI---
Q4K1S8      -----------------------------------------------EEA---RPAI---
P96474      -----------------------------------------------EEA---RPAI---
Q4K196      -----------------------------------------------EEA---RPAI---
Q4K0Z7      -----------------------------------------------EEA---RPAT---
Q4JZ85      -----------------------------------------------EEA---RPAI---
Q4JYH6      -----------------------------------------------EEA---RPTI---
Q4JZ19      -----------------------------------------------EEA---RPAI---
Q4K0A1      -----------------------------------------------EEA---RPAT---
Q4K1M5      -----------------------------------------------EEA---RPAI---
Q4K2Q8      -----------------------------------------------EEA---RPAI---
Q4K1G0      -----------------------------------------------EEA---RPAI---
Q4K0T6      -----------------------------------------------EEA---RPAI---
Q4K0K3      -----------------------------------------------EEA---RPAI---
Q4K0X6      -----------------------------------------------EEA---RPAI---
E8KDN1      -----------------------------------------------EEA---RPAL---
F9PEU3      -----------------------------------------------EEA---RPAT---
E8K321      -----------------------------------------------EEA---RPAT---
F9PZP6      -----------------------------------------------EEA---RPAT---
D6R2T7      -----------------------------------------------EEA---EIPK---
F3UUQ1      -----------------------------------------------EEA---EIPK---
E6IZC3      -----------------------------------------------EEA---EIPN---
G6A746      -----------------------------------------------EEA---EVPN---
B1V0N8      -----------------------------------------------DYPKS-I------
B1BNK2      -----------------------------------------------DYPKS-I------
B1R3X7      -----------------------------------------------DYPKS-R------
Q8XN77      -----------------------------------------------DYPKS-R------
A3ICA4      -----------------------------------------------FIAQS-SEHP---
B1HR40      -----------------------------------------------FVAQS-SEHP---
H1BJT0      -----------------------------------------------DKATL-QTH----
F8FCE3      -----------------------------------------------GVANP-EKPA---
I0BSG5      -----------------------------------------------GVANP-EKPA---
A8YPQ6      -----------------------------------------------SKADG-TAV----
P95695      -----------------------------------------------SKADG-TAV----
Q2G1K8      -----------------------------------------------SKADG-TAV----
C5QNG5      -----------------------------------------------SKANG-TAE----
Q4L9H8      -----------------------------------------------SKATG-TAH----
Q2FUV1      -----------------------------------------------SSAHD-NAV----
P39850      -----------------------------------------------STADN-TGK----
D7UYE3      -----------------------------------------------SKADV-KAV----
Q4A121      -----------------------------------------------SKADY-YGS----
E3HB17      -----------------------------------------------EKAEI-PTK----
C9AAE4      -----------------------------------------------AEGTV-LPQE---
H7F6C7      -----------------------------------------------SEAQF-LGNE---
F0SX23      -----------------------------------------------DMAKA-PTE----
Q38VG4      -----------------------------------------------SEAKP-NLV----
F2I4B6      -----------------------------------------------SKAQA-SHS----
Q8RBS6      -----------------------------------------------DRAVP-PTS----
D9SR42      -----------------------------------------------DNALV-PSS----
D9SVC8      -----------------------------------------------DTAQV-PKS----
E7RG09      -----------------------------------------------SPAVV-LENQ---
D4G2E2      -----------------------------------------------SKAEV-SEHP---
Q8EME7      -----------------------------------------------SQAEL-AEEP---
D6Y035      -----------------------------------------------SPADL-ADSM---
Q5WBB3      -----------------------------------------------SEAEI-GEDP---
Q9K6Q9      -----------------------------------------------STAEL-GESP---
Q97EP7      -----------------------------------------------DRATA-PKS----
Q97ER4      -----------------------------------------------DRATA-PKS----
E4S7Y7      -----------------------------------------------DKAVV-PEK----
E4Q5T6      -----------------------------------------------DKAVV-PDK----
E4SDX3      -----------------------------------------------DRAVV-PDK----
G2FWX3      -----------------------------------------------DKAMT-PIN----
G7WJV2      -----------------------------------------------DTAVV-PAK----
G7W774      -----------------------------------------------DTAVV-PDE----
G2FM60      -----------------------------------------------DTAVI-PDK----
H5XZD5      -----------------------------------------------DTAVI-PDK----
I4DBG9      -----------------------------------------------DKAET-PDA----
G2FWT7      -----------------------------------------------DTAVT-PDK----
H5XZG8      -----------------------------------------------DTAVI-PDQ----
G0V448      -----------------------------------------------DNAVF-PDK----
A0PZ01      -----------------------------------------------DKVQV-PEK----
B1B737      -----------------------------------------------DKVQV-PEK----
                                                                        

G7EJX5      ------------------------------------------------------------
G9RSY8      ------------------------------------------------------------
F3CAY8      ------------------------------------------------------------
I0UTA4      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
G8AU95      ------------------------LTAAQAQKAAAE----------------------AR
G5IFS2      --------------------EKYLQLNVLGTIPVFE----------------------VD
F0G6H6      ------------------------SVDIETRILTLQ------------------------
F6CNF6      YESQLKMAGVELEQLSAGVARLEQELASTPKMVSVEKLDPDTGKIVTVQDVNPVYVSVSQ
A3W0H6      ------------------------LLALDQQIITLE----------------------TE
A3K8W6      ------------------------ELDLSQEIITIQ----------------------GD
Q0FMP1      ------------------------QLALARDIVEME----------------------GN
S9QRP2      ------------------------ELELDREIVALR----------------------TN
D0D9W1      ------------------------ELELDREIVAME----------------------GS
I1AYC4      ------------------------ALTLDREIVALE----------------------AN
E9TE87      ------------------------VHPAYRTLLEKR----------------------QA
E6PYQ4      ------------------------YGSNYPGLGQVQ----------------------AQ
C0QCJ1      ------------------------YTRQHPDVRRLE----------------------AV
I5B297      ------------------------YTEKHPDVKKLK----------------------RI
B8D0N1      ------------------------YTDKHPEIIKLK----------------------AE
D9QTC7      ------------------------YTDNHPKVIATN----------------------RK
C7LPS4      ------------------------YTDQHPKVVRLQ----------------------GQ
Q314L4      ------------------------YTEKHPAVIRTK----------------------QE
G0VNK5      ------------------------YTDEHPKMQEIN----------------------NQ
D2RIR1      ------------------------YTSENPKMKEIN----------------------RQ
I0GRR3      ------------------------YTEDHEKMQAVN----------------------QK
Q39U16      ------------------------YTDNYPEVIRIK----------------------SI
F0JCB9      ------------------------YTENHPRVRQLE----------------------NA
G7QCG0      ------------------------YTEKNPKVIKAR----------------------AA
I2Q342      ------------------------YTEKNPKVIKAR----------------------AA
Q74BQ7      ------------------------YTDSYPEVLRVR----------------------GE
B5EA80      ------------------------YTDSFPEVVKVK----------------------GD
C6DZX6      ------------------------YTENFPEVVKVK----------------------GD
A1ARV9      ------------------------YTDSYPEVLQIK----------------------GD
E8WSZ4      ------------------------YTDSYPEVLTVK----------------------GD
A5G425      ------------------------YTESYPEVIRVK----------------------TE
B9M2X7      ------------------------YTDRYPEVMRLK----------------------SE
C2MBF7      ------------------------I-----EGFKQS----------------------QQ
H8YYB8      ------------------------YSSQHPERMRIE----------------------RE
E7T802      ------------------------------------------------------------
F4SM98      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
E3H7M4      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
H1WR07      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
H1X4N3      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D8FLF7      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
C4VP07      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
Q1AUN7      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
C3WFM8      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F4FXQ8      ------------------------------------------------------------
C0WV34      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
B7BDT7      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
G5IRQ5      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
F0PU65      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
C2QJY6      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
G5SDT9      ------------------------------------------------------------
G5LQM7      ------------------------------------------------------------
G5Q4J1      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
A5V0I4      ------------------------------------------------------------
A7NQ70