BYKdb

Dataset for cluster tadcd of phylum aquificae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A432EZU1      MTVPVIKAVGNLSAATHDTAIPLSNIQMVDASASPDIKRELSLSELFSIIWRRKWLVIFS
A0A432F1D0      MSSENSQIFPVKTSNANNQGRLVVPSNEIYPEEILEQRSGLNLRDFISTLARHKTLLIGF
                *:    : .   :: ::: .  :   : : ..   : .  *.* :::* : *.* *:*  

A0A432EZU1      VILSLVVALLFTLSAKSTYRANATIQIERQGVEVVNFGKTDNLGGEVDSLNDPFFRTRYE
A0A432F1D0      TLATLLFSIIVTLLMDPVYRASSTLQIERNAKKVVNI---DMLSAQESRSDKDFYETQRQ
                .: :*:.:::.**  ...***.:*:****:. :***:   * *..: .  :. *: *. :

A0A432EZU1      TLKSRKLLSKVIAETNLYQSLAGTNDKPSLLKQGLIALGLAEASKKRNKGVEDYPKLLLD
A0A432F1D0      LIQSRALARRVINQLDLEKNVASS----GIISRLKSLLGLGDNSSKNNPSVIE--TIFLE
                 ::** *  .** : :* :.:*.:    .::..    ***.: *.*.* .* :  .::*:

A0A432EZU1      RLLVQPIDKTHLVEIYYEGNSPEEAKNVVTSLVDNFIRSQLDSRSETGDFAKRFLNKQVE
A0A432F1D0      NLSVTPVSNSQLVQINYESTDPKLAADIANAVTKTFVRMNLERRFDTASYSKEFLTSSIS
                .* * *:.:::**:* **...*: * ::..::...*:* :*: * :*..::* **...:.

A0A432EZU1      EARERLRLSEEKLVAYSNEKGILGIDENQTRHVTKLNELNAALVHAEIARSAAESQYRAM
A0A432F1D0      KTKKDLEDSEKRLNEYATKYGIIQGVEGEGSNTHSLKKMAEELITAGKERIEAESAYEQS
                ::.: *  **:.*  *:.: **:   *.:  :. .*:::   *: *   *  *** *   

A0A432EZU1      Q-----GRGSTSSALTNPVIVGLKSRLVDLEGQYQEKRKLFKPTYPDMRRLNQQIVGVRT
A0A432F1D0      KQTLNDENATSVRILKDPYIQSLKKTLARLEANSQEILKTHSPRSSKARRIRKQIDEVRS
                :      ..::   *.:* * .**. *. **.: **  * ..*  .. **:.:**  **:

A0A432EZU1      KLNRELQLIKGAAGRSLKATYLAAKAQERRLRSELSRFNKKLKTLQDSGVDYNKYKREVE
A0A432F1D0      QINIESYAIKSA----LKSEFFAAQQKESMVKKQLELLKKETLEIQGKTIKYNTLLREVQ
                ::* *   **.*    **: ::**: :*  :..:*. ::*:   :*.. :.**.  ***:

A0A432EZU1      SNARLYKNLLQRVEEVSIASSVNTSSIKVVDPAITPVKKYRPRPSLNMIVGLLSGLFLGL
A0A432F1D0      SNRDLYKNLLGQLKQVNIAGNVNSNNISIIDKAGIPYKKFKPNFKTNIAFGLLLGLLLGM
                **  ****** .:::*.**..**:..*.::* *  * **:.*. . *: .*** **:**:

A0A432EZU1      ALAFLREALDQSVRSTEDLQRITGLPVLGLVPKPKRISNKEIAMATVLKPSAIFSEAYRV
A0A432F1D0      AAAFLREFMDDSVKNPDELEKLTGLPVLGMLPAQASQSPSSVALQTYNEPKSPLAEAIRS
                * ***** :*:**...::*:.:*******::*     * ..:*: *  :*.: ::** * 

A0A432EZU1      LSANVRFTLARERGKVLLVTSSSPNEGKTTTACNMACAYAQMGMKVLLIDADLRKPSIAE
A0A432F1D0      LRTSLRFSTQEGAPKSTFITSSAAGEGKSTVAINLATAYAQSGNKILLIDADLRNPSLHK
                * :.:**:      *  ::***:..***:*.* *:* **** * *:********:**: :

A0A432EZU1      KMRIYNKRGLSNFLGEDDGLLEVTQQIKGVSGLYVIPSGSNDTDSMRLLSSERMQFLIAQ
A0A432F1D0      LFKLENYSGLTNYLAGGGSSSDIYRPTM-IKNLDVITSGPIPPDPVELLSGKRMGTLLSN
                 :.: *  **:*:*. ...  :: .    :..* **.**.  .*.: ***.:**  *:::

A0A432EZU1      AEQKFDFIIIDSPPVGGFADTLILSSLVSSTLIVADEAKLQISKIRYTLEQLMRIKSTAV
A0A432F1D0      ASADFDYIIIDGPPVLGLADALVISGLCDATILTIEAGKTRKVTLMKTLKRLERAHSNIV
                *. .**:****.*** *:**:*::*.* .:*::. : .* .  .:  **:.* * :*. *

A0A432EZU1      GFLLINSTNPLVTDTAYEKHYKRKDASRFDNMLPNAFSAKLLTKKKTDRIKKFKVRGVKK
A0A432F1D0      GLLFTRVNSSVDSDYHEDYHYPYSGDNDKTESINSPVVTPLKLHRRA-------------
                *:*: . ...: :*   : **  .. .   : : ... : *  :..:             

A0A432EZU1      PLWGKPKKGINLGYMN
A0A432F1D0      ----------------
                                

© 1998-2019