BYKdb

Dataset for cluster orphancd of phylum armatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3C0CSI4      ------------------------------------------------------------
A0A402CP56      MQSEPLLIESEESQPVMSPQDYVSILRRRRNTIVTTWILISAFGIIVTMATRNVYQATAK
                                                                            

A0A3C0CSI4      --------------------------------------------QEIDKLN---------
A0A402CP56      LLVDGPSMMVSQVESDNNLASLFNIGSEQTVDTKVEELQAGPLINTVDKLSNHAKLTVTA
                                                            : :***.         

A0A3C0CSI4      --------------------STRAELLQEYIPSSREV---------KKVDGQIEDAEQRL
A0A402CP56      VKGTNVIDIVGESTDKVAAAAAPNTLIQLYLQTTAETDLQEVHKAQKFAQKQMTDAQARL
                                    ::   *:* *: :: *.         * .: *: **: **

A0A3C0CSI4      KKVAQ-------------------------------------------------------
A0A402CP56      DKANRALELLKQKHGFVDIAKSRDDQIARVSSLTQQLQQARAELAGARAQVSGLSNLVSA
                .*. .                                                       

A0A3C0CSI4      ------------------------------------------------------------
A0A402CP56      EPATLDVQLRQTNTEIAEIKSKITQRELDRRQMTLPGGFTAKAPQVRALDSEIAGLKSQL
                                                                            

A0A3C0CSI4      ----TVLSTTTNSRNPLWENLLKDFSGSIAESSALDTKVQVLNRCLVQREMDFKVLPELE
A0A402CP56      AALPAVSTTMTSNPNTVRENLRAKVASSEGDVASLEARVLETQTLLEQAKSELATYPSLE
                    :* :* *.. *.:.***  ..:.* .: ::*::.*   :  * * : :: . *.**

A0A3C0CSI4      RELTTRIQNIAILERTYDMLSQKYYTLLLSEQSMLPNGILISKPRVPEAPSYPRTDRNIA
A0A402CP56      APAEQYQNEHDTALASYQMYATTLQNLNLREQARHVSAHVIEPAVVPTEPIRPKRLLNFL
                       ::      :*:* : .  .* * **:   .. :*. . **  *  *.   *: 

A0A3C0CSI4      LFAMLGIMLSVVVAIVVDRMDIRVHDPSVMAGIADLPSLASIPFMDNEDAAYKQIGKLKH
A0A402CP56      FAIIMGGVIGILMALLQEYLDDRLNSTEDAERLLGLPSLGRVPQLSRDDALL--LSNMSG
                :  ::* ::.:::*:: : :* *::...    : .****. :* :..:**    :.::. 

A0A3C0CSI4      NSIFLESFRILRNNIMFSAIDNPLKVLAVSSPGPGEGKSTLAVNLAIAMAMDGKKVLLVD
A0A402CP56      PHPELEAYKTLRTNIHFAAIDTPFRSLQVTSSSPGEGKTTTATNLAYAMAADGKRVILID
                    **::. **.** *:***.*:. * *:*..*****:* *.*** *** ***.*:*:*

A0A3C0CSI4      CDLRRPSIHNWMSLSREIGLTNVVKGLSNIKDAV-CSTDIENVFCLPSGPLPPNPTEFLN
A0A402CP56      TDLRRPSVHKHLDLAQTPGITELLVGDATLHEALQVSPNFPNLSVLAAGTIPPNPSELLN
                 ******:*:.:.*:.  *:*::: * :.:::*:  *.:: *:  *.:*.:****:*:**

A0A3C0CSI4      SKHSRNIIKELSGMYDMLILDCPPCTGLSDVQVISTMADGVLLVVTINRTLKTYLHMALS
A0A402CP56      SQKFRTLVDQLSARFDIIIFDSAPVLAVADAQIVASQADGVVLVVANGETRKAAAKQGLN
                *:: *.::.:**. :*::*:*..*  .::*.*:::: ****:***: . * *:  : .*.

A0A3C0CSI4      TLSQVKAPIIGYVLNMVDSRRQGYGYYYNYDYDEQ---GGRNKSKRRCCMPKSKN
A0A402CP56      LLRRARANVIGVAFNKMNVKDNMYYYRYTAETSTEALPGRNGHSTRQIETEGTKK
                 * ...* :** .:* :: . : * * *. : . :   * ..:*.*.     :*:

© 1998-2019