BYKdb

Dataset for cluster tadcd of phylum armatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3D4ZY98      --------------------METSARTLEVKDYVRIFT-KRWLLILIITAAV---GMMAT
A0A068NY62      MTNPKRITDDLRSGGGYDVDEQERTELLHYGGVLR----RRWPAMLVVALAVF--GLVAA
A0A3D0NA47      --------------MEHVAAEESRPRHLGLPDYIRILSKRKWFILIVTAVGMLVGGLLA-
                                     :  .  *   . :*    ..*  ::: : .:   *::* 

A0A3D4ZY98      LFALRAPSYRAEALVLIRTEPIQRLEVMEGEAIESR--DVQSELTLDTHARIVTSYSVAS
A0A068NY62      YTMLQRKVYEASTKLVVVTKGAS---IGGGDTLLATLGAIRQSRTVDTQVEIINSFDLID
A0A3D0NA47      --LSSERLYEATSLVIIQQRPQGFFWVTGEEA------GMPPNVAMETHARIVRSSDVTQ
                        * * : :::         :   ::       :  . :::*:. *: * .: .

A0A3D4ZY98      RTAAKLAARESGQKMEVEPAEIIKTLQVIPQDPDRLVIQSTSSERDRAREFANETAETFV
A0A068NY62      RAFRTMTPAERMNGFKSLTAPAWSYEIKSRAETDVILIDSRSFRPDLAARFANAIAQTYL
A0A3D0NA47      LASEKLQQLPTDSRVIATSTEIQDALNVSVIEPDLLRIDATSPDRRRALLFANYTAFAFV
                 :  .:      . .   .:   .       :.* : *:: *     *  ***  * :::

A0A3D4ZY98      QISAELRRKDVTAAREFLEEQIGNLHARLLTLEEELAKYQHQVGIVVPEVEATSAVAQLQ
A0A068NY62      DEDLKRNSQATRQAWEYVQREMATSRNQLAIASADLAHYKQKTGLVAAADQVSGLAKAEL
A0A3D0NA47      ERNLEDRQRESRDAREFLERQVAQYGTEVESIIEEMTAFARDSGFVDIDSEIGQAVQSLA
                : . : . .    *.*::: ::.     :     ::: : .. *:*    :    .    

A0A3D4ZY98      DYQRELNSATTQLEALNSKQAELRRQLQG-EPQILEIPGREPDPERIVVEAQLRQERLGL
A0A068NY62      EVQGSLDSSRADMLAAERNLARLKGQLRALSPEIDFQRTIAENPEFALVRANVLQLEGRL
A0A3D0NA47      AYENEERQAQRELMAAEARLAELR-QVRGSQGDYLVGEAPAPNPEWTTLQASLTEARIGL
                  : .  .:  :: * : . * *. *:.. . :         :**   : *.: :    *

A0A3D4ZY98      TGLQARYQDEHPAVSEAKRRIEALEARIAALPE-TRDVTQMQTNPRLPALKAELDGTRVN
A0A068NY62      VELSQEFTPNSPEVTQVKQELQVQKDKLKALARTTVSTEEKVRNPLLDKLASDYAEATAT
A0A3D0NA47      EKLQSQYTGGNPLVLDQQALVEELAARLADTPQ-LVRAESTRANPATTGIEGEIKAAGVA
                  *.  :    * * : :  ::    .:   .     . .   **    : .:   : . 

A0A3D4ZY98      IAETRSRISRLQSIVTGLRADTVDLPLELAAIERLESQINLARRTYETFLAQLEQSKLRE
A0A068NY62      QVVASERAKALGGQLVKDQAALRQYPEQERHLAELQQRVDVLYRTFNMLSDRYYALLIEW
A0A3D0NA47      VQEARARVAAAQGVLGGVQERIKDLPDARQQWQGLTDRLDAAREAYLSLQGELRQARLSE
                   :  *     . :   .    : *        * ..::    ::  :        :  

A0A3D4ZY98      AIKQGSATVIDRAVEVEELRASLGR-TFGFGIALGLFVGLLAALLLEALDDTFHSPEDLA
A0A068NY62      RSSLPNGLVAALARPPSAHSSPRTSLNLTFGIIIALVLGLGVGVLLERLDTKLHSPEEAE
A0A3D0NA47      AVKKGNARVVDQAQEPREIQTSLLH-SLLFALAIGLFIGVGLSILLEALDDTIYSVDDLQ
                  .  .. *   *       :.    .: *.: :.*.:*:  .:*** ** .::* ::  

A0A3D4ZY98      YYTDVPFLGMVPMLDQPGDELVTIVA-PKSPPAEAYRVLRSNIHFAQADNPARTFLVTSA
A0A068NY62      RATGLPALTFVPEATTSGDRLLLGEAQPSHAFIESFRLLRNNIAFAVPDKDLRVVAVTSA
A0A3D0NA47      RVSDLYLLGVVPLHMDDAGPLVTVDA-PKSPSAEAYRTLRSNIRFSLFDRPARTFLITSA
                  :.:  * .**     .. *:   * *. .  *::* **.** *:  *.  *.. :***

A0A3D4ZY98      GAGEGKSMTTANLAVVFAQSGQKILLIDSDLRRPTLQRRFKVPRDTGLTNLLIGEMSLEE
A0A068NY62      AMAEGKSTISVNLAIAMAMDGKRVLIIDADLRRPTVHKWVGMTNEKGFTSVVRGVSSLSD
A0A3D0NA47      GSGEGKSVTTANLAVAQAHSGLSVILVDADLRRPVQHKLFCVPSEVGVTNVVVGDMSVAE
                . .****  :.***:. * .*  ::::*:*****. :. . :. : *.*.:: *  *: :

A0A3D4ZY98      VVIEVERVPGLYVMPTGPLPPNPADLLGSDRMIEIIAEATRFADIVIFDSPPAIVLTDAV
A0A068NY62      AVRSTQ-WDGLQVLPSGPLPPDPTEFLNSHRSKDVFQLAANEYDVVVVDAPPCTGLSDMQ
A0A3D0NA47      ALTPTE-VPGLRLLTSGPVPPNPAELLESEQMTAVIQELTQLADLVIFDSPPAVMLTDAT
                .:  .:   ** ::.:**:**:*:::* * .   ::   :.  *:*:.*:**.  *:*  

A0A3D4ZY98      VLSSKIDRTILVAECDHVNRTAFIEMIRLIRNARGNILGAILNKMRLSTADY------YY
A0A068NY62      VISTIVDGVVLVAALDSTSKPMMHATMRMLRQAGAPLLGLVINRIKHSNKGYYGYYGYYG
A0A3D0NA47      VLAAKLDRTIVVAESGQITERALADVERLFRHARADILGIVLNKLRITGGDY-----HYY
                *::: :* .::**  .  .   :    *::*:* . :** ::*.:. :  .*      * 

A0A3D4ZY98      YYYYYDYAKETPVSRPLDGAPTPAPEIDVEEPLEVLXRCGPPRPAPTRSSGLRSSPGKRR
A0A068NY62      YYGYSSYQDD-----------------------------------PAAEEKVAKTKRSRT
A0A3D0NA47      YYYYSDYSEE-----------------------------------PQSPRGARNASGSER
                ** * .* .:                                   *       .:  .  

A0A3D4ZY98      RASSTSCTAIRRPSRRPRLRPHCRLTTCRSRSRRRKRRRSPTAPGATATRTATATATATT
A0A068NY62      SKK---------------------------------------------------------
A0A3D0NA47      KAQDLIDLNSSDERGRDDLEA---------------------------------------
                  .                                                         

A0A3D4ZY98      AAACSMTCSGQTMTTSERTPVFLSPVENRNLRTQ
A0A068NY62      ----------------------------------
A0A3D0NA47      ----------------------------------
                                                  

© 1998-2019