BYKdb

Dataset for cluster cd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C2MBF8      ------------------------------------------------------------
B7B947      ------------------------------------------------------------
B7BDT8      NQIAVSTSAFISDRLGVIEQELGNVDENISSYKSEHLLPDVQAAASMYMEQSSATNAQIL
                                                                        

C2MBF8      ------------------------------------------------------------
B7B947      ---------------------------------------------------------SSS
B7BDT8      ALNTQLSMARYIRNYLTNSTSKNQLLPANSGIESPGIEQQIANYNTAQLRRNDLVANSSE
                                                                        

C2MBF8      ------------------------------------------------------------
B7B947      KNPVVQDLNNSLIAMKQTIIRSVDNLIVGLNIKIKNIRAQEEQTSRRISAVPTQQKEVLS
B7BDT8      RNPLVIDMDQSLENMRHAIITSIDNHITTLNTQIRSLQQSERQTTARIAANPTQGKYLLS
                                                                        

C2MBF8      ------------------------------------------------------------
B7B947      VERRQKIKEELYLYLLNKREENELTQRMTESNARIIDPAAGSNAPVAPKAMMILLASVVL
B7BDT8      VERQQKVKEALYLFLLQKREENELSQAFTAYNTRVITPPSGSMIPTAPVKKNIALVAFAL
                                                                        

C2MBF8      -----------------------------------------------MIDQASRTFVVGR
B7B947      GCAIPAGILWLLMVSDTKVRSRKDVEGVLSVPFLGEIPM--------RDKKDKNEVVVHE
B7BDT8      GLLIPVVIIFIRENMNSKVRGRKDLES-LSVPFVGEIPLVGSGKKKKKTANTAKEIVIHQ
                                                              :  . .*:  

C2MBF8      HRRSLVSEAFTVIRSNISFL--APDNGAPVKRILVTSAIPGSGKTFTSSNLALSLAQSGK
B7B947      NGRDSVSEAFRIVRTNMDFM---RVKEKNMQVVMFTSFNPGAGKTFVSINLAMSFALTHK
B7BDT8      GKRDIVNEAFRVLRTNLEFILDAKEDKDKASVTLITSFNPGSGKTFLTMNTAATFAMKGK
              *. *.*** ::*:*:.*:     .    .  :.**  **:**** : * * ::* . *

C2MBF8      RVLLIDCDIRKNTLSKAIGMHCRGQLGLSSYLSDARITPEQIMSPSLQTESLIFLPSGPI
B7B947      KVVLVDLDIRKGTLSSHVQVS---DMGVTNYLSGRIDNVDEIIQKGELYDKLDIIHAGPV
B7BDT8      RVLVVDGDLRHGSASAYVGSP---KKGLSDYLGKRENNCEDLIVEKENYPGLFVLPVGTI
            .*:::* *:*:.: *  :      . *::.**.    . ::::        * .:  *.:

C2MBF8      PPNPTELLMSPRFEELLQYADEAFDYIVMDTIPVLNLADTRVISHLTDITIMVVRENHLP
B7B947      PPNPAELLLSDRLEALIAELRERYDYIILDNVPAGVVADAVIVNRVADLTIYVVRAGRMD
B7BDT8      PPNPTELLAEPRLAELIEKMRCRFDYILIDCPPVDIVADTQIIEKLADRTVFIVRAGLLE
            ****:*** . *:  *:      :***::*  *.  :**: ::..::* *: :** . : 

C2MBF8      RRLLHELEALYRDKRLKGLCVVLNDAGIGASAYGYGYG---SYGYGSYGSYGSEKE---
B7B947      RRALPEVEKLYREGKLRNMSLILNGTVYKHGTYGYHYGYGYGYGYGYGYGYGQRKKK--
B7BDT8      RDMLPKLQSDYEAKRFKNMALVLNGTIGGSSRYGYRYGYRYGYKYGYAYGYGSKSYYNN
            *  * :::  *   .:..:.::**.:    . *** **   .* **   .**. .    

© 1998-2019