BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

157 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      --------------------------------MTFNKEYKMIIRP------LLKASPVLI
R6U429          ------------------------------------------------------------
A0A350V3E4      ------------------------------------------------------------
A0A212J9Z9      -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVL------WFYRILKYW
F5IV23          -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVL------WFYRILKYW
F8X2T0          -------------MDIN--NKPGADTDPYFEEIKSKTTLSFDFVL------WFYRILKYW
A0A1M3LAG1      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVL------WFYRILKYW
A0A212K6G4      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVL------WFYRILKYW
A0A1M5DFS8      -----------MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVL------WFYRILKYW
A0A2V3PNY7      -----------MEQNIN--RPADFGTDPYFDEVQAKTKFTFDFVL------WFYRILKYW
A0A015VNG0      ------------------------------------------------------------
A0A142HHS5      MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLST------LVLVARRSL
A0A1M6MYT6      ------------MKKQQNDKDILNFYGQLEEE-------SLISKK------TLFKCFRNW
A0A2P8CDS1      ---------------MDTQNPLTPNQPTTFSR-------PRNYRK------YFFLLLSHW
A0A353WYK7      ----------------------------------MEQNQQFDFDK------LQMVFKRSL
A0A136LSC7      ---------------------------MLQPKEIGPQVQSIDTEK------LSAVIRKNL
A0A355BP94      ------------------------MSKQLNSPTTDP-IEGFDLDK------LWVLLKKNA
A0A161LWY6      ---------------METNNNNQYQNYPLSNSDMEEDESGFDIIE------WLFKILRHW
A0A239K409      ----------------------MVMIDKEAQKMGNRQNEQESFID------SFFKYVRYW
A0A1G9B1T9      ------------------------METSRYSHTQALKSDPIDLSV------ITKKIIRKW
A0A2W4RDE8      -----------------------------------MEEEKINIKK------IFHKLISKW
A0A1V5S1J9      ------------MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIML------WVLRFLKSW
A0A0A2EYC8      -----------------MENTNN-IPNIQTFSEEE-ASS-FNLME------WVMRFLKYW
A0A2G6H6Y4      -----------------METSNNQIQSMQQFSEEDNTSS-LSVME------WIMRCVRYW
A0A1M3DPL8      -----------------MNMEEENKDIKTSDFTDEESS--FDIME------WVMLFVSHW
A0A1V5F519      --------------------MNPDTGSINQNFTEEESS--FDFQK------WLHLFIKNW
A0A2G6R1T9      --------------------MEENSLNQQQFDDSEESG--FDFMS------WVILLVQYW
A0A0L8VEV2      ------------------------MKTMEDFSKSLEREDMLAIKK------FFHKLKRNW
A0A1I2A9Z9      ------------------------MKTMEEYSNSLEREDMLSVKK------FFHKLVRNW
A0A3D0FMX4      --------------------MATDTNVQNQDFTNQDDRIQFDVME------WVFKFLSVW
A0A1M3MEI8      --------------------MEQPVKPRERVIPEEEES-GFDIME------WVAHFIGHW
A0A1J5HQM0      --------------------MEQ--NKPANPFSEEEES-SFDIME------WVNIFLHFW
E4T131          --------------------MDK--FNLEKPFNSEEES-GFDIME------WVSYFLNNW
F4KR18          ----------------------MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILSKW
A0A350PNH9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQD------LMYLCLVRW
A0A354LNT9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQD------LMYLCLVRW
A0A389LWV6      --------------MESTNTKSTNFSIDDTNFQHPGNTSSFDLVL------WIFRILKYW
A0A2W7RD29      ------------------------MNNKSESDPLLLSSQKIDFSV------FFKRLGKKW
A0A3N2NDY8      ------------------------MSDNINVTQESEAAEEFSLKD------FLACCLSKW
L1M9T3          -----------------------------------------MVRD------GFYLCLAHW
D7JEV9          ---------------------MEQNNNISNNTFNEEETSSFNFME------WAIRFLKYW
A0A2W7QSQ0      --------------------------MRKINKKVNSNEEPINIKL------ILRTILKSW
R7F6L5          ---------------MANQIKENEAANISPYYEQAAPASLVSVQG------FLSFVRHRW
C9LKL0          ---------------------------MEYSQKNEVQNSEFKIVPFLLL--CYHVFLAKW
A0A3D0QPV7      --------------------MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARKSL
A0A3C0I8F1      ---------DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRGSI
R5JJI4          ------------------------------------------------------------
A0A1F3D6P8      -------------------------------MTKETDSGIALIKH------YLQDIAYFK
A0A356Z058      -------------------------------MTKETDSGIALIKH------YLQDIAYFK
A0A3D1BT36      -----------------------------MSKNNETKSESLKIKE------FIFKVFSYK
A0A352ME00      -----------------------------MLKTIEPDSSIAPLKY------FILKVASLK
A0A3D3HL11      --------------------------MQLMTNNNDSQSEAFNIKE------FLAEALSYK
A0A3D2HF71      ------------------MTSPSPLNNPSQPYYIPPEEEGLDFKR------YLSLFISNW
B5CTK0          -----------------------MAEKKQATDLLKGEDSSFNIGE------ILHMFLSNW
A0A229I3A5      ------------------------------MARPNQEEDFIRIQD------LLYLCLTQW
A0A3R6HJB3      ------------------------------MARPNQEEDFIRIQD------LLYLCLTQW
A0A0A2DQN2      ---------------------------------MIRQVSDVNLLD------VLRYLVSYW
A0A0A2F2N5      ---------------------MTPQSSSKQTKSAGTVVADINLID------LFFYLLGYW
L1NGW4          ----------------------MANTQETTSTQPAEKGLEVNLVD------IFFYLLRFW
Z4WRA0          ----------------------MANTQETTSTQPAEKGLEVNLVD------IFFYLLRFW
U2K8K9          ------------------------MPEQQITNRPSDKGADLNLVD------IFMYLYRYK
A0A069ZM60      -----------------------MSTQTNRSNQAGEKAAEVNLLD------IFFYLLRFW
J6GV98          -----------------------MSTQTNRSNQAGEKAAEVNLLD------IFFYLLRFW
A0A134B4F8      -----------------------MSTQTNRSNQAGEKTAEVNLLD------IFFYLLRFW
A0A134B8C7      -----------------------MSTQTNRSNQAGEKTAEVNLLD------IFFYLLRFW
A0A1M6B6D5      ---------------------------MSEEFETNEAGTTFDFKG------FLIRLLRNW
A0A451FS66      ---------------------------MNQEFDIKQADGSFDFKG------FFDRLLRSG
A0A2E3GN39      ------------------------------------------------------------
A0A3D1MEL0      ------------------------------------------------------------
F0R0C9          ------------------------MAIPNNPTRPKQGDDFIRIQD------LFYLCLAKW
A0A2A4N9A6      --------------------------MKENQIQNPLPDLDIGLLI------GIFRKSFLL
A0A368D1N7      ---------------------MSEPSKKKQQSSVLYDKFNVGLLL------YVLRKSFKW
A0A3B8TU58      ------------------------------------------------------------
A0A1T5IIR6      ---------------------------MKTAPRKVTRNEQVNLVD------LFYYLIGNW
A0A3E0QD27      --------------------------MGKKKITNLNEEFDFKLFS------IIAKKNAYW
A0A0M1W1I6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
I8WPR6          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A0K2HKS3      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
B6W3W8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A1Y3Z9Z6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A076IRY8      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A3A6AD54      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A3A6MIU7      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
I8WPP8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A372Y7D2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A3E4JJC9      ------------------MIRMSEQKDLSGDKATSGGGFNINPID------IVMYLLSNW
A0A3E4WDQ0      ------------------MIRMSEQKDLSGDKATSGGGFNINPID------IVMYLLSNW
A0A414H9P2      ------------------MIRMSEQKDLSGDKATSGGGFNINPID------IVMYLLSNW
C3R5A8          ------------------MIRMSEQKDLSGDKATSGGGFNINPID------IVMYLLSNW
D1JY72          ---------------------------MSGDKTLSGGGFNINPVD------IIMYLLSKW
A0A1C5XJA7      ---------------------------MQNNIQSNKNDQNINLLD------LLMYLASKW
R7CUW4          ---------------------------MQTTSNNNRNEQGINVVD------LLVYFASKW
D7J4K6          ---------------------------MQNNSLSNKNEQGVNLVD------LSVYLLSKW
Q8ABP9          ---------------------------MQNNSLSNKNEQGVNLVD------LSVYLLSKW
A0A174C2Q8      ---------------------------MQNNSLSNKNEQGVNLVD------LSVYLLSKW
D6D2Z5          ---------------------------MQNNSLSNKNEQGVNLVD------LSVYLLSKW
A0A1T3EDR4      -----------------------MIRNSKYINIRGTWGENFHILD------LFKYALGYW
A0A174SDD8      -------------------------MEKHKKLAVTEEEKSINIVD------LFIYLLVHW
A0A1H7RFH3      -------------------------MEKHKKLAVTEEEKSINIVD------LFVYLVVHW
A0A412GR09      -------------------------------MAVTEEEKSINIVD------LFVYLVVHW
A0A139L1N2      -------------------------MEKHKKLAVTEEEKSINIVD------LFVYLVVHW
A0A174TVL8      -------------------------MEKHKKLAVTEEEKSINIVD------LFVYLVVHW
A0A1H8BJR6      -------------------------MEKHKKLAVTEEEKSINIVD------LFVYLVVHW
R9H6G0          -------------------------MEKHKKLAVTEEEKSINIVD------LFVYLVVHW
A0A081PBV5      ----------------------MDNLNNINLMPKAKEEKSINLLD------ILKYLLFQW
A0A1I2AN85      ----------------------MDNLNNINLMPKAKEEKSINLLD------ILKYLLFQW
A0A1H6CKR6      --------------------------MNKDFLIKDKQTQSINVLD------VLKYLLSNW
A0A235E1C0      ---------------------MVNHSTNKPFQGKGKQDQSLYVLD------ILRYLLANW
R6D982          -------------------------MEKQVKKILAEEDKSINLVD------ILMYLLSYW
A0A078PL82      -------------------------MEKQRKLALTEEEKSVNIVD------VFMYLIAHW
A0A078QKV9      -------------------------MEKQRKLALTEEEKSVNIVD------VFMYLIAHW
A0A1F0I8C4      -------------------------MEKQRKLALTEEEKSVNIVD------VFMYLIAHW
A0A3A5RIJ2      -------------------------------MALTEEEKSVNIVD------VFMYLIAHW
A0A0B8T471      ---------------------MDNTNYNPYIESREKEGKSLNLID------LIKYLLLHW
A0A0D5BSQ0      ------------------------MINQNKQNV--QKDGIINVLD------ILKYFLFHW
A0A1T3F6P5      ----------------------MDTINQKNQVVGNKKEHSVNVLD------ILKYLLHNW
A0A0W8EPA0      ----------------------MDTINQKNQVIGNKKEHSVNVLD------ILKYLLHNW
A0A365UKN1      ----------------------MDTINQKNQVIGNKKEHSVNVLD------ILKYLLHNW
A0A2T5RP38      ----------------------MNTLNQKEYRIGERKEQTINVLD------LLKYLLHNW
A0A1A6CF06      ----------------------MNQYSKNSV----QKENTINVLD------IFKYLLFHW
A0A1T3D6S8      ----------------------MNQYNKHSV----QKENTINVLD------IFKYLLFHW
A0A376E091      ----------------------MNQYNKHSV----QKENTINVLD------IFKYLLFHW
A0A1P8E011      --------------------------MKTTHYNQLQKDKSINVLD------VLAHLLYHW
A0A1V3N3U3      ----------------------MNNILERTGAGAERKNNSVNVLD------IFKYLLFHW
C2FUH6          ------------------------MVNNQITQNITKADKSVNIID------LFKYLMIHW
A0A239XXC4      --------------------------MNKSFQGKGKQDQSLYVLD------ILRYLLGNW
A0A2X2J8S4      -------------------MENRPEVVNNQFFG-AKNNSTFNVLD------IIKYLLFHW
A0A3C0S618      -------------------MENRPEVVNNQFFG-AKNNSTFNVLD------IIKYLLFHW
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      GLITIAILVTRR------AVTYMTPEYR-------------AGGAIKINNLNYTQAAINL
R6U429          -----------------------------------------MRDLASFTGGLSRMR----
A0A350V3E4      --MPILLSLAVGLVVSYFYAYSQVDIYA-------------SASSMRLSKPKENVL----
A0A212J9Z9      YLFIISVALFLG--YAYIKNKSWVPVFY-------------VQALMILEDRNTASV----
F5IV23          YLFIISVALFLG--YAYIKNKSWVPVFY-------------VQALMILEDRNTASV----
F8X2T0          YLFVISVVLFMA--YAFIKNKSWVPLYG-------------IQAMIILEDRGSSMI----
A0A1M3LAG1      YLFVISIALFMA--YAFIKNKSWVPFYG-------------IQAMIILEDRGSSMI----
A0A212K6G4      YLFVISIALFMA--YAFIKNKSWVPFYG-------------IQAMIILEDRGSSMI----
A0A1M5DFS8      YLFVLSLALFLG--YAYLKNKSWTPLYR-------------SGAVLMMESRGNSGV----
A0A2V3PNY7      YLFALSLALFLG--YAYIKNKSWTPLYQ-------------SGAVLMMESRGNAGV----
A0A015VNG0      ------------------------------------------------------------
A0A142HHS5      PWVIFLLTLGIT--SSWLYMRYTKPIYE-------------ATSILKIDDHSDASA----
A0A1M6MYT6      YWYVVAVIVAGA--LAWLYVQYTTSVYE-------------IKSSMLVEEGKSGSP----
A0A2P8CDS1      YWFVIAFILTVT--GIWLYYRYSHPVYA-------------VSSTMLIHEQQNQNP----
A0A353WYK7      PVLIMLLIFSVATAYLTIRYTKDLYQSE-------------SVLQLDIKSEAQVLG----
A0A136LSC7      VWIVLIFIAVNLAAYLTIRYTKDLFESE-------------SEMKLDIKRDATELG----
A0A355BP94      LIIILLFLSTNLIAYLKIRWTKDEFESY-------------SELKLEVKQDATALG----
A0A161LWY6      YLFVIALAISLS--ISFIANRTWKPSYQ-------------VSARVILGGGQASAS----
A0A239K409      YLFLLGLLITVG--TAYVYIQHATPLYL-------------ISGTLLIKTSGNEGQ--LS
A0A1G9B1T9      YLLLGSLLLTLA--LAYVVILTTPEVYK-------------VSSSMLVRDESATGN----
A0A2W4RDE8      YYFPLGLLITMPLAYAYIQLTEPRYLVR---------------ASMLLKGEKDKGP----
A0A1V5S1J9      YLFVISLAIFLS--IAYVKNRSWQPNYK-------------SSALVIIEENKGLSGAQAA
A0A0A2EYC8      YLFAIGVVIALT--IAYYQNRSFVPIYN-------------SSLRLLLK-QE---SGSFL
A0A2G6H6Y4      YLFVIGASIGFG--LAFYKNQKVVPNYL-------------SYSQILLEDKK---ADSFA
A0A1M3DPL8      YLILISVFVFMF--LAYMQNRKWLPSFK-------------SSATVIIDESRGSMNSAQV
A0A1V5F519      YLFLIFIPFFLI--GGYLKNRSWMPLYQ-------------SVGTIIINENKYR-SSSQG
A0A2G6R1T9      YLFVIFGVLAFG--ASYLKNRSWVPVYF-------------SSGKLMIDPNAGQ-NNPQ-
A0A0L8VEV2      YWFMIAGIIGGA--GGYLLTQVTPPSYE-------------LNSLFLIKKKDNAQV----
A0A1I2A9Z9      YWFMIVGIIGVG--LGYLKTQVTAPAYK-------------LESLFLIKTDNKGGL----
A0A3D0FMX4      YLYVICLAIAFG--ISIYSNRKWVPTYR-------------TAGTLIINEYGSQ-----A
A0A1M3MEI8      YLFVIGLVIAFG--LSYMQNRKWLPEYK-------------STGSVIIDDSRTM-M--NS
A0A1J5HQM0      YLFVIFVIISLG--MAYLKNRTWIPSYK-------------SAGTMLIEEYKIT----NN
E4T131          YLFVIGIILSLG--LAYIENRSWLPTFQ-------------TEGRVLIDENRSSNA--NS
F4KR18          YLYLAFSIICIG--LAYVYYKNQQPVYA-------------ITSKLLIRERERDYGPGAD
A0A350PNH9      RWFVISLVVTLG--IATYHLLSTPCVYQ-------------RTASILIKEDGKSQSINSD
A0A354LNT9      RWFVISLVVTLG--IATYNLLSTPCVYQ-------------RTASILIKEDGKSQSINSD
A0A389LWV6      YLFLVVILLSLS--LALLKNKTWTPTYK-------------TSSTILINENKGQQV----
A0A2W7RD29      PLFLLTGIICLF--IAHTSYKSTVTTYE-------------INSKLFIYTEGQSINFFEK
A0A3N2NDY8      RWFTVSIVLFCC--LGVLYVLRQQPVYS-------------RSMELLIKDQDGGGG-VAD
L1M9T3          KWFVLSLLVCLS--SATYYLLRTPKTYV-------------ASASILIKPDSNKGNTPDE
D7JEV9          YLFVLGVFISLA--IAYYQNRSFVPIYN-------------SSLRMLLKQEAGSLS--YM
A0A2W7QSQ0      YLFPIFILLFCG--VAYYYIKTITPEYL-------------ISSVIIIKEGERNNN--VT
R7F6L5          YWYVISVAVCVG--IAWLMLARSPRLYT-------------KSETILIKDPTFGNS---A
C9LKL0          RWFAFSIIVCVA--CGWYYQQIQPRVYT-------------RQATMLIEGGNGSGRGGFS
A0A3D0QPV7      RWVLLFLITSLL--AAWLYLRYTPPVYE-------------SLSVIQISEENNMKQ----
A0A3C0I8F1      PFIILIVGLSLGGSYLFLRYTKALFQSS-------------SDLRLSIRDEAQ-------
R5JJI4          ----------------------------------------------MIRDDSKGGS--IS
A0A1F3D6P8      YFYIICLVILLTVAFLFNKYSSRLYEVK-------------ASIGPVQNDASSLLT----
A0A356Z058      YFYIICLVILLTVAFLFNKYSSRLYEVK-------------ASIGPVQNDASSLLT----
A0A3D1BT36      YYFISSIILLGLMAFLLNKFTPAVYEVN-------------SIIGPVENKQSSLLE----
A0A352ME00      YLYMALIVLCLAIAFFYNHFSKKVYEAS-------------ASLSPVEDKTSSLLK----
A0A3D3HL11      YFYIASFFICLLIAFLVNRFSPTVYEVN-------------SVIGPVEDRRSSMLG----
A0A3D2HF71      YWFAGALLIALS--IAYSINRWSEDVYS-------------VSSTLLIKDEQLMGGLSSG
B5CTK0          YWFLVSVILCLF--FGWYTLQKAIPTYK-------------RMATVLIKDNSSGSM---S
A0A229I3A5      RWFILSLVVTCG--IAIYYNLTTPNVYQ-------------RTASLMIKDESKAQGIGGD
A0A3R6HJB3      RWFILSLVVTCG--IAIYYNLTTPNVYQ-------------RTASLMIKDESKAQGIGSD
A0A0A2DQN2      KWFVLSVLICAG--YMYYRSAQQPYTYM-------------SEVTVIIQDPSQRTS----
A0A0A2F2N5      KWFLLSILLCTG--YMYYKSAKQAYTYE-------------SVVTVIVRDPAQRTS----
L1NGW4          YLYVICVGIVVA--FALYRTAKQPYIYE-------------ASVKVFIKDASQRSM----
Z4WRA0          YLYVICVGIVVA--FALYRTAKQPYIYE-------------ASVKVFIKDASQRSM----
U2K8K9          FLYILCVGIVVA--LALYRNARQPFTYE-------------GVVKIFIRDASQRTM----
A0A069ZM60      WLYLLSVGVVLA--VALYRNAKQPYVYE-------------SSVKIFIKDASQRAM----
J6GV98          WLYLLSVGVVLA--VALYRNAKQPYVYE-------------SSVKIFIKDASQRAM----
A0A134B4F8      WLYLLSIGVVLA--VALYRNAKQPYVYE-------------SSVKIFIKDASQRAM----
A0A134B8C7      WLYLLSIGVVLA--VALYRNAKQPYVYE-------------SSVKIFIKDASQRAM----
A0A1M6B6D5      PLFLIFLAITFS--IAYYINVRKLPVYL-------------IENLVSIRDDQNPFF----
A0A451FS66      PLFLISFLITFS--IAYYFNIRKLPIYQ-------------MENLVAIKDDQNPFF----
A0A2E3GN39      ------MLLSSGVAHIFLHFSTRIYSSK-------------GVLIHIAGEEKQSLL----
A0A3D1MEL0      ------MLLSSGIAHIFLHFSTRIYSSK-------------GVLIHIAGEEKQSLL----
F0R0C9          RWFVVSLVLTLG--IAVYYLLTTPPVYT-------------RAASLLIKEDSKGQSLSGD
A0A2A4N9A6      FCLIFAMAMFGV--WLFLRYTPPIYQAVTHIRAASNKAVELGTFVNFLEKDKNKML----
A0A368D1N7      FFLFMLLSSGIA--HIFLHFSTRIYSSK-------------GVLIHIAGEDKQNLL----
A0A3B8TU58      ----MLLSSGVA--HIFLHFATRVYDSK-------------GVIIHIGGEQKQNLL----
A0A1T5IIR6      YWFLLCVLLALG--VAYYRYSRMPFVYS-------------SGVTAIIKNPGDELR----
A0A3E0QD27      LFVILTICFTSA--FLYLRYTLPIYESR-------------GILKIGTVNTANAVL----
A0A0M1W1I6      YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
I8WPR6          YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A0K2HKS3      YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
B6W3W8          YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A1Y3Z9Z6      YWFVLSVSLFGG--YTWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A076IRY8      YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A3A6AD54      YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A3A6MIU7      YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
I8WPP8          YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A372Y7D2      YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A3E4JJC9      YWFILSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A3E4WDQ0      YWFILSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A414H9P2      YWFILSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
C3R5A8          YWFILSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
D1JY72          YWFVLSVSLFGG--YAWYQYAKLPFIYS-------------RSATVMIKDAYSNNI----
A0A1C5XJA7      KWFIMSVLIFGG--IAWYKYATAPLVYF-------------GSATVIIKDPSSKTT----
R7CUW4          KWFLISVLVCGG--LAWLSYARSPLVYF-------------RSATVIIKDPSNKTS----
D7J4K6          KWFVLSVLLFGG--MAWYHYAKSPLVFF-------------RSVTVIIKDPSNKTS----
Q8ABP9          KWFVLSVLLFGG--MAWYHYAKSPLVFF-------------RSVTVIIKDPSNKTS----
A0A174C2Q8      KWFVLSVLLFGG--MAWYHYAKSPLVFF-------------RSVTVIIKDPSNKTS----
D6D2Z5          KWFVLSVLLFGG--MAWYHYAKSPLVFF-------------RSVTVIIKDPSNKTS----
A0A1T3EDR4      YWLVLSCIFFGG--YYYYRYSKSLYVYR-------------DKEVVMIKKQSSAPI----
A0A174SDD8      KWFVLSILLFGG--CFWYIYCKTPFEYS-------------RVAIVMIKTPANSRS----
A0A1H7RFH3      KWYLLSILLFGG--CFWYIYCKTPFTYS-------------RVAIVMIKTPANSRS----
A0A412GR09      KWYLLSILLFGG--CFWYIYCKTPFTYS-------------RVAIVMIKTPANSRS----
A0A139L1N2      KWYLLSILLFGG--CFWYIYCKTPFTYS-------------RVAIVMIKTPANSRS----
A0A174TVL8      KWYLLSILLFGG--CFWYIYCKTPFTYS-------------RVAIVMIKTPANSRS----
A0A1H8BJR6      KWYLLSILLFGG--CFWYIYCKTPFTYS-------------RVAIVMIKTPANSRS----
R9H6G0          KWYLLSILLFGG--CFWYIYCKTPFTYS-------------RVAIVMIKTPANSRS----
A0A081PBV5      KWFLLSIFIFGG--YYLYQYSKTPFIYS-------------RSETIMIKTPLNTMP----
A0A1I2AN85      KWFLLSIFIFGG--YYLYQYSKTPFIYS-------------RSETIMIKTPLNTMP----
A0A1H6CKR6      RWYLLSILIFGG--YFYYQYNKTPFLYK-------------SSQTVMIKTASNTIS----
A0A235E1C0      KWFLLSILVFGG--FYYYQYSKTPFLYK-------------KEQTVMIKTATNSMS----
R6D982          KWYVLSILICGG--YFWYDYSRTPFVYS-------------RSATVMIKTPANTPS----
A0A078PL82      KWYFLSILLFGG--CFWYFYCKTPFVYS-------------RVAIVMIKTPTNSRS----
A0A078QKV9      KWYFLSILLFGG--CFWYFYCKTPFVYS-------------RVAIVMIKTPTNSRS----
A0A1F0I8C4      KWYFLSILLFGG--CFWYFYCKTPFVYS-------------RVAIVMIKTPTNSRS----
A0A3A5RIJ2      KWYFLSILLFGG--CFWYFYCKTPFVYS-------------RVAIVMIKTPTNSRS----
A0A0B8T471      YWFVLSVLLFGG--YYYYQYSKTQFLYS-------------RSQTVMIKSTTNTLS----
A0A0D5BSQ0      KWFALSVLIFGG--YYYYQYSKTPFVYN-------------RSEVVMIRTPSNTPT----
A0A1T3F6P5      KWFALSILVFGG--YYYYQYSKTPFVYN-------------SSETVIVKTPSNTPT----
A0A0W8EPA0      KWFALSILLFGG--YYYYQYSKTPFVYN-------------SSEIVIVKTPSNTPT----
A0A365UKN1      KWFALSILVFGG--YYYYQYSKTPFVYN-------------SSEIVIVKTPSNTPT----
A0A2T5RP38      KWFALSILVFGG--YYYYQYCKTPFVYS-------------RSEVVMIKNSSNTPT----
A0A1A6CF06      KWFALSILIFGG--YFYYQYSKSPFIYN-------------RSEVVMIKTPSNTPT----
A0A1T3D6S8      KWFALSILIFGG--YFYYQYSKSPFIYN-------------RSEVVMIKTPSNTPT----
A0A376E091      KWFALSILIFGG--YFYYQYSKSPFIYN-------------RSEVVMIKTPSNTPT----
A0A1P8E011      KWFALSILLFGS--YYYYQYAKSPFIYR-------------SAETIIIKTPMNTPR----
A0A1V3N3U3      KWFVLSVLCFGL--YFYYGYSKSPFIYR-------------STEMVMIKTPLNTPA----
C2FUH6          KWFALSVLLFGG--YYYYQYSRSTFMYR-------------SSEMVMIKTPMNTPS----
A0A239XXC4      KWFLLSILIFGG--YFYYQYSKTPFLYK-------------KDQTVMIKTATNSMS----
A0A2X2J8S4      PWFLLSVCIFGG--YYYYQYSKTTFSYR-------------QASTVMIKTPANTPS----
A0A3C0S618      PWFLLSVCIFGG--YYYYQYSKTTFTYR-------------QASTVMIKTPANTPS----
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
R5DEG6          -MVV--------------------------------------------------------
A0A1G1TG88      -------------------MKVT-------------------------------------
A0A3M1TXY5      --------------------------------------------L---DFGISYYLKEGL
A0A2E0VQ27      FGEE---------NEKNLPRQNENFLAEVEVFQTRDLIRKTLENL---HWELTTYRVGDV
R6U429          -------------------SSGSNVYNEMEAFSSPDLMCSVVKRL---GLETSYVEKQFL
A0A350V3E4      -ENK-------IFSDIEGELPERYINNEVEILKSFAIREKTAASL--------------L
A0A212J9Z9      -----------VAGSVPTGTLLRNTENQQIVLKSYGLTERTVKSLPA-KMRIEYYIQTRF
F5IV23          -----------VAGSVPTGTLLRNTENQQIVLKSYGLTERTVKSLPA-KMRIEYYIQTRF
F8X2T0          -----------S-GAVPLGSILRNTENQQIVLESYGLTERTVKNLPK-KMHIDYFIQTRF
A0A1M3LAG1      -----------S-GAVPLGSILRNTENQQIVLESYGLTERTVKNLSK-KMHIDYFIQTRF
A0A212K6G4      -----------S-GAVPLGSILRNTENQQIVLESYGLTERTVKNLPK-KMHIDYFIQTRF
A0A1M5DFS8      -----------AMGAVQLGSLVQNSVNQQMILNSYDMVVRTVAKLP--QMRVDYFLKTKF
A0A2V3PNY7      -----------AIGSVQLGTLVQNSINQQMLLNSYDMVVRAVAKLP--QMRVDYFKKSKF
A0A015VNG0      -------------------------------------MAEVVKRL---NLDMSYFQSGKF
A0A142HHS5      LGLG------MAMGGAENNQASQ-LAGEVELIKSGLTYKRLKQTV---PLDINYYTQGTV
A0A1M6MYT6      LGSGGANSENIFLGLGMMNSMRN-IHNQIAVLSSTPIVSRTLDEL---DFSVNYYSIGRF
A0A2P8CDS1      LTTQKDPESNVFQGFGLFQGKQN-TENQIQILKSWTQVRTTLEHF---NFEATYYKIGRF
A0A353WYK7      -----------FRSF--DEDINN-LSKEIELLKSKLFFTRVAEVI---NNDVNVFAYGKV
A0A136LSC7      -----------IKTYMEDQNVNQ-VSGEIEQIKSKIFFNQVLDSL---DFEVSYYSLGKV
A0A355BP94      -----------IKQFAEDQNRNL-VAGEIEQMKSKLFFSRVLDSL---DLGISYYSLGNV
A0A161LWY6      QQMV-------MQGVNLNMAYKN-NDNQMIMFTSNDLVERAINKI---NANVDYYTTGHF
A0A239K409      ESAA-------FSDLNTFKTSKN-FDNEIEVLKSYRLMRRVLSKL---PVNISYYVEESL
A0A1G9B1T9      -QQF-------MEGIGLFEPQTK-ISDQTAMLTSFDIIRRTLEKL---DFGVTYYKHDQF
A0A2W4RDE8      -SQF-------LKGMELFQSATD-LEDEIGIIKSFSNVESAIKRL---NFGISYYTEKNF
A0A1V5S1J9      LMQG-------FS---VERGYRN-VNNQVIMFGSYELISRVIAKQP--ELTIDYYTQGRF
A0A0A2EYC8      SMQN-------FNSGFSRQDQTN-IENQILLLQSQDLIGRTIDSLP--NFKIDFYRKLKF
A0A2G6H6Y4      TLQN-------YS---SRGSGKG-VENQIVILKSWDMVTRTIDSLP--QFKIDFFKILTF
A0A1M3DPL8      LMQG-------FG---IQESYRN-VNNQVIMISSYDLMSRVVDSLP--EFQIEYISKGRF
A0A1V5F519      FMQG-------FG---LEEAYQN-VNNQVIILNSYDLIGKVVDSLP--FMKVDYLTIGRF
A0A2G6R1T9      FMQG-------FG---VESGHKN-MANQVILLTSRDLISQVVDNLP--EMRVEYISKGKF
A0A0L8VEV2      -QLD-------LPFSNAMGGNIN-LLNHIGILTSHSINRQVLENL---DWTTSWYEELLL
A0A1I2A9Z9      -RMD-------FPLPSAFGGNIN-LQNNIGIITSYSINRQVMENL---DWSTSWYHELMF
A0A3D0FMX4      SNAL-------MQGFGVDVGYRN-VNNQVIMMGSYDLMCRVVDSLP--FMRTDYISRGRF
A0A1M3MEI8      AQVM-------MQGFGIQDAYRN-VNNQVIMLGSYDLLGRVVDSLP--ALSIDYISQGRF
A0A1J5HQM0      TQAM-------MQGFGVDAGYKN-TRNQIIMLSSYDLIGRVVDSLP--QMRVDYISKGNF
E4T131          SQAL-------MQGFGIQSGYKN-AKNQIIMLGSNDLFSKVVDSLP--FLKVDYISKGSF
F4KR18          F----------VKQNINFAAAAEDASNEIEMLTSFALMKAVVEDL---GLETRYYWKHKF
A0A350PNH9      VASM-------FSDMGISGGKSN-VNNELIAIQSPAVLLEAGKQL---KLDVNYSEDGTF
A0A354LNT9      VASM-------FSDMGISGGKSN-VNNELIAIQSPAVLLEAGKQL---KLDVNYSEDGTF
A0A389LWV6      -SDL-------TTGFAVSQGLRN-VNNQMIMYGSYDLISKSVDKL---DISTDIYHKGLL
A0A2W7RD29      LQNV-------TNSQNVL------LDNEVVIIKSNPVIKSTLEVL---DLKVGYYVPPET
A0A3N2NDY8      ISNA-------FSSLGLVSSNTN-VNNELISLSSPAVMYEVVKNL---GLDVNYSTPGRF
L1M9T3          LLAR---------RMNVESGLDAQMTNEMLSLKSVTITRAVAERL---NLDVEYTHKGMF
D7JEV9          QGQG-------FNSVMNRLDQTN-IENQILLLQSQDLIGRTIDSLP--KFRVDFYKKLQF
A0A2W7QSQ0      ENSI-------VSDLENMKSTIT-VENELEKLKSKSLLMDAVIKN---KGFINYYNAEDF
R7F6L5          SSVD-------LSEVGVMPKYAN-LENEIAIFTSPDLMENVVKAY---NLNNFYSYNDGF
C9LKL0          SSRNRGSGLNTMMDFNGVTIGDN-LSNELFILTTRRLMRKVVDSL---GLDVDYTTKNAL
A0A3D0QPV7      ---V-------IPGINSFEDEQSGVDKALELMRSEFLFKKSIEKL---DFTVSFFSEGQI
A0A3C0I8F1      -PGG-------LPIQTAPINNNAHLLGEIEFIKSELLHEEVIKKM---NLGLTIYAQGNI
R5JJI4          ESTA-------FADISFLGGKRN-VDNEVLVFQSRHLMEKVARRL---HLDMSYKVKNGL
A0A1F3D6P8      -SND-------LFMGLKALQSNRNLESGISNFISFPTVSSTISSM---NLEIGYFREKHH
A0A356Z058      -SND-------LFMGLKALQSNRNLESGISNFISFPTVSSTISSM---NLEIGYFREKHH
A0A3D1BT36      -SSD-------IFSGLGSLSQSRNLENDINSLKSFSLISETIKNL---ALEIGYFIESDD
A0A352ME00      -SNE-------LFSGIQSLESLRNIENDIKNLSSFELVYSTVNSM---NLEVSYFSESKK
A0A3D3HL11      -SND-------LFSGLGALAESRNLENDINSLNSFSLVATTIRSM---NLEVGYFAGKNT
A0A3D2HF71      TTTL-------FPGMEAFRSQQN-LKNEMGILRSFTLNYRVMQEMPDFHVDYTAVGRRGI
B5CTK0          ESAV-------FEDIATVRAERN-VSNEMLVFKSNRLMQIVARRL---HLDVNYLIEEGL
A0A229I3A5      VASM-------FSDMGMGNMKSN-VNNELIAIQSPAVLLETGKRL---KLDVDYAIDGRF
A0A3R6HJB3      VASM-------FSDMGMGNMKSN-VNNELIAIQSPAVLLETGKRL---KLDVDYAIDGRF
A0A0A2DQN2      IDFD-------FINPRQR-GRAN-IENERLILRSQRIIENALKKI---DAQVSYKYKKEF
A0A0A2F2N5      IDLD-------LVG--RR-SRVN-IENERLQLRSRVVIANAIKAI---NGHVHYGIIDGL
L1NGW4          MDAD-------VLRYMRS-FRLN-MDNEKMQMSSRRVLERAVKTV---NANVYYQVQSGL
Z4WRA0          MDAD-------VLRYMRS-FRLN-MDNEKMQMSSRRVLERAVKTV---NANVYYQVQSGL
U2K8K9          VDDN-------MLRYMRN-TRLN-VSNERIQLSSRRVMQRTVRLS---GANVFYNVKSGL
A0A069ZM60      MDTE-------MLRYARA-ARLN-MDNEHVQLVSRRVLERTVKMA---NANVFYNVKSGL
J6GV98          MDTE-------MLRYARA-ARLN-MDNEHVQLVSRRVLERTVKMA---NANVFYNVKSGL
A0A134B4F8      MDAD-------VLRYTRS-TRLN-MDNERMQLVSRRVMERTVKMA---NANVLYNVKSGL
A0A134B8C7      MDAD-------VLRYTRS-TRLN-MDNERMQLVSRRVMERTVKMA---NANVLYNVKSGL
A0A1M6B6D5      -TSN-------TSLVFNWGGTSDKVNTSVITLRSRSHNEKVVERT---QYYLTYLRDGEY
A0A451FS66      -TTT-------TSLTFNWGGTTDKVNTSVITLQSRSHNEKIVERL---QFYLTYLRDGKF
A0A2E3GN39      -GLD-------KTLPNQDFTPTD-FQQDVRVITSPIIVNKAFSQK---GLNYVFYEVGDF
A0A3D1MEL0      -GLD-------KTLPSQNFTPTD-FQQDVRVITSPIVVNTAFSQK---GLNYIFYEVGDF
F0R0C9          VGST-------FADMGLFQANTN-VNNELLSLQSPAVMLDVVKRL---HLHTDYLTDGTF
A0A2A4N9A6      --------------------LEE-LQEEIAILKSVFMIKKTLTTM---NYGVSYFAEGDL
A0A368D1N7      -GLD-------KTLPSQNFTPTD-FQQDVRVITSPIVVNKAFRQK---GLNYIFYEVGDF
A0A3B8TU58      -GFD-------RDFQKQ-FTNTD-FQQDIRVLTSPLVINNAYSDK---GLNLLFYDVGNF
A0A1T5IIR6      -TAR-------LETYDQMINKVS-VTNEQLQLRSLTIMTEVVKAL---DADVNYLDRIKF
A0A3E0QD27      -NIG-------SNQALEVLGSNQ-LAGDVELIRSRVIVSRVVGAL---PLDVSYYAHGKV
A0A0M1W1I6      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
I8WPR6          -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A0K2HKS3      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
B6W3W8          -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A1Y3Z9Z6      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A076IRY8      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A3A6AD54      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A3A6MIU7      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
I8WPP8          -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A372Y7D2      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A3E4JJC9      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A3E4WDQ0      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A414H9P2      -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
C3R5A8          -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
D1JY72          -GRG-------LDRFNTY-SYTN-VSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL
A0A1C5XJA7      -TTG-------LDRFDNFINKVN-VANEMLQFNSKRLIREVVSRT---HADVSYKMKDGL
R7CUW4          -TAG-------LDRYDNFINKVN-VANEILQFRSKKLMREVVQRV---HADVDYLIQDGL
D7J4K6          -TAG-------LDRYDNYINKVN-VANEILQFRSKRLMREVVQRL---HADVDYRVESGL
Q8ABP9          -TAG-------LDRYDNYINKVN-VANEILQFRSKRLMREVVQRL---HADVDYRVESGL
A0A174C2Q8      -TAG-------LDRYDNYINKVN-VANEILQFRSKRLMREVVQRL---HADVDYRVESGL
D6D2Z5          -TAG-------LDRYDNYINKVN-VANEILQFRSKRLMREVVQRL---HADVDYRVESGL
A0A1T3EDR4      -TSA-------FLQSAE--SPVN-IKDEMLQLQSKELLRQVIPYM---GGDKSYKISKGL
A0A174SDD8      -TMQ-------LNNSDFA-GQVN-VASEILQFKSKELMRKVIDRL---QANICYTVHEGL
A0A1H7RFH3      -TMQ-------LNNSDFT-GLVN-VASEILQFKSKELMRKVIDRL---QANISYTVYDGL
A0A412GR09      -TMQ-------LNNSDFT-GLVN-VASEILQFKSKELMRKVIDRL---QANISYTVYDGL
A0A139L1N2      -TMQ-------LNNSDFT-GLVN-VASEILQFKSKELMRKVIDRL---QANISYTVYDGL
A0A174TVL8      -TMQ-------LNNSDFT-GLVN-VASEILQFKSKELMRKVIDRL---QANISYTVYDGL
A0A1H8BJR6      -TMQ-------LNNSDFT-GLVN-VASEILQFKSKELMRKVIDRL---QANISYTVYDGL
R9H6G0          -TMQ-------LNNSDFT-GLVN-VASEILQFKSKELMRKVIDRL---QANISYTVYDGL
A0A081PBV5      -GTR-------ITRANYY-NTVN-VASEILQLRSKELMRKTIDRI---EGDISYTVKKGL
A0A1I2AN85      -GTR-------ITRANYY-NTVN-VASEILQLRSKELMRKTIDRI---EGDISYTVKKGL
A0A1H6CKR6      -SSR-------ITRPNNIYNSVN-VNSEILQLRSKELMRNTIGAL---DANISYKRQNGL
A0A235E1C0      -ASR-------ITRPNNFYNIVN-VNSEILQLRSQELMRNTISLL---NADVSYTKEEGL
R6D982          -AIR-------LIRSGDYMGQVN-MATERLQFQSKALMRKVISRL---NADVSYAVRDGL
A0A078PL82      -AMQ-------LYGSNDFMGQIN-VASEILQFKSKELMRKVIDRL---QANVSYMVYDGL
A0A078QKV9      -AMQ-------LYGSNDFMGQIN-VASEILQFKSKELMRKVIDRL---QANVSYMVYDGL
A0A1F0I8C4      -AMQ-------LYGSNDFMGQIN-VASEILQFKSKELMRKVIDRL---QANVSYMVYDGL
A0A3A5RIJ2      -AMQ-------LYGSNDFMGQIN-VASEILQFKSKELMRKVIDRL---QANVSYMVYDGL
A0A0B8T471      -VSR-------ATRLNSYYNTVN-VAGEILQLRSKELMRNTISSL---RSDVSYSVQHGL
A0A0D5BSQ0      -TAR-------ITRSSSA-NVIS-VKDEILQLKSKELMRQTIDRI---GADISYKIRKGL
A0A1T3F6P5      -TAR-------ITRSFGA-NSIS-VKDELLQLKSKELMRLVVDRI---NADKSYKVHRGL
A0A0W8EPA0      -TAR-------ITRSFGA-NSIS-VKDELLQLKSKELMRLVVDKI---EADKSYKVHKGL
A0A365UKN1      -TAR-------ITRSFGA-NTIS-VKDELLQLKSKELMRLVVDRI---NADKSYKVHRGL
A0A2T5RP38      -TAR-------ITRTNVS-SSVS-VKDEILQLRSKELMRQTIDRL---GADISYKVHRGL
A0A1A6CF06      -TAR-------ITRSFSG-GGVS-VKDEILQLKSKELMRQVVDKV---GADKSYKIHSGL
A0A1T3D6S8      -TAR-------ITRSFGG-GGVS-VKDEILQLKSKELMRQVIDKV---GADKSYKIHSGL
A0A376E091      -TAR-------ITRSFGG-GGVS-VKDEILQLKSKELMRQVIDKV---GADKSYKIHSGL
A0A1P8E011      -TAR-------ISRTNEAYNSIS-VASEILQLKSKELMRQTVTRI---GAEMSYTVGDGL
A0A1V3N3U3      -TAR-------ITNTNNAVGSVS-VTSEILQLKSKELMRETIGRI---GAETSYSIRKGL
C2FUH6          -TAR-------ITRTNSAFNSVS-VAGEILQLNSKELMRRTIDRL---NADVSYVIRNGL
A0A239XXC4      -ASR-------ITRPNNFYNMVN-VNSEILQLRSQELMRNTISLL---NADISYSRKEGL
A0A2X2J8S4      -SAT-------LTRSGMSYNTVN-LATEMLQLKSKELMRETVESI---KADVSYVVRRQL
A0A3C0S618      -SAT-------LTRSGMSYNTVN-LATEMLQLKSKELMRETVESI---KADVSYVVRRQL
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
R5DEG6          -------------VPSLYYGDKYFNTT---------------------------------
A0A1G1TG88      -------------PTQYFG-PASLAAK---------------------------------
A0A3M1TXY5      ---K---------TRQTYH-YAPFEVQ-------------LDSSHVQIVGAKFFVRPISD
A0A2E0VQ27      ---R---------LSEIYE-ERPFKID-------------YGVNDDKALDKTIYFDYLGE
R6U429          ---R---------TRDLFT-NSPLALV--------------RAGDNNASSFSFEIMKEGE
A0A350V3E4      ---D---------SFQVLKGKIPFYLL---------------------------------
A0A212J9Z9      ---K---------YISLYT-DTPIEIE---------M----IDIKPEAYNYAYEVTYIDQ
F5IV23          ---K---------YISLYT-DTPIEIE---------M----IDIKPEAYNYSYEIAYIDQ
F8X2T0          ---K---------YISLYT-DSPIEIA---------IDSLETDITPEAYSKVFDVSYVSD
A0A1M3LAG1      ---K---------YISLYT-DSPIEIV---------IDSLETDITPQAYSKVFDVAYVSD
A0A212K6G4      ---K---------YISLYT-DSPIEIA---------IDSLETDITPGAYSKVFDVAYVSD
A0A1M5DFS8      ---K---------TENLYG-VTPITIE---------AKY----VAPSAYSIVFEVEPIDS
A0A2V3PNY7      ---K---------VENWYG-VTPVTIE---------AKY----VAPSAYSIVFEIEPINS
A0A015VNG0      ---H---------RQVAYGLTLPVTVS-------------M-NDFPENESAEFILEVKPD
A0A142HHS5      ---L---------ETELFG-NCPYRVT-------------YVISDPAYYNHKFDVEYIDA
A0A1M6MYT6      ---A---------ATERYQ-DVPFMVV-------------WEEDHPQIINADFYLTIQPD
A0A2P8CDS1      ---R---------TIELYK-DVPFHIE-------------LDRSHPQLLDANFDLHFLPN
A0A353WYK7      ---L---------FEERYQ-NSPFFVE-------------Y-KIEPQYFDHPFDVDILNS
A0A136LSC7      ---L---------TDEMYK-RSPFRIK-------------ASHINPKHYDQPIYFDFLDN
A0A355BP94      ---L---------EHEMYR-RSPFKAR-------------CIGNVESFQDQPIFVDFVEG
A0A161LWY6      ---K---------VSNLYG-YAPIEIK-------------GDNISDAVSGLEFDFRDIDG
A0A239K409      ---K---------ERELYGSELPIKVV-------------AHSLDSTAYGREVTVSFNGG
A0A1G9B1T9      ---I---------QHEIYK-RRPFDVE-------------LDSLSDQLIGVPIYVRFLSS
A0A2W4RDE8      ---K---------TAEHYG-NTPFTIH-------------LDSSVHQLINVPIYIERLSS
A0A1V5S1J9      ---K---------STNLYK-AAPILIT-------------KTFVSPQAYEREFTIQDLGN
A0A0A2EYC8      ---K---------NRPMYG-RSPIDIE-------------IISTPDAGFWQYYLYQKQND
A0A2G6H6Y4      ---K---------QKALYE-NLPINVE-------------ILSTYDNSFDNYYRFEVTGE
A0A1M3DPL8      ---K---------TRNLYE-WTPISID-------------ADFISPQAYDILFKLNIKPD
A0A1V5F519      ---K---------TRNLYT-TTPIIIE-------------ADYVAPEAYELLFKISLHPN
A0A2G6R1T9      ---K---------TRNLYK-MSPIQIE-------------TNYISTEAYGVLFKIEINED
A0A0L8VEV2      ---R---------DDEMYG-NEPFEIL-------------YDRQAMNLEGIPIHIQMLDT
A0A1I2A9Z9      ---R---------NEELYK-NEPYDVL-------------FDRNAMNLEGIPVYVQMLDS
A0A3D0FMX4      ---K---------DTYLYR-YTPVVFE-------------PSEIRPEGYEHLYKLDIGTN
A0A1M3MEI8      ---K---------VRNLYG-QSPVVIH-------------TDYIAPEAYGILFKLSISED
A0A1J5HQM0      ---K---------TRNLYN-ASPIQIN-------------PDYIAPEAFNLTFKLDLNAN
E4T131          ---K---------TRNLYK-TTPIIIQ-------------TDYIAPEAYGVLFKIKLHSN
F4KR18          ---S---------EYDAYG-NFPIVVD-------------T-FKLNPSAESTFKITPLNN
A0A350PNH9      ---H---------PVALYGRTLPVTVH-------------F-YSLNDMQSANLDVEVKHG
A0A354LNT9      ---H---------PVALYGRTLPVTVH-------------F-YSLNDMQSANLDVEVKHG
A0A389LWV6      ---K---------SVSYYK-ASPILIK-------------SNFISEEAASLDFRIRGIDT
A0A2W7RD29      TSKNFWSFNKSNLPIEIYE-DAPFEIE-------------LKENDKSIEEKFFRISWVDS
A0A3N2NDY8      ---H---------EKTLYGSNLPVNVK-------------F-HDLEEQQCAGFRIELGKD
L1M9T3          ---H---------PKVIYGSELPVKTE-------------F-LNISEEQTASLSLTLMAD
D7JEV9          ---K---------NRPMYA-TSPIDID-------------IISISDISYGKYYLYQRKDN
A0A2W7QSQ0      FKTK---------IDPFQS-SIDITVD-------------SISKSFISPSESFEIQPISE
R7F6L5          ---K---------DVDIYH-QEPGIIS-------------SPDAANADASYSFKYIVKPD
C9LKL0          ---H---------RIALYD-NRPFDVS---------------FGTKTSVPANFQAEIMPG
A0A3D0QPV7      ---L---------TENKYP-AKYLRFS----------------------DLTIIDSTIFG
A0A3C0I8F1      ---L---------DNELYG-NVPFEIK------------WWATANNPWFDKRFDVQIVDP
R5JJI4          ---R---------EDELYT-HSPITVL-------------F-PESEERQVIEMTVTPVDS
A0A1F3D6P8      LFRQ---------VSELYL-RSPYVVI-------------MDKSHIQPIDVKLRVFILSD
A0A356Z058      LFRQ---------VSELYL-RSPYVVI-------------MDKSHIQPIDVKLRVFILSD
A0A3D1BT36      ILGQ---------VRQVYP-NSHYTVN-------------IDKSHIQPINARFYINIVSD
A0A352ME00      LLKQ---------TNELFG-TTPFTVS-------------IDKSHIQPIGANIYVSILDE
A0A3D3HL11      IFQK---------PTQVYL-GNPFSVI-------------IDKSHIQPINTRFRVDILDD
A0A3D2HF71      ---V---------EKRIYN-KSPFIVI-------------YDSLNKQTIGEKVNVKILSA
B5CTK0          ---H---------MKELYT-QAPISVR-------------F-FDVDEAETLSLTVLPHSE
A0A229I3A5      ---H---------KEALYGADLPVTVD-------------F-VGFTDEQSGSFKLQLKGD
A0A3R6HJB3      ---H---------KEALYGADLPVTVD-------------F-VGFTDEQSGSFKLQLKGD
A0A0A2DQN2      ---R---------MIELYK-ASPIRVS---------------FVDSLELYDSFFVSYKDE
A0A0A2F2N5      ---R---------PIELYK-SAPIQVT---------------FADSLDQYHQFEVTYKDA
L1NGW4          ---R---------TLELYT-AAPFSMR---------------FLDSLEKVATYEVRFKDA
Z4WRA0          ---R---------TLELYT-AAPFSMR---------------FLDSLEKVASYEVRFKDA
U2K8K9          ---R---------TLELYD-EAPFKVT---------------FLDTLDVANTFRVSYQDA
A0A069ZM60      ---R---------TLELYS-DAPFSMK---------------FLDTTERKSTYEVAFQDA
J6GV98          ---R---------TLELYS-DAPFSMK---------------FLDTTERKSVYEVAFQDA
A0A134B4F8      ---R---------TIELYT-DAPFSMK---------------FLDTLERGSSFDVAFQDA
A0A134B8C7      ---R---------TIELYT-DAPFSMK---------------FLDTLERGSSFDVAFQDA
A0A1M6B6D5      ---Q---------QEDAYK-QTPFFVEVDTAKSQMLNHQIK-VVFKDSLTFNLSVSFEEA
A0A451FS66      ---Q---------LIDAYK-QTPFLIRVDTTKAQVLNQQFK-VVFKDSVNFNLSVSFEEG
A0A2E3GN39      ---R---------SLEIYP-NPYFTID-------------SFYQDPKMRRVSIDYSVLIN
A0A3D1MEL0      ---R---------SLEIYP-NPYFTID-------------SFYQDPKMRRVSIDYSILIN
F0R0C9          ---Y---------KQVLYGQTLPFSIS-------------F-FGLQDNETASLTLRQGAS
A0A2A4N9A6      ---L---------TQELYK-SSNYKVD-------------FMVKDPIIYQVRFNIEILNT
A0A368D1N7      ---R---------SLEIYP-NPYFTID-------------SFYQDYKMRRVSIDYSILIN
A0A3B8TU58      ---R---------SLEIYP-NPYFSVD-------------SFYQAPELTKINIDYHMFLS
A0A1T5IIR6      ---R---------DVELYTSQSPVRMA-------------FNREKSDPGSVSVTVIPEDA
A0A3E0QD27      ---I---------DHEMYL-SSPFRIEYEIEDSAIFSIPFY-LDFESEKVFHLRYPTHEG
A0A0M1W1I6      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRIQNR
I8WPR6          ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRIQNR
A0A0K2HKS3      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
B6W3W8          ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
A0A1Y3Z9Z6      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFNLTVRILNR
A0A076IRY8      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
A0A3A6AD54      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
A0A3A6MIU7      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
I8WPP8          ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
A0A372Y7D2      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
A0A3E4JJC9      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRTLNR
A0A3E4WDQ0      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRTLNR
A0A414H9P2      ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRTLNR
C3R5A8          ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRTLNR
D1JY72          ---R---------EEELYT-QAPVKVS-------------F-PEEEDHLDFSLTVRILNR
A0A1C5XJA7      ---R---------NVELYT-KSPVAVS-------------F-ADMLPEQYVAFTVTLLNK
R7CUW4          ---R---------YNELYT-QSPVRLS-------------F-PDAMPEQGLALTVQPKSE
D7J4K6          ---R---------MNELYT-LSPVNVS-------------F-INVLPERHISFVVTPKDD
Q8ABP9          ---R---------MNELYT-LSPVNVS-------------F-INVLPERHISFVVTPKDD
A0A174C2Q8      ---R---------MNELYT-LSPVNVS-------------F-INLLPERHISFVVTPKDD
D6D2Z5          ---R---------MNELYT-LSPVNVS-------------F-INLLPERHISFVVTPKDD
A0A1T3EDR4      ---R---------DYELYT-DSPVEVI-------------L-LGETSLSGYSLKVEPLDG
A0A174SDD8      ---R---------PVELYT-ESPVRVA-------------F-LEAGTDEAHSLSVTPKSN
A0A1H7RFH3      ---R---------PVELYT-ESPVRVT-------------F-LDAGMDEAHSLSVTPKSR
A0A412GR09      ---R---------PVELYT-ESPVRVT-------------F-LDAGMDEAHSLSVTPKSR
A0A139L1N2      ---R---------PVELYT-ESPVRVT-------------F-LDAGMDEAHSLSVTPKSR
A0A174TVL8      ---R---------PVELYT-ESPVRVT-------------F-LDAGMDEAHSLSVTPKSR
A0A1H8BJR6      ---R---------PVELYT-ESPVRVT-------------F-LDAGMDEAHSLSVTPKSR
R9H6G0          ---R---------PVELYT-ESPVRVT-------------F-LDAGMDEAHSLSVTPKSR
A0A081PBV5      ---R---------EYELYK-DAPVKVQ-------------F-IDAKPEVGFSLQIEAVDQ
A0A1I2AN85      ---R---------EYELYK-DAPVKVQ-------------F-IDAKPEVGFSLQIEAVDQ
A0A1H6CKR6      ---R---------TLELYK-TSPFLVK-------------F-VDANPNMPQEFTLKSLGK
A0A235E1C0      ---R---------TIELYK-TSPFIVR-------------F-VNAPANAGFSFNLKYKGN
R6D982          ---R---------QKELYM-AAPVRVH-------------F-LVSEPEAELSLLVTPKNE
A0A078PL82      ---R---------PRELYT-EAPIRVA-------------F-MDAIPGERCFLSVIPKNQ
A0A078QKV9      ---R---------PRELYT-EAPIRVA-------------F-MDAIPGERCFLSVIPKNQ
A0A1F0I8C4      ---R---------PRELYT-EAPIRVA-------------F-MDAIPGERCFLSVIPKNQ
A0A3A5RIJ2      ---R---------PRELYT-EAPIRVA-------------F-MDAIPGERCFLSVIPKNQ
A0A0B8T471      ---R---------TVELYR-NSPFEVK-------------F-LNIKPESNFSFTLTAIDS
A0A0D5BSQ0      ---R---------DYELYK-KSPVQVK-------------V-EGKSSEDNYAFTVIPVDM
A0A1T3F6P5      ---R---------DYELYK-KSPVQVQ-------------V-EGKSSEDSYNFTVVPLDA
A0A0W8EPA0      ---R---------DYELYK-KSPVQVK-------------V-EGKSSEDSYNFTVVPVDA
A0A365UKN1      ---R---------DYELYK-KSPVQVQ-------------V-EGKSSEDSYSFTVVPVDA
A0A2T5RP38      ---R---------DYELYK-KSPVKVV-------------F-SNKSPESRYGFTIIPIDA
A0A1A6CF06      ---R---------DYELYK-KSPVQVK-------------V-EGKTQADSYGFTVTPIDT
A0A1T3D6S8      ---R---------DNELYK-KSPVQVK-------------V-EGKTHADSYGFTVTPVDT
A0A376E091      ---R---------DYELYK-KSPVQVK-------------V-EGKTHADSYGFTVTPVDT
A0A1P8E011      ---R---------RKELYT-ASPIKVI-------------V-PQTKPEDSFSFTVTPVGG
A0A1V3N3U3      ---R---------DIELYR-TSPVKVD-------------L-AGAGPTSQYNLLIIPLDA
C2FUH6          ---R---------DQELYT-QSPVKVT-------------W-MDKKPDQSFSFTLTPLDG
A0A239XXC4      ---R---------SVELYK-TSPFIVR-------------F-RNAAPQSGFSFNLKYKGN
A0A2X2J8S4      ---R---------DYELYN-ESPVLVQ-------------F-VNYNPSGSFSFTITPRDN
A0A3C0S618      ---R---------DYELYN-ESPVLVQ-------------F-VNYNPSGSFSFTITPRDN
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A3M1TXY5      TEYEI--------EADEKSAEIWNIAEDALVHELEPFVFNKRLRFGQPYTDQNLSFTLHR
A0A2E0VQ27      GRFRF-----------------FDGSPKDSAHATIV-------DQGQLIEKNGLLLTIEP
R6U429          DAFVI--------------KDWHVAGEEMEYAKIKG-------RLNDTLDTPVGKLVIAP
A0A350V3E4      ----------------------------------------------------------SA
A0A212J9Z9      EKCEI---------------SYKENPESETKISLIA-------PFDQEIDYKLFRIKLHK
F5IV23          EKCEI---------------SYKENPESETKISLIA-------PFEQEIDYKLFKIKLHK
F8X2T0          SQIRV---------------SYKDGLDGEPEEAFNV-------VFDSPVENKFFKGTIRK
A0A1M3LAG1      SQIRV---------------SYKDGLDGEPEEAFNV-------VFDSPVENKFFKGTIRK
A0A212K6G4      SQIRV---------------SYKDGLDGEPEEAFNV-------VFDSPVENKFFKGTIRK
A0A1M5DFS8      DKCRI---------------FY-PGSENTAPFSMEV-------PYNQYVQESRFYIKINK
A0A2V3PNY7      EKCRI---------------FY-EGSETTQPFSMEV-------PYDQFVQEPRFYIKITK
A0A015VNG0      RTVIL--------------SDFTRNDETLDSDEIKG-------ILLDTIATPLGKIIVEP
A0A142HHS5      KHYRLNVTVGNAKLGGNYE-------------------------FGQLVKLPGISLRLLS
A0A1M6MYT6      GKLELKIEEEDEVMVFNYKDKTVLDELDSYSYSEEA-------TPGTRISTDEFAFKILL
A0A2P8CDS1      NRVEMTIQGKKAVR-YDYRNEKELQPEKEIEETRTF-------PIDSFVASDDYAFRIIP
A0A353WYK7      KKFIL------------------RLKKGDQVIENTY-------SFGEEIVCDGFVFMLAL
A0A136LSC7      NEVSL------------------RL-KGA--VSTRG-------SMGNPVEFDGTVLTITK
A0A355BP94      NKYQL------------------WVGENG--TKQTG-------TLGEPVVVSDANFVIEL
A0A161LWY6      VTYEI-----------------------AHQKDKQLDELRYTGRYGSLLNTPYFSVVVNK
A0A239K409      KSYNL----------------------EEGGKTFKF-------EFGEVVRRPYGTFTILT
A0A1G9B1T9      NRYEISVEADEASVYQMAEEKFAPTKARDVLIQNVQ-------KVGQPVRTPYLNFTLIR
A0A2W4RDE8      SKYMVSVRGKEVPTYDVITNTVKDRVPVVDIQEVV--------DINKPFQSKNLSFSIT-
A0A1V5S1J9      NNFEI-----------------------SAPGTKQLPELKISGKYGIPIQNSSFFIQVDK
A0A0A2EYC8      NEFTI-----------------------KIFDNEDVELETVKGRYNEPVGCKYFLIKVTK
A0A2G6H6Y4      KSFNI-----------------------SVLDEHDEVLEVVDGEYGEPIGCKYFLVKVLR
A0A1M3DPL8      GTFTV-----------------------TEDEESMPKGFNINGRIGYPLQHHLMFITIND
A0A1V5F519      GTFTI-----------------------SPHNNNSMPSSPINGHIGVPLQHNLFFMTVNS
A0A2G6R1T9      GSYVI-----------------------SDDKGVIDEDLEIRGKIGVPVKSKLFVINVTK
A0A0L8VEV2      SNFQI----------EVKGKKMVYGKEVEIEFSQKG-------KFGELFSNDYFNFTLYP
A0A1I2A9Z9      TNYRI----------IVDEKTMYYGREIEIKIDQRG-------VFGEIFENDYFHFTLYP
A0A3D0FMX4      GQLTV-----------------------SIADEDTKNPMTFNTIYGQTFDCGLFSGLFMP
A0A1M3MEI8      GTFLI-----------------------TEEEENLRKGFALRGRLGKTFQHNLFFITVNM
A0A1J5HQM0      GTFTI-----------------------TVDENKQYENFKLNGNIGEPISNNLFFITINN
E4T131          GSYTI-----------------------SVDDKNLFSKFQINGRYGRPLQHNLFFLTVHN
F4KR18          YSFRF-------------------SQGSKTETQ----------RFGTLFSNQFGVFRINR
A0A350PNH9      NLFSI----------VHVSGTDKAGNQVESDEEVQG-------KLGQTVRTAMGHVCVDQ
A0A354LNT9      NLFSI----------VHVSGTDKAGNQVESDEEVQG-------KLGQTVRTAMGHVCVDQ
A0A389LWV6      TAYEI-----------------------TFDGAKNIAPFSIVGNYGTSLQHNLFFVTVDK
A0A2W7RD29      LSYSV-----RFVGDEPTTSMFNSNQDEGSGKSYVC-------KFNEWCGLPFLTLRT--
A0A3N2NDY8      GNVVL--------------SKFHLETPDGDEEIEKEVKAK---IGAGPIETPVGKVSIAA
L1M9T3          GRVLL--------------ENFVRDGQNLGGSVLS--------QVGKRCATPIGLLKLTP
D7JEV9          DYFTI--------------KVF--DNEDVELETVEG-------RYNEPVGCKYFLIKVIE
A0A2W7QSQ0      TKFLL-------------------ILDEDKQKEF---------EYGQKIKFSFGIISIQK
R7F6L5          GTVIL--------------KDFNKGGTELPDKPLSC-------KLGATVKTPVGAIAIDR
C9LKL0          GKVRL--------------FDFKLNGE-EYSDDIET-------APEQAVKTPLGVLKISK
A0A3D0QPV7      ERIDI-------------FSNSNQITLNCRNQTFTT-------ESGGLLQSPWFRARITV
A0A3C0I8F1      KHFVL---------------AFEQGRGVIKQKY----------QFNDTIHLSGMSLVLIP
R5JJI4          ATVRL--------------SDFSLSIAGEEIRSAEVVDA----RLNDTISTPVGTMVVTP
A0A1F3D6P8      TTFRL-----VIDQNTVSLYNYLDNQIVIENVPLKVDTIC---RFNETIRGKTFKFSVSF
A0A356Z058      TTFRL-----VIDQNTVSLYNYLDNQIVIENVPLKVDTIC---RFNETIRGKTFKFSVSF
A0A3D1BT36      TTYRL-----TVSEDDVSFYNYLDNKVISAGHMLNIDTVY---KFNQTIASPYFRFSVSK
A0A352ME00      SSFRL-----TASQKKVSYYNYVDNQIISEDNFFEIDTIC---KFNETISNKVVRFSVAL
A0A3D3HL11      QSYRL-----TASEDEASYYNYIDNAVVSTENRVRIDTIC---RFNETVTSYNYKFSIGF
A0A3D2HF71      KKYKI-------------------EIDGERNFSKEM-------NFGDRFNEQGFDFIIEL
B5CTK0          KEVTI--------------TDIITSSGESVNKSFYI-------PLNDTVSTPIGRILISP
A0A229I3A5      GSYVI--------------SKL--KGVTRDNLPVDDSDEITG-RIGQIIRTPLGKIKVDK
A0A3R6HJB3      GSYVI--------------SKL--KGVTRDNLPVDDSDEITG-RIGQIIRTPLGKIKVDK
A0A0A2DQN2      NQVSV--------------------S--YNEEEHIF-------LLGDTISIGKNRLIIEP
A0A0A2F2N5      SSI-V--------------------LSREGGETKQV-------QLGEEVTYEKSRLIVVP
L1NGW4          GHVSI--------------------QPQGSSKAQDV-------PLNVPVQLGPDRFIIEP
Z4WRA0          GHVSV--------------------LPQGSSKAQDV-------PLNVPVQFGPDRFIIEP
U2K8K9          SHVSI--------------------KLGKDGRTQVI-------PVGEPIRIGETRFIVEA
A0A069ZM60      GHVRV--------------------TPVHTGKSQVV-------PLNVPVQLGDERFIIEP
J6GV98          GHVRV--------------------TPVHTGKSQVV-------PLNVPVQLGDERFIIEP
A0A134B4F8      SHVRV--------------------TPASTGKSQVI-------ALNVPVQLGEERFIIEP
A0A134B8C7      SHVRV--------------------TPASTGKSQVI-------ALNVPVQLGEERFIIEP
A0A1M6B6D5      KNINL--------------QNY--NSKEKKSLFVEAGDFSKDFKIGEPVNTPFFNGIFVP
A0A451FS66      KNINL--------------QNY--TTKEKSSLFIDTDVFSKDYKLGESISTPFFSGTFIP
A0A2E3GN39      QQKDS-----VRLDYIYQGKSW--GGFLKPGKPYSDE------NIYLAISNLDQKLLEGS
A0A3D1MEL0      QQKDS-----VRLDYIYQGKSW--GGFLKPGKPYVDE------NIYLDISNLDQKLLDES
F0R0C9          GKLEL--------------SDF--TRNGEKVEGISEG------KLNDTIASPVGKLLVEP
A0A2A4N9A6      REFKLLYSIDKKYDNIYNFGTW-------IRTEFAD-------FKVSLKESD---AIITD
A0A368D1N7      QQKDSV-----RLDYIYQGKSW--GGFLKPGKPYAD-------ENIYLAISNLDQKLLEG
A0A3B8TU58      RKKDSI-----RLEYIYKGSTW--GGHLKPGKPFID-------ENIFISISNFDESLLTD
A0A1T5IIR6      GHIRL--------------Q--------TSAGSQLV-------ALGDTVALGRGKVVFLP
A0A3E0QD27      EKVKAF------------QTNV--WNK-VPGLKFRM-------TVQNWAAIQKQEINLQD
A0A0M1W1I6      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPIGKIVVSP
I8WPR6          KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPIGKIVVSP
A0A0K2HKS3      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPIGKIVVSP
B6W3W8          KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPIGKIVVSP
A0A1Y3Z9Z6      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPIGKIVVSP
A0A076IRY8      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPVGKIVVSP
A0A3A6AD54      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPVGKIVVSP
A0A3A6MIU7      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPVGKIVVSP
I8WPP8          KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPVGKIVVSP
A0A372Y7D2      KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPVGKIVVSP
A0A3E4JJC9      KQVRL--------------SDF--STD-ATGITLTA-------NLGDTIQSPVGKIVVSP
A0A3E4WDQ0      KQVRL--------------SDF--STD-ATGITLTA-------NLGDTIQSPVGKIVVSP
A0A414H9P2      KQVRL--------------SDF--STD-ATGITLTA-------NLGDTIQSPVGKIVVSP
C3R5A8          EQVRL--------------SDF--STD-ATGITLTA-------NLGDTIQSPVGKIVVSP
D1JY72          KQVRL--------------SDF--STD-ATSITLTA-------NLGDTIQSPIGKIVVSP
A0A1C5XJA7      DSVEI--------------TDF--SMA-ENGERQVV-------ELNDTISLNEGKVVVVP
R7CUW4          RSVTL--------------SRF--SWM-EADSTCTV-------AMGDTVRVHGQRLVVTP
D7J4K6          ATVTL--------------SGF--GGLPAAKDSYDV-------RLNDTLAVGGERILVTG
Q8ABP9          ATVTL--------------SGF--GGLPAAKDSYDV-------RLNDTLAVGGERILVTG
A0A174C2Q8      ATVTL--------------SGF--GGLPAAGESYEV-------RLNDTLAVGGERILVTG
D6D2Z5          ATVTL--------------SGF--GGLPAAGESYEV-------RLNDTLAVGGERILVTG
A0A1T3EDR4      GSVLI--------------REW--QSK-KLEKPFKL-------SLNKPTRLPFGELLVKG
A0A174SDD8      VQVEL--------------SDF--SRG-MEQRKV-V-------KLNDTIQTALGKLVVFA
A0A1H7RFH3      QQVEL--------------ADF--SRG-MEQRKV-V-------NLNDTIHTALGRLIVFA
A0A412GR09      QQVEL--------------ADF--SRG-MEQRKV-V-------NLNDTIHTALGRLIVFA
A0A139L1N2      QQVEL--------------ADF--SRG-MEQRKV-V-------NLNDTIHTALGRLIVFA
A0A174TVL8      QQVEL--------------ADF--SRG-MEQRKV-V-------NLNDTIHTALGRLIVFA
A0A1H8BJR6      QQVEL--------------ADF--SRG-MEQRKV-V-------NLNDTIHTALGRLIVFA
R9H6G0          QQVEL--------------ADF--SRG-MEQRKV-V-------NLNDTIHTALGRLIVFA
A0A081PBV5      DHVAL--------------SSF--SKG-NTSQVLKI-------KLNQTVRTPIGLLKVTR
A0A1I2AN85      DHVAL--------------SSF--SKG-NTSQVLKI-------KLNQTVRTPIGLLKVTR
A0A1H6CKR6      NQLEL--------------SEF--SNQEEAGKPLVV-------ALNQTVNTPIGKVIITP
A0A235E1C0      NQVEL--------------SNF--SNT-DPEKTVTV-------KLNAETKTPVGNLIISA
R6D982          RQVEL--------------SDF--SRG-AESRKT-V-------NINDTVETALGRLVVSA
A0A078PL82      QQVEL--------------AEF--SKG-TELRRV-V-------NLNDTVHTALGKLVVFA
A0A078QKV9      QQVEL--------------AEF--SKG-TELRRV-V-------NLNDTVHTALGKLVVFA
A0A1F0I8C4      QQVEL--------------AEF--SKG-TELRRV-V-------NLNDTVHTALGKLVVFA
A0A3A5RIJ2      QQVEL--------------AEF--SKG-TELRRV-V-------NLNDTVHTALGKLVVFA
A0A0B8T471      TKVRF--------------AT---VDG-DVENYTTI-------PIGKEIKTPFGNMVVDT
A0A0D5BSQ0      KHVVI--------------KNW--SNT-NKNEEFKV-------VLNQSVVTPIGKVLIKP
A0A1T3F6P5      NNVII--------------KNW--NPS-NKDKEIKI-------ALGKLTSTPIGKLLINP
A0A0W8EPA0      NNVII--------------KNW--NPA-SKDKEIKV-------ALNSLTSTPVGKVLITP
A0A365UKN1      NNVII--------------KNW--NPE-NKDKEIKV-------ALNRLTLTPVGKVLITP
A0A2T5RP38      KNVIV--------------KDW--NKN-VDGQEVKV-------VLNQLTKTPFGEIIIVP
A0A1A6CF06      RYVLL--------------KKW--NET-SE-EELKI-------ELNRWVVTPAGKVFITP
A0A1T3D6S8      RYVLL--------------KKW--NET-SD-EELKI-------ELNRWVVTPVGKVFITP
A0A376E091      RYVLL--------------KKW--NET-SD-EELKI-------ELNRWVVTPVGKVFITP
A0A1P8E011      KEVVL--------------SNW--SEG-DAALEVDA-------TLDKPVNTPFGQVIVQS
A0A1V3N3U3      QTVLL--------------SGR--IAG-KEQQEIRV-------PLNKTVNTTLGRLTVRP
C2FUH6          KYVLL--------------KKW--SNG-DRAKELKI-------ELNKESNTPVGRIVVTA
A0A239XXC4      NQVEL--------------SSF--SNS-DPDKTITV-------KLNSEVKTPVGNLIISA
A0A2X2J8S4      KSVLV--------------VEN--VGK-DKEKVYIA-------PLNKAIKTSFGGIRILA
A0A3C0S618      KSVLV--------------VEN--LGK-DKEKVYIA-------PLNKAIKTSFGGIRILA
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      -----------------------------------------------------MSVQDVL
A0A3D4CJE1      -----------------------------------------------------IAFQSAN
R5DEG6          ------------------VQVTKSPLQNVALRFQS-GLQATLASKT--ATIINLTLQDVS
A0A1G1TG88      ------------------YHFTIQDQGTVNAYLEK-NLAVDISSAD--ANTIQISFTDFN
A0A3M1TXY5      NPD-FE------VKKGQRFYFVIHGLKDLAERYQS-ALKVEAVSKE--ARLLNITSEGPV
A0A2E0VQ27      DSA-FLKLKPNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPVDKE--VSIIKVYFNHEL
R6U429          TML-----YDQWKKP---IVISWVNAKKLAKAYNK-SLSVSLSGKE--STVLVLTLTDRF
A0A350V3E4      TPE---------------NQVDPKSKNQIANVLSA-VTEISQKRG---LDIVSIKTESPS
A0A212J9Z9      TPNFRKDVKGAFKPDISTFNFRFLSEAQLIGMYSG-RIGSALQ-NN--SSILSISMSGTN
F5IV23          TPNFRNDVKGAFKPDISTFNFRFLSEGQLIGMYSG-RIGSDLQ-NN--SSILSISMSGTN
F8X2T0          TKN--------FKRDFLPFSFRFFTNSQLTGMFSG-RVSTALKTEN--STALTVSMYGTD
A0A1M3LAG1      TKN--------FKHDFLPFSFRFFTNSQLTGMYSG-RVSTALKTEN--STALTVSMYGTD
A0A212K6G4      TKN--------FKRDFLPFSFRFFTNSQLTGMYSG-RVSTALKTEN--STALTVSMYGTD
A0A1M5DFS8      TDR--------FTPNFTPFSFRFISKEELIGRYTG-RTSSGYQREG--SSALAISIYGTS
A0A2V3PNY7      SPR--------FAPNFEPFSFRFVSKEELIGRYSG-RISSGLVRDG--STALGISIFGSS
A0A015VNG0      TLN-FNEEKTCL------LHVFRNKLYDAINNYSE-NLSVTLNNEK--ASVIDLSFKDYS
A0A142HHS5      ASS--P------AELDAIYHFVIVDDNTINSYLDH-NLKAEVLNPI--ANTIQISFLDNN
A0A1M6MYT6      NEH-FN------PESDNEFKFRFHSPQELIRQYQN-QLEVALKSDE--TTILDLTLRDRN
A0A2P8CDS1      AA---D------SKLEGNYRVVFHSLDELTADYLN-RLTVAPISKE--GTIVKLSTTCEN
A0A353WYK7      SPH-YR--KDNDNVH---YFFKINSPQSNIRYLMD-NTEVKPLDFK--AKTISVTFKDFN
A0A136LSC7      TNY-FT--ENDGN-N---YYFVLNSRKSLIEYLSK-NIQVDPLNFN--ANTIRVSFRDHN
A0A355BP94      SPN-AT--PDFKN-H---FFFVMNSRNRLLDFLSS-NLRIEPINFD--ANTIRVTFRDFN
A0A161LWY6      TDN-FEPRKK--------INFAFLSNAYLIDYFTP-RISLSFVTQN--STVLAVSLVGTV
A0A239K409      SDA-FPQKSPKQKK----IIVVFENINTLAKYYSD-WLKVEPINAK--ASVLNISITDPV
A0A1G9B1T9      NEQ-----EPLDTLSQ--YSFMIHPLERVTEQYQK-KLVVAPFEEG--SDILVLTTTGEI
A0A2W4RDE8      ----FN--DAFKLEPDSKMFFRINNQVSLAERYRN-QLNIEPISKE--SNIVQLTIEQAV
A0A1V5S1J9      SAI-YRRNFN--------ICFKLLNPENLAITYSA-KLSFDFLMTG--ASVVQASISGTV
A0A0A2EYC8      NSN-YHSANS--------VNFVFRNRDNLVMEFAS-KLQIN-LLPN--TSVLNISVASDN
A0A2G6H6Y4      DER-YNEIPQ--------FYFRFRTRMSLIQEFVG-RLEVA-PIDK--TSVLNLSLASNN
A0A1M3DPL8      ISG-NNSAKD--------LYFKFRTKESLIGEFSS-KLALNFVMDG--SSVLEISMVSET
A0A1V5F519      VSD-NVKEFE--------MYFRFRTRETLIEDFKS-RLSSRYVIEG--SSILEISLISET
A0A2G6R1T9      DIE-FSNK-T--------MFFRFRTKTSLVNEFSG-LYPE--FINK--SSVLSISLQSPT
A0A0L8VEV2      KYA----------KRGNQYYFTFNNFENQVKKYMN-RLVIEEPEDK--ADLIYLSLIDQV
A0A1I2A9Z9      KNV----------KRGETYFFTFNNFEGLVRNYSG-RLMIEETEEQ--ADLIRLSMVDEV
A0A3D0FMX4      TEY-MTEKTT--------IYFRFRSQESLVADFSS-RLTLNFVAEG--SSVLTIQLVSET
A0A1M3MEI8      AEGVVHGKKE--------VYFRFRSRESLISDFSG-RLRLNFVMEG--SSVLEISLASAT
A0A1J5HQM0      TNS-YYAERE--------LYFQFRSRESLISDFAS-RLTFNFVQEG--SSVLEIAMNSET
E4T131          VNK-YMGNTE--------MYFKFRTKESLVNDFIS-RFSTSYVTEG--SSVLRINFVSDT
F4KR18          IGA-LPISSDSS------MYVSFQDTKGLARNYQH-NLSVELSDEKNHSSVLILGLRDVV
A0A350PNH9      APG-YS--AFINGHESRKLHVTRTNLYAMTNHIKA-SLSASISEEK--ATVIDLTYKDQL
A0A354LNT9      APG-YS--AFINGHESRKLHVTRTNLYAMTDHIKA-SLSASISEEK--ATVIDLTYKDQL
A0A389LWV6      TDQ-FPHTVKYE------LNFNFLSRGQQIADYNN-RLNCSFLLDG--ASVMEISLVGKV
A0A2W7RD29      --------RLLEAKNDGNFLFKIRNEESLISEFSG-NLAIYPATTG--GSILDIRLITNN
A0A3N2NDY8      NGN-YTAPKGKKNKPVTEIIVERDGMQSTVETYGG-LVKADLADKD--ADVIDLSMKDVS
L1M9T3          TNA-YR---KGMTDE---YDIKRSSISTTAAIVRS-RFDVQLSDKA--STIIDIRYSDVN
D7JEV9          NKA-FR--------DVDKVHFRFRHRQELIAEFSS-KLAIQLI-PN--TSVLNISVLSDN
A0A2W7QSQ0      KPA-----SDDFATEMGNVLVELVNPQVAAENYSR-VLEFQNPSVK--SSTLYIRLYDTS
R7F6L5          PEW-VS---DYVDKT---IHYSHVPVRPVAESIVG-GLKATYEAKE--GTLIALSYTSTS
C9LKL0          NAT-FE--EFSKGKV---ITVDYIPADLAARRYQG-EISATVQDQE--SSLIVLTCQDIN
A0A3D0QPV7      ADP-QTI-QAIQSENK--LYFVFNHPDQLLTQYFP-AINVQVLNAS--AKTLQISMRDHN
A0A3C0I8F1      KPA-IN-----ISKN---YYFIINSRYALLSYLQS-KLKVDIINHN--AGIIRISFKDHN
R5JJI4          TLY-YT--DTYYGKP---VYITKSNMEKVVEGYLR-RINISLASKT--ATIINLVLDDVS
A0A1F3D6P8      NRD-FYT-RETNMEDF--YYFSFFHLDYLTKDYLK-KLEVEPISPK--TSLIILKFRGRN
A0A356Z058      NRD-FYT-RETNMEDF--YYFSFFHLDYLTKDYLK-KLEVEPISPK--TSLIILKFRGRN
A0A3D1BT36      NQD-YLN-QRPVDEER--SFFMMNHIDIITEQYLN-RLTVESVSLK--STLINVFFQGEN
A0A352ME00      NKD-FPL-KKTEDKSR--YYFKFNHLDYLAKGYLK-QLEIEKASPL--ASIINVRFSENN
A0A3D3HL11      NKE-YYN-PKLSGETD--YYFEFYHLDQLTRTYLR-RLKVEPVSIR--SSLINVLFHGEN
A0A3D2HF71      RDK-NN--FVFDPNASNRYYFYFVSPQSLANIYRS-KLSVSPVEEE--ASLVTLTVTGTN
B5CTK0          TLY-YG--KGEFSP----LIVRKVNLKSIANSFAA-RLTIAQALAG--STMLNLSIIDSS
A0A229I3A5      APA-FT--QFVSGEDESVLYVSRSNVYAMTDRIKG-SLSASLSDVK--STVIDLTYKDVL
A0A3R6HJB3      APA-FT--QFVSGEDEPVLYVSRSNVYAMTDRIKG-SLSASLSDVK--STVIDLTYKDVL
A0A0A2DQN2      NPN-YT--SPWIARQ---IQVSRVPVPALAVAYQG-SLSIGQPEGR--ATILSLSITEAS
A0A0A2F2N5      SKG-YN--EPWPNKA---IKITRLPVKDLAASYQG-RLFIGQPENR--ATVLSLTLTDNS
L1NGW4          RSN-FN--SPWEHKT---INVIRHPLVGTARYYQN-AVAISQPQEK--SSTLMLSLQDRT
Z4WRA0          RSN-FN--SPWEHKT---INVIRHPLVGTARYYQN-AVAISQPQEK--SSTLMLSLQDRT
U2K8K9          RKT-FN--APWAYSE---IQVSRIPFVDAVRFYQH-SVAITQPEAQ--TSTLTLTLRDKT
A0A069ZM60      HQN-FN--TPWEYKH---IEVNRMPFTQTVRYYQH-AILVAEPENR--ASTLTLRLQDRT
J6GV98          HQN-FN--TPWEYKH---IEVNRMPFTQMVRYYQH-AILVAEPENR--ASTLTLRLQDRT
A0A134B4F8      RQN-FN--APWEHKH---IEVTRMPFTQTVRYYQH-AIMVAEPENR--ASTLAIRLQDRT
A0A134B8C7      RQN-FN--APWEHKH---IEVTRMPFTQTVRYYQH-AIMVAEPENR--ASTLAIRLQDRT
A0A1M6B6D5      NPD-VI---SKMGTP---YYLVFSEYDATVKRYL--DINIAPLSSG--SSVLQMRMTGHN
A0A451FS66      NEE-VI---SNPGTP---YYFIFQDYDTTVKNYL--NTKVTPESKG--SSVLRLTVIGSN
A0A2E3GN39      AES-QK--------S---ILFKVYTDEQLSNELMA-ITSIEP-NKE--TFAILVSARHPS
A0A3D1MEL0      AEN-QK--------S---ILFKVYTDEQLSNELMA-ITSIEP-NKE--TFAIQVSARHPS
F0R0C9          TPY-YN---IGFHEP---VYVSRSSLHGATGAYSS-RLSVVLSDEK--STVINLSFQDVC
A0A2A4N9A6      SKS-NI-------YY---FLINNLDEQARFKFAPA-IQTLIT-NLS--ARTMILNFRDPN
A0A368D1N7      NAE-NQ-------KS---ILFKVYTDEQLSNELMA-ITSIEP-NKE--TFAIQVSARHPS
A0A3B8TU58      EFE-GE-------KN---IFFNVYDNNRLADEMLS-NIKIEP-NKE--TFSVAITGKHPS
A0A1T5IIR6      TAR-YS--PDQYGQS---IRIQKIPVNWAAQAYIS-RLSIAH---D--KQILTLVEQDYN
A0A3E0QD27      EAY-YF---------------IINNSTTLVERYFK-NLTVVLMNQV--AQTILIKFNDNN
A0A0M1W1I6      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
I8WPR6          TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A0K2HKS3      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
B6W3W8          TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A1Y3Z9Z6      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A076IRY8      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3A6AD54      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3A6MIU7      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
I8WPP8          TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A372Y7D2      TLY-YT--DKWFNTP---ITIRRQSTDIMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3E4JJC9      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3E4WDQ0      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A414H9P2      TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
C3R5A8          TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
D1JY72          TLY-YT--DKWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A1C5XJA7      TNY-MT--ESWIGVP---VKVSKMPLDAVVSVYRN-SIAVKQEEEE--SSILTLALKDNS
R7CUW4          TNY-YA--ASWTDVP---IRVQKRPLESVVNRYKG-ALGIQQEEEE--SSILTLALKDSS
D7J4K6          TDH-WG--KSWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
Q8ABP9          TDH-WG--KSWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
A0A174C2Q8      TDH-WG--KSWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
D6D2Z5          TDH-WG--KSWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
A0A1T3EDR4      SPH-YG--TPYYGKS---IRVEKLPLERSVVYFLG-QLKIKHLGED--TSVLELSIEDSS
A0A174SDD8      AEN-YG--ESCFGKP---IVVTCKPLEEMVSFWLN-NLSIRQMSGD--AALLRIAMNDLS
A0A1H7RFH3      AEN-YG--ESSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A412GR09      AEN-YG--ESSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A139L1N2      AEN-YG--ESSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A174TVL8      AEN-YG--ESSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A1H8BJR6      AEN-YG--ESSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
R9H6G0          AEN-YG--ESSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A081PBV5      SPG-YK--VSDFDKP---VIVRKYPREAMVGYYMA-NLKIQQMEED--ASLLQVFVEDSS
A0A1I2AN85      SPG-YK--VSDFDKP---VIVRKYPREAMVGYYMA-NLKIQQMEED--ASLLQVFVEDSS
A0A1H6CKR6      NPE-SKY-RVNVSEP---IQVSKTPIDAMVGYFLS-NLEIVQM-ED--VAILQMTMEDTS
A0A235E1C0      NSD-KKF-RVNLSED---ITITKSPIESMVGYFLG-NLDIVQM-ED--VEILKMTLEDAS
R6D982          TEN-YD--SSCWGKP---VKVSKQAREKMVYFFLS-NLSIKQVNGD--VALLNIMMDDFS
A0A078PL82      AEN-YG--GDWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A078QKV9      AEN-YG--GDWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A1F0I8C4      AEN-YG--GDWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A3A5RIJ2      AEN-YG--GDWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A0B8T471      TAK-FT--SSYYGEQ---VTVSKNAMESMVGYFLS-RMRIEQMEDD--ASLLQMSLEDVS
A0A0D5BSQ0      SKF-YK--KDYYGTE---IQVTKSPRESMTGYFVG-NLVVKQMEED--TSLLQITLSDNS
A0A1T3F6P5      SRY-YK--KDYYGVE---IQVVKSPRESVMGNFVG-NLSIKQMEEE--ASLLQVTITDDS
A0A0W8EPA0      SKY-YK--KDYYGVE---IQVTKFPREAVMGNFVG-NLSIKQMEEE--ASLLQVTISDDS
A0A365UKN1      SKY-YT--KDYYEVE---IQVAKLPREAVMGSFVG-NLTINQIEEE--ASLLQLTIKDDS
A0A2T5RP38      SKY-YH--KDNYGES---ILVTKYPREEMMLGLMG-NLKVKQMEED--ASLLQVSLDDLS
A0A1A6CF06      TKF-YN--KDYYGKD---IQVTKSPREAVMGYFIA-NLKIKQMDED--TSLLQVSIEDVS
A0A1T3D6S8      TKF-YS--KDYYGKD---IQVTKLPREAVMGYFIA-NLKIKQMDED--TSLLQVSMDDVS
A0A376E091      TKF-YN--KDYYGKD---IQVTKLPREAVMGYFIA-NLKIKQMDED--TSLLQVSMDDVS
A0A1P8E011      ALK-PN--KALPQQE---VKVEKFALEGMVNYFIS-TISITQMEED--ASLLQIVAEDTN
A0A1V3N3U3      TKF-YK--AGVFGEE---IQVRKYDREDIVGYFLG-NLKITQLEED--ASLLQIVIEDQN
C2FUH6          EKQ-FT--ASTVGED---IQVTKYAHEAMVGYIMG-NLKIQQMEED--ASLLQITLEDQS
A0A239XXC4      NSD-KSY-RVNLSEQ---ITITKNPIESMVSYFLG-NLKILQ-MED--VEILQMTLEDAS
A0A2X2J8S4      TPY-YT--KAAYDQE---ISVNKLSSIDMANALLG-RLSITQTTDD--ASLLQIAMEDSN
A0A3C0S618      TPY-YT--KAAYDQE---ISVNKLSSIDMANALLG-RLSITQTTDD--ASLLQIAMEDSN
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------NINDPFLQSL--------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      --------------------------------------------MH--------------
A0A3N2LCI3      ------------------------------------KMLPMNSGVA--------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      -------MKQLISRYQKASIGEKNKVADNTIAFINANLARISSELVQVETRIEHFRKRHR
A0A2P8G5K0      PRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARISSELALVETNIEHFRKRHR
A0A3D4CJE1      ARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYYNKLKVSENKLQKFQKENK
R5DEG6          IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIESYKREHQ
A0A1G1TG88      PRKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQGFVEQTK
A0A3M1TXY5      VSMQNQFINTLLNTYIQNDLEKQREIGRKMLMLIDEQLTGVTDSLRKAEFSLRGFRAGTN
A0A2E0VQ27      PEKAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVKKRLGDAEAGLAGYRSENQ
R6U429          PSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIEKELGGVEEHLKDYKAEHN
A0A350V3E4      PQEAALISNCYAEAYADYSMKFNRGHLTLNREFLEKQVQEKYNSLLQTEDKLTNFLRTEN
A0A212J9Z9      PAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLINDSLDISRFKLERFQKETG
F5IV23          PAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLINDSLDISRFKLEKFQKETG
F8X2T0          PAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLEQFQKETG
A0A1M3LAG1      PAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLERFQKETG
A0A212K6G4      PAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVINDSLNISRLKLERFQKETG
A0A1M5DFS8      PAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLISDSLEQSEQTFKTFQDETG
A0A2V3PNY7      PAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIADSLQQSEIIFKDFQDETG
A0A015VNG0      IQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISSYKSEHL
A0A142HHS5      RFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENGQNLAKAEDNLKIFVQQNG
A0A1M6MYT6      VRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASISDSLSVSESRMEDFQSEHQ
A0A2P8CDS1      PQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVSDSLSASQKIRERFQSRNN
A0A353WYK7      KYKAQDILMAIDTLYIYYTQLEKNRVNDQKIKFLNEQLHQTESTLSELENYFENFTIDNR
A0A136LSC7      AHKAYDVVNKIDSLYIVYSNQQKNLANKQKIEWLNNELVQVEEKMEGYENYFESFTLQNK
A0A355BP94      PLKVYTVVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVENKMEGFENYFEDFTLKNK
A0A161LWY6      YQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDISDSLRTSESHLQHFRKANQ
A0A239K409      PERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLSAELIEIEKDVEQYKRQNK
A0A1G9B1T9      VEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVADSLSQVEQSLRSFRDRTR
A0A2W4RDE8      PQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVSDSLRRVEGTLESFRARSN
A0A1V5S1J9      PERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIADSLRISEGRLKDYKANNF
A0A0A2EYC8      PIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVISDSLSRSESNLNSFKIANK
A0A2G6H6Y4      PARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVSDSLSRSEAKLNSYKIEHK
A0A1M3DPL8      PRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVSKSLATSEDNLSDFRKRNQ
A0A1V5F519      PDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVSKSLSVSEDEMTRFRRDNQ
A0A2G6R1T9      PQRDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIKQTLKGSENDITEFRRSNQ
A0A0L8VEV2      PQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVIDTLQVAGNKFTSFRSQNQ
A0A1I2A9Z9      PQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVIDTLKVAGNNFTSFRSRNQ
A0A3D0FMX4      PERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIRKSLASSESAMTDFRKRNE
A0A1M3MEI8      PARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVAEELSMSEDEFTSFRRRNQ
A0A1J5HQM0      PERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVSKSLTVSQGEMTDFRQRNQ
E4T131          PDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVSKSLTTSESQMTNFRQSNK
F4KR18          PQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANISAELASAESTVESYKLNND
A0A350PNH9      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSRNL
A0A354LNT9      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISSFKSRNL
A0A389LWV6      TQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILKDSISSAESKLNAYQSQAG
A0A2W7RD29      PAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVSDTLGVIENELQNFRAANQ
A0A3N2NDY8      TQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFDFKRDHR
L1M9T3          TARAKDAIDMLISVYNENWVKDRNQISVSTNEFIKERLSVIQRELGNVDQNIAGYKSANL
D7JEV9          PLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIISDSLSRSESNLNSFKVANK
A0A2W7QSQ0      PEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVKNDLEEFEKSGENFKTRNN
R7F6L5          PYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIEQELGNVDSDISSYKARTM
C9LKL0          IARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIGSELAGVEGRLASLKESNR
A0A3D0QPV7      KAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVYTKLKNSELELQAFRQLNK
A0A3C0I8F1      AEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVDEELTKYESLLEGSLIENK
R5JJI4          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIESFKRENQ
A0A1F3D6P8      IEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQ
A0A356Z058      IEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEISDSLVISESKLRNYRSANQ
A0A3D1BT36      LDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEISESLSSSQSELRDYRSTHQ
A0A352ME00      LDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMADSLVRSESALKNYRSANQ
A0A3D3HL11      RRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEISDSLTQSESKLRDYRSANQ
A0A3D2HF71      PEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIISDSLHLAENSLESFRLANR
B5CTK0          VARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIEKELGNVDSNIETFKRQNR
A0A229I3A5      AKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISAFKSSNL
A0A3R6HJB3      AKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIERVLGDVDKNISTFKSSNL
A0A0A2DQN2      KQKATDLLGALVEAYNEEVNTLRTQISVNTTEFINNRLISLEEELESMENNREELLIENQ
A0A0A2F2N5      KQRATDLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLSEELDALASNIDSFQRANN
L1NGW4          KQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLSKELGIVENEMESFLVTNR
Z4WRA0          KQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLSKELGIVENEMESFLVTNR
U2K8K9          LKRALDILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALSRELGVVEQDMTRFSARNK
A0A069ZM60      KKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNR
J6GV98          KKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNR
A0A134B4F8      KKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNR
A0A134B8C7      KKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALGKELGLVEGDMERFLMNNR
A0A1M6B6D5      KAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKSIELSLVEDELNDFRRNNV
A0A451FS66      KAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKSAELNSVQDELNKFRNKSA
A0A2E3GN39      KSKAALTVELLMEAFMDFHLDQKMESLEQSISFLDKQIDSIKPLYDDALIAVRNAEAQKG
A0A3D1MEL0      KSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIKPLYDDALIAVRNAEAQKG
F0R0C9          IQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDENISSYKSEHL
A0A2A4N9A6      PAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIE-------IQLLNSTNKLM
A0A368D1N7      KSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIKPLYDGALIAVRNAEAQKG
A0A3B8TU58      KAKALVMVDLLIESFLNFHLYQKTESIKQSISFLDEQIDSIKPLYDEALVAVRNAEAQKG
A0A1T5IIR6      AQRAADIINMLVVKYNEAAIREKNRVAVHTEDFINERLAIIEEELGGVEGELARFKSSNK
A0A3E0QD27      AVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGIDVELRASEGSLEQFKKDNM
A0A0M1W1I6      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNND
I8WPR6          TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNND
A0A0K2HKS3      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNND
B6W3W8          TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNND
A0A1Y3Z9Z6      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNND
A0A076IRY8      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
A0A3A6AD54      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
A0A3A6MIU7      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
I8WPP8          TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
A0A372Y7D2      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
A0A3E4JJC9      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
A0A3E4WDQ0      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
A0A414H9P2      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
C3R5A8          TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIEKELGGVENELQSYKQNND
D1JY72          TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIEKELGGVENELQSYKQNND
A0A1C5XJA7      SERAEDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIGQELGDVESDLESFKRENQ
R7CUW4          PVRAEDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIERELGGVESDLESFKRSNQ
D7J4K6          PLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQ
Q8ABP9          PLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQ
A0A174C2Q8      PLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQ
D6D2Z5          PLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIERELGGVETELESFKQHNQ
A0A1T3EDR4      SKRGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVEGELSGVEQKIEDFKLSNQ
A0A174SDD8      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKKANN
A0A1H7RFH3      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A412GR09      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A139L1N2      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A174TVL8      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A1H8BJR6      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
R9H6G0          PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A081PBV5      LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQSELGSVESNLENLKVSNQ
A0A1I2AN85      LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQSELGSVESNLENLKVSNQ
A0A1H6CKR6      PMRAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIETELSGVESQIEGMKTSNQ
A0A235E1C0      PLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIEKELSSVESSLEGMKTQNQ
R6D982          PLRAGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIEDELGSVETDIEVMRKESD
A0A078PL82      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A078QKV9      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A1F0I8C4      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A3A5RIJ2      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIEHELGSVETDIEDLKRANN
A0A0B8T471      AERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIETELGGVETDLEQMKARNE
A0A0D5BSQ0      SERASDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIEAELGAVESNIENLKVANQ
A0A1T3F6P5      PERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQ
A0A0W8EPA0      PDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQ
A0A365UKN1      PERAADILTSLITVYNDVFLQDKGKIAENTANFIKDRLAIIEGELGAVESNVENLKVANQ
A0A2T5RP38      SERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIESELGAVEANIENLKIDNQ
A0A1A6CF06      SDRADDMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIEGELGAVESNIENLKIANQ
A0A1T3D6S8      SDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIEGELGAVESNIENLKIANQ
A0A376E091      SDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIEGELGAVESNIENLKIANQ
A0A1P8E011      PLRATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIEQELGSVESSIEDLRTQNQ
A0A1V3N3U3      PQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQQELGSVESNIEQLRQSNQ
C2FUH6          IKRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIESELGNVENNIEQLKTANQ
A0A239XXC4      PLRAEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIEKELSSVESSLEGMKTQNQ
A0A2X2J8S4      PQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILSEELGSVEGDLEKIKVNNN
A0A3C0S618      PQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILSEELGSVEGDLEKIKINNN
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      VI-DMAEDSRQALQNLN----TNASEEKQLAVHLKIVKLLEGHLR----AKPSAAIPSAL
A0A2P8G5K0      II-DMAEDGRQALQKSA----TNALEEKELAIRLKIVRLLEAHLL----EKPAAAIPSAL
A0A3D4CJE1      IS-GSSEFSAMYMEKLN----RLENQLIDLDLQINVLKEIQNKAK----NANDNMQVYDL
R5DEG6          LT-DISSETGMYLQTSS----QYRQEGLSLENQLSLAKYIKNYLT----DPGKN---SDL
A0A1G1TG88      TY-DVRSEVAALAAKGE----DLEEQRLKLNQNLVLLSDISRMVQQTHITRNEEETVEQS
A0A3M1TXY5      IV-DIGVTSKDLTDQLT----ELERQRAALAVAGQYYEYVLEDIQ-------ADNSLAEV
A0A2E0VQ27      LI-NSTQETDAVLRELT----QLNLQKVDLDMKTSELKRLQEYLL-------SGNSLSDF
R6U429          IT-DIQSLSAAYLGEST----EYKSMSFEVNNQLAIAKFIKEYLE-------NPAHDGAL
A0A350V3E4      VV-ELNAQANSIISSLSGIEGDYNRSLIDVQSTTRALTDIKGELD------KYDPKATDY
A0A212J9Z9      VY---DVSSQSLRIALD----SADREKDALALREKSVLLLTEKMK------EKILGTDDL
F5IV23          VY---DVSSQSLRIALD----SADREKDALALREKSVLLLTEKMK------EKILGTDDL
F8X2T0          VY---EVSSATVRRELD----VADVDRDQVAMREKTVLFTTQKIK------EGIMGSSEL
A0A1M3LAG1      VY---EVSSATVRRELD----VADVDRDQVAMREKTVLFTTQKIK------EGIMGSAEL
A0A212K6G4      VY---EVSSATVRRELD----VADVDRDQVAMREKTVLFTTQKIK------EGIMGSAEL
A0A1M5DFS8      LY---RIQGGDQRADRD----AVLQGIAENKAQEELILRLTDEIN------NSILSNTEL
A0A2V3PNY7      LY---RITKSDGRVELE----SVMKSIGEVKAQEDLILRLTDEIS------NSILNKTEL
A0A015VNG0      LP-DVQAASSMYMAQSS----QTNAQILALNNQLYMTRYIRSYLA-------NDANRTQL
A0A142HHS5      TY-DAKGELGTITNKLE----KIEEDRFKLEQKLTLLADVSQRAAAERLTPSDEVTVDQT
A0A1M6MYT6      IV-NISAQSEQLLERMR----ELDQERIAMETQNKYYHYLR-----DYINTTASRELETV
A0A2P8CDS1      LL-DVSYQSQQLLDQLV----KLEDQKSLLETQHQYYQYLE-----TYLSRNDN--LQSL
A0A353WYK7      TT-DMNVSLSRTITMLE----ELDSIKMKLNDQLDNFNEIYDKLL-------DTADLQLG
A0A136LSC7      SS-DLTLDLKKTIAAIN----VVDSQRYSLNKQLAELNTLIDQ-I-------TASDFANA
A0A355BP94      SS-DLTTELRQTIYALN----QVDSQRFSLNKRILELNGYIEE-L-------STGKLVQ-
A0A161LWY6      IL-DLNAYGSTILGHLT----SYDEKRLQYNLKESYLNYLADYIK-------KNVNNQEL
A0A239K409      LA-DVASQSKVYVEESN----TYQKQLAEWSVQIDVLETIETYIS-------NSKENSYR
A0A1G9B1T9      TV-DIGTTARDLNTKLD----ELQKTREDLLIDYRSYQNLFQYL--------EQNDYTEV
A0A2W4RDE8      VI-DIRTSAQTLTNNLD----KLETERANLEVKLKYYQYILQSLQ-------SGKNTDIV
A0A1V5S1J9      VV-A-SVGGSNLMGQYT----QLDAMQTDLRLKESYLNYLTNYLK-------SNVEEGAI
A0A0A2EYC8      MY-G-QNNSILLTNKME----ALEEQGKIIKLRDEYFKYLRNYLK-------NNIDSESL
A0A2G6H6Y4      IY-S-SDMTSVLVGQME----KLKNQGKQIKLRDEYFKYIKRYLN-------KNIQTESL
A0A1M3DPL8      LI-NVSSLTDELLSKAA----SFDEELNQIRLKETYIAYVEKYIQ-------TNLNEGAI
A0A1V5F519      II-DISSHGSELMSKAN----SLDEKKAELKLKETYLNYLTKYLT-------GNFEEGTV
A0A2G6R1T9      IV-DITTHTSEIVEKST----EYNERKSALRLKEKYLNYLADYIK-------TNLSSGNI
A0A0L8VEV2      IV-DIGQEGGIIVQRLV----DLDKERSLAQSHLDYYRNLQKYLS-------DTEKMQEV
A0A1I2A9Z9      IV-DMSQEGGIIVQRLV----DLDTERSMIQSHLDYYKNLQQYLD-------DTEKMKQV
A0A3D0FMX4      IV-DIQSYSSELLGKVN----AYDQERLAMRLKETYFEYLTNYLN-------TTMEQGTV
A0A1M3MEI8      II-DVGSFSGDLLSKAA----AYDTEINQLKLKESYLDYLVKYVK-------TNLQDGSI
A0A1J5HQM0      II-NVDTHAGELLGKSN----SYESQFSTLKLKETYLDYLTKYLR-------TNMEDGSI
E4T131          IV-DVSSHTSDLLGKAT----KYDGQQAELKLREDYLTYLTKYLK-------TNLEDGAI
F4KR18          IIAETTTDLSITLEDVN----NLVKEQRKVELQQKMLQAMKSDLQ-------DTSSKFKL
A0A350PNH9      LP-DVETAAQQYMQKSG----DVDKQILELNSRLSMARYLRDFLT-------GKVGKNQL
A0A354LNT9      LP-DVETAAQQYMQKSG----DVDKQILELNSRLSMARYLRDFLT-------GKVGKNQL
A0A389LWV6      IF-SSDNSLRSS-TELV----DLDKKKAEIRLRKEYTKFLQDNLK---------KEDGNL
A0A2W7RD29      TT-NISSEGEVIFGRLQ----SMGEELAKEKIKKEYLLSLDRYLR-------NNDFDNIV
A0A3N2NDY8      VP-NLEEAAKTQMKQSV----EMSNKMLEVTNQMSMSIYLRDYLN-------NPGNAKSV
L1M9T3          LP-DVEQSGSMAMAQAN----DAEIKARELSTQTYMTRHVREYLT-------DGRHENQV
D7JEV9          MY-G-QNNTSILTERME----SLENQGKQIRLRDEYFKYLRNYLK-------NNIDNESL
A0A2W7QSQ0      IT-DISMNSKIYLENTA----ETRKQVAEVSGKIDILESIELTMN-------NQSGQFDL
R7F6L5          SP-DLEAQAQINMARSS----ELQNQQYDLSNQIQILNYVRGELS--------REGIDET
C9LKL0          IV-DFKTAADQYSSMSV----TARQSSVDLQSQVSVARYLKDFMQ-------NNSNKHQL
A0A3D0QPV7      VQ-NFEGVSKNYLERLT----ELEGQLLKVDIDEELIIEVERALK----EYHNESDIYNV
A0A3C0I8F1      TT-DLLSKFSTSVKESE----NFGEKKAEITNLLNLLDQLEVQAQ-------NDSIITTL
R5JJI4          LT-DITSETGMYLQNTS----RYKQEGLSLENQLSIVKYIKEYLV-------DPQKGSDL
A0A1F3D6P8      VM-DLSFQGKSLYEKLE----QIETERANLQIQERYYNYIINNFK-------SSNDMSGV
A0A356Z058      VM-DLSFQGKSLYEKLE----QIETERANLQIQERYYNYIINNFK-------SSNDMSGV
A0A3D1BT36      VT-DLSYQGQQALNQME----QIDNEKATLQAQQRYYNYIIDYFN-------NNQDIAGL
A0A352ME00      VM-DLSFQGQRVYEQMT----DIDNERANLKVQERYYNYVINYFK-------MNADVSGL
A0A3D3HL11      VT-DLSYQGQQALEQMR----QIENERSMLQVQERYYNYILDYFD-------KNQDMTSL
A0A3D2HF71      LI-DLSREGVAIQNRLE----EIDKEKTSLMLQKNYYEYLKDYID-------TKKESGEI
B5CTK0          LT-DVNSEASMYLASSS----SYQQEGVGIENQLTLAKYIKSYLT-------DPSKNFNL
A0A229I3A5      LP-DVEAAAQQYMQKST----EVDKQIMDLNSRLAIAQYIRNYLT-------GKVGKNQL
A0A3R6HJB3      LP-DVEAAAQQYMQKST----EVDKQIMDLNSRLAIAQYIRNYLT-------GKVGKNQL
A0A0A2DQN2      FI-NPASLAESYMNRTQ----TNQNGRIELEAQERLIAYMQSYLK-------DASKTNEF
A0A0A2F2N5      FI-APEVVAGAYTSRAQ----TGHEASFEIDAQKRLARYFLDFIN-------NPSKRSEY
L1NGW4          TL-DFDAKMGRYNTRSV----DYEVQAMEIETQLKLVSFMLSNLS-------SPQKQTEY
Z4WRA0          TL-DFDAKMGRYNTRSV----DYEVQAMEIETQLKLVSFMLSNLS-------SPQKQTEY
U2K8K9          TI-DFTSKVESYNARSL----EEEDASIKIEKQLKLVSYMLSQLN-------SPSKRNEL
A0A069ZM60      TL-DFEGKVGVYNSRSL----ESEAEALQIETQLKLISYMLSEFS-------NSHRKNGY
J6GV98          TL-DFEGKVGVYNSRSL----ESEAEALQIETQLKLISYMLSEFS-------NSHRKNGY
A0A134B4F8      TL-DFEGKVGVYNSRSL----ESEAEALQIETQLKLISYMLSEFS-------NSHRKNGY
A0A134B8C7      TL-DFEGKVGVYNSRSL----ESEAEALQIETQLKLISYMLSEFS-------NSHRKNGY
A0A1M6B6D5      IF-DLNIEGAELNEKLN----ALDLRKEAAARELDYYNTLQEYLV-------TRSDYRDV
A0A451FS66      VY-DLATEGSELNSKLN----ALDLRKEAVNRELNYFITLQEYLT-------TRTDYRDV
A0A2E3GN39      YR-NIEALGGGLYKDIK----DLQKKLVRIEYVTSVLEWFAVMIQ----------QEEDL
A0A3D1MEL0      YR-NIEALGGGLYQDVK----ELQKKLVRIEYVTSVLEWFAVMVQ----------QEEDL
F0R0C9          LP-DVQAASNLYMAQSS----ETNAQILALNTQLSMARYIRNYLT-------AASSRNQL
A0A2A4N9A6      NI-NLDT-----------------KTIANIS---RVFQSEGKYIINDNPEFLIAQKINDL
A0A368D1N7      YR-NIEALGGGLYEDVK----ELQRKLVRIE---YVTSVLEWFAV-------MVQQEEDL
A0A3B8TU58      YR-NIEALGGGLYADVK----NLQQKLVRLD---YLISVLGWFAV-------MVEQEEDL
A0A1T5IIR6      IM-DVDYTANMYLGDSR----GYNAEIVAVETKLALSNYLKDHVV-------SGAESYRL
A0A3E0QD27      II-DPRQNASEALTHIN----KLIEQRVEMQLQLAVMNRLERDIT-------SDSEVESL
A0A0M1W1I6      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKGYLV-------DPSKETEL
I8WPR6          II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKGYLV-------DPSKETEL
A0A0K2HKS3      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKGYLV-------DPSKETEL
B6W3W8          II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKGYLV-------DPSKETEL
A0A1Y3Z9Z6      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKGYLV-------DPSKETEL
A0A076IRY8      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
A0A3A6AD54      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
A0A3A6MIU7      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
I8WPP8          II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
A0A372Y7D2      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
A0A3E4JJC9      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
A0A3E4WDQ0      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
A0A414H9P2      II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
C3R5A8          II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKSYLV-------DPSKETEL
D1JY72          II-DIGSAASMSMSDKR----QYSSTTQELELQARMARYIKGYLV-------DPSKETEL
A0A1C5XJA7      TL-DISSSASMYMGESQ----KYNSSALELETQLRLAQYIKEYLT-------DPKKEADL
R7CUW4          IV-DISSAAGMYMTESQ----KYNADALELETQLRLANFIKDYLT-------DPSKETDL
D7J4K6          VM-DIGSLAGRYMGEAQ----AYSADALEQETQLKLARFIKEYLT-------DPTKSRDL
Q8ABP9          VM-DIGSLAGRYMGEAQ----AYSADALEQETQLKLARFIKEYLT-------DPTKSRDL
A0A174C2Q8      VM-DIGSLAGRYMGEAQ----AYSADALEQETQLKLARFIKEYLT-------DPTKSRDL
D6D2Z5          VM-DIGSLAGRYMGEAQ----AYSADALEQETQLKLARFIKEYLT-------DPTKSRDL
A0A1T3EDR4      GM-DAQSLKSLSLSEQG----ENKSQGMKIDMDISLLEMLSSYLK-------DADKSKGL
A0A174SDD8      GV-DINMAAGMYIQDSR----QYESSIKELDTQLQLVTFIKQYLQ-------DSSKDDEL
A0A1H7RFH3      GV-DIDMAAGMYIQDSR----EYESSIKELDTQLQLVTFIKQYLQ-------DSSKEDEL
A0A412GR09      GV-DIDMAAGMYIQDSR----EYESSIKELDTQLQLVTFIKQYLQ-------DSSKEDEL
A0A139L1N2      GV-DIDMAAGMYIQDSR----EYESSIKELDTQLQLVTFIKQYLQ-------DSSKEDEL
A0A174TVL8      GV-DIDMAAGMYIQDSR----EYESSIKELDTQLQLVTFIKQYLQ-------DSSKEDEL
A0A1H8BJR6      GV-DIDMAAGMYIQDSR----EYESSIKELDTQLQLVTFIKQYLQ-------DSSKEDEL
R9H6G0          GV-DIDMAAGMYIQDSR----EYESSIKELDTQLQLVTFIKQYLQ-------DSSKEDEL
A0A081PBV5      GI-DVNAASQMYVSEGM----MHESAGNDVQTQLKLVEMMQNYMR-------DADKKDDL
A0A1I2AN85      GI-DVNAASQMYVSEGM----MHESAGNDVQTQLKLVEMMQNYMR-------DADKKDDL
A0A1H6CKR6      GL-DVKSAGEQYWSDSR----GYDASSKEIETQMKLVEIMRQRLD-------DPSKRDEL
A0A235E1C0      GL-DVKSAGEQYWTESR----TYQSSSKELATQMKLVEIMRQRLS-------DPSRVDDL
R6D982          WG-DINTAASMYVSDGR----KYESSLKELDTQLQLVSFIKQYLQ-------DAAKEDEL
A0A078PL82      GV-DINTVAGIYIQDSR----QYELLIKELDTQLQLVTFIRQYLQ-------DSGKEEEL
A0A078QKV9      GV-DINTVAGIYIQDSR----QYELLIKELDTQLQLVTFIRQYLQ-------DSGKEEEL
A0A1F0I8C4      GV-DINTVAGIYIQDSR----QYELLIKELDTQLQLVTFIRQYLQ-------DSGKEEEL
A0A3A5RIJ2      GV-DINTVAGIYIQDSR----QYELLIKELDTQLQLVTFIRQYLQ-------DSGKEEEL
A0A0B8T471      GM-DVNTATGVFWGESR----EYQSTTRGIETQLRLVELMRQRID-------NTESRNDL
A0A0D5BSQ0      GI-DVETAGSMYLAEKN----QYKTDRTKVETDIRLAEMMRSYLG-------SRDQKNAL
A0A1T3F6P5      GI-DVATAGGLYLNEKN----QYKTEGAKIETDIRLAEMMRSYLT-------NRGKQNNL
A0A0W8EPA0      GI-DVATAGGLYLNEKS----QYKSEGAKIETDIRLAEMMRSYLT-------NKGKQNNL
A0A365UKN1      GI-DVATAGGLYLNEKN----QYKTEGAKIETDIRLAEMMRSYLN-------NRGKQNNL
A0A2T5RP38      GL-DIETAGGMYLSESN----QYKTEKTKTETDLRLAEMMRSYLN-------NKN-RNEL
A0A1A6CF06      GI-DIATAGGMYLSESS----QYKTEGTKIETDIRLAEMMHSYLN-------NKNKRNAL
A0A1T3D6S8      GM-DVATSGNMYLSESN----QYKTEGTKIETDIRLAEMMHSYLT-------NKNKRNAL
A0A376E091      GM-DVATSGNMYLSESN----QYKTEGTKIETDIRLAEMMHSYLT-------NKNKRNAL
A0A1P8E011      GM-DASTVGTAYFEDSR----LYQSERNKVETDINLAQMMRGYLS-------DGSKKNEL
A0A1V3N3U3      GV-NIETAGEMYLNDSR----QFQSARTKIETERKLTQLMQRQLH-------DANKRNEL
C2FUH6          GV-DVNVAGEMYLSESR----QHLEERNKLETDIRLVDMMRSHLD-------NKTKRNEL
A0A239XXC4      GL-DVKSAGEQYWTESR----TYQSSSKELETQMKLVEIMRQRLS-------DPSRVDDL
A0A2X2J8S4      GM-DVAEVGGMYIEDSR----SYRLEATKIDTDLKLAEMMSDYLS-------KSDKQTAL
A0A3C0S618      GM-DVAEVGGMYIEDSR----SYRLEATKIDTDLKLAEMMSDYLS-------KSDKQTAL
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      YPQ--------EG-NFEALIGKYN--------------------EMELSRTRALA--SL-
A0A2P8G5K0      YPQ--------EG-TFEALAGKYN--------------------EMQMARIMALA--TL-
A0A3D4CJE1      LSILAGTD--YES-TINGLITNLQ--------------------RLLDKKQQLQN--EV-
R5DEG6          IPANTGIS---DV-NIESQIGEFN--------------------EMLLKRDKLIS--NS-
A0A1G1TG88      IPGLGD-I--NDP-VLSQLLGQLN--------------------GMQWDQERVRR--SY-
A0A3M1TXY5      VAPASTGI--EDP-LLTSLLVDLA--------------------RLKQERAAIRL--TA-
A0A2E0VQ27      SPNFEA-L--SDP-IFRGSYLKAQ--------------------SYEEQRQDYLQ--KY-
R6U429          IPANSG-L--TNS-TVESQIGEYN--------------------QLVLSRDRLVS--GS-
A0A350V3E4      FESKI-----TDP-YVAELQGEIA--------------------RLEIQRD-LAKTGNDE
A0A212J9Z9      MDPASMNI--RNP-KLSEFVVTYN--------------------ELLQKARNL-------
F5IV23          MDPASMNI--RNP-KLSEFVVKYN--------------------ELLQKARNL-------
F8X2T0          IDPVSIGL--TDEIKLSRYVEEYN--------------------QELRKSKNL-------
A0A1M3LAG1      IDPISIGL--TDEIKLSRYVEEYN--------------------QELRKSKNL-------
A0A212K6G4      IDPISIGL--TDEIKLSRYVEEYN--------------------QELRKSKNL-------
A0A1M5DFS8      IDPSAFGI--SDT-KLSQSVGEYN--------------------KIVKKLASM-------
A0A2V3PNY7      IDPTALGL--NEP-KLARSIGEYN--------------------NLVNKLSSM-------
A0A015VNG0      LPANSG-I--ESA-NIESQIAEYN--------------------KQLLQRNSLVA--NS-
A0A142HHS5      I-PGLALL--EDP-ALSQQLNNLN--------------------ALQQNLRRIRRSYQDR
A0A1M6MYT6      IAPSAMGI--EDP-LLNNLILQLN--------------------DLINERLSQTSIRQN-
A0A2P8CDS1      VAPTTVGI--DDP-LLVNLLQELS--------------------QLNIEKTTLSATVKD-
A0A353WYK7      NSELRM----LSS-EVAQDINRLE--------------------ELKKEMNILKG--AY-
A0A136LSC7      IRPANS----FPE-SILQRIEELH--------------------KKTRERDKLAL--AY-
A0A355BP94      VAPRNF----LPE-YLNTRIEEYL--------------------KLVRGKERLAL--SY-
A0A161LWY6      LTPSSLGI--VDP-VLTGLLTQYN--------------------------ETIRKLLQT-
A0A239K409      LVPSTLSI--EDP-TLQELISRFN--------------------ELQLERERLLR--TT-
A0A1G9B1T9      IAPSVRNI--NDE-VMSGLLRNLI--------------------ELNQQRAQLKT--SV-
A0A2W4RDE8      APSTFG-V--DDP-LLSNLLIELS--------------------KLNQERSGLNY--SA-
A0A1V5S1J9      IAPDNLGV--SDA-NLSSLVSQFT--------------------EMQLKRKEIGV-----
A0A0A2EYC8      ASPTTIGI--QEP-RLIALVDKYN--------------------ELQIKLLDLGV-----
A0A2G6H6Y4      ASPTTIGI--QEP-RLISLVDKYN--------------------ELQLQLIDLGV-----
A0A1M3DPL8      IAPSNIGL--NEP-MLMTIVQQIN--------------------DLLLKRSELTE-----
A0A1V5F519      VAPSNLGL--NEP-LLMQLVQQIN--------------------ELYLQRSELTE-----
A0A2G6R1T9      IIPTNTGL--NES-TLVVLAQQFN--------------------ELLEERNSTSR-----
A0A0L8VEV2      VAPSVVGI--VDE-SLNNLVTQLS--------------------DLYRQREVFSY--TV-
A0A1I2A9Z9      VAPSVVGI--VDD-ALNNLVVHLS--------------------DLYRQREVISY--TA-
A0A3D0FMX4      IAPSTMGL--DAQ-ALGTLVTQLN--------------------DLQIKRAELSE-----
A0A1M3MEI8      VAPTNLGL--NEP-MLMALVQQIN--------------------ELIMKRAELPE-----
A0A1J5HQM0      IAPSSLGL--NEP-MLMGLVSQIN--------------------DLNLKRSELSE-----
E4T131          VAPSSLGL--SEP-MLMKLVEQVN--------------------DLYNQRSDLTE-----
F4KR18          IPINPA-L--YDG-KIRDLIQPYN--------------------DLVMERERFLT--KG-
A0A350PNH9      LPANIG-I--DSP-GIEQQITEYN--------------------KQQLERNNLVA--NS-
A0A354LNT9      LPANIG-I--DSP-GIEQQITEYN--------------------KQQLERNNLVA--NS-
A0A389LWV6      VPPSSMGI--QDV-ELAVLVSKYN--------------------------DIFFEIKGL-
A0A2W7RD29      VPSLVG-I--TDP-TINSLIDELI--------------------NLQNEKSNQLV--TL-
A0A3N2NDY8      IPVNTG-I--GSP-TLEAQISNYN--------------------NLLLTRNTLAA--SS-
L1M9T3          LPSNSG-I--NNP-SIQAQINDYN--------------------SKLLERNRLLA--TS-
D7JEV9          ASPTTIGI--QEP-RLIALVDKYN--------------------ELQIKLLDLGV-----
A0A2W7QSQ0      IPGGLADL---DP-SLSGLLTQYN--------------------TLQRDKQRIIR--IV-
R7F6L5          LPSNMG-I--ANT-GLESQIQVYN--------------------QQVIERNRLLK--TT-
C9LKL0          IPV----LNLPDA-TFAGLVNEYN--------------------TMMIERNSTEK--NS-
A0A3D0QPV7      LSILSGTR--FES-ELSGMVKELH--------------------VLILTKEKEKF--SS-
A0A3C0I8F1      MPEVNL----PGI-DFNSLILKIN--------------------ALFSEIASISY--YK-
R5JJI4          IPANTG-I--SDN-SVESQIKEYN--------------------DMLLKRDKLVA--GS-
A0A1F3D6P8      VPPSAMNV--ADP-IMNQLITQLL--------------------LLYSQRSGIAS--NN-
A0A356Z058      VPPSAMNV--ADP-IMNQLITQLL--------------------LLYSQRSGIAS--NN-
A0A3D1BT36      APPSAANV--SDP-IMNTLVLELL--------------------DLNSQRSAILS--NN-
A0A352ME00      APPSAMNV--SDP-IINQMITNLN--------------------DLNAQRSTIIAG-SN-
A0A3D3HL11      APPSSSNV--VDP-ILSSMIMELQ--------------------QSSAERANILS--NN-
A0A3D2HF71      IAPSVMGV--TDQ-LLIRLVEELS--------------------QLQKQKKQLSL--NL-
B5CTK0          IPTNTG-ISGADV-NIESSIATYN--------------------AMLLKRDKLID--SS-
A0A229I3A5      LPTNTG-I--ESP-GIEQQITEYN--------------------KSQLERNNIVA--NS-
A0A3R6HJB3      LPSNTG-I--ESP-GIEQQITEYN--------------------KSQLERNNIVA--NS-
A0A0A2DQN2      LPLNIG-I--MSP-ALDESIGQFN--------------------QIKQERDLWMQATGA-
A0A0A2F2N5      LPQNIG-L--NNA-ALETAITAYN--------------------QVKPEYDRWLATTGG-
L1NGW4          MPLNIG-V--SDP-NLDGYIAKYN--------------------QLKGDRDRLVKASEG-
Z4WRA0          MPLNIG-V--SDP-NLDGYIAKYN--------------------QLKGDRDRLVKASEG-
U2K8K9          MPLNIA-M--PDP-ELDGYITQYN--------------------QLKFQRDKLVESSGG-
A0A069ZM60      LPLNVG-V--PDQ-ALDGYIAQYN--------------------QLKSQRDKLVEGAGG-
J6GV98          LPLNVG-V--PDQ-ALDGYIAQYN--------------------QLKSQRDKLVEGAGG-
A0A134B4F8      LPLNVG-V--PDQ-ALDGYIAQYN--------------------QLKSQRDKLVEGAGG-
A0A134B8C7      LPLNVG-V--PDQ-ALDGYIAQYN--------------------QLKSQRDKLVEGAGG-
A0A1M6B6D5      PAPSVAGI--SES-SVVAGVGKIV--------------------SLAEQRNKLQY--SF-
A0A451FS66      PAPSVAGI--SEG-SIIAGVGKIV--------------------ALAQERNKLQY--SF-
A0A2E3GN39      SLASTQ-L--SGE-EFDGITRALSVDEIL---------------KLEYEKESALM--QV-
A0A3D1MEL0      SLVSTQ-L--SGE-EFDGVTRALSVDEIL---------------NLEYEKESALM--QV-
F0R0C9          LPANSG-I--ESA-NIEQQIGEYN--------------------TMQLQRNNLVA--NS-
A0A2A4N9A6      KLEINI-I--DTV-NYY-LNNNISLENIILLPKEAYVTIIGQLRELELQKKFLAQ--HE-
A0A368D1N7      NLASTQ-L--SGE-DFDGVTRALSVDEIL---------------KLEYEKESALM--QV-
A0A3B8TU58      SLASTQ-L--SGA-DFEGIINGLSVSEIL---------------NLEAEKEKALM--QV-
A0A1T5IIR6      IPGNMG-L--EDN-SMDEVIARYN--------------------DLVLQRDRLVA--AS-
A0A3E0QD27      LPFLSGSY--SDG-VILSIVSKIH--------------------ELEDKRSNLRF--IA-
A0A0M1W1I6      IPSNTG-I--ADI-NIETQIAAYN--------------------ANKLKRDKLIE--GS-
I8WPR6          IPSNTG-I--ADI-NIETQIAAYN--------------------ANKLKRDKLIE--GS-
A0A0K2HKS3      IPSNTG-I--ADI-NIETQIAAYN--------------------ANKLKRDKLIE--GS-
B6W3W8          IPSNTG-I--ADI-NIETQIAAYN--------------------ANKLKRDKLIE--GS-
A0A1Y3Z9Z6      IPSNTG-I--ADI-NIETQIAAYN--------------------ANKLKRDKLIE--GS-
A0A076IRY8      IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
A0A3A6AD54      IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
A0A3A6MIU7      IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
I8WPP8          IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
A0A372Y7D2      IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
A0A3E4JJC9      IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
A0A3E4WDQ0      IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
A0A414H9P2      ISSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
C3R5A8          IPSNTG-I--ADI-NIETQITAYN--------------------ANKLKRDKLIE--GS-
D1JY72          IPSNTG-I--ADI-NIETQIAAYN--------------------ANKLKRDKLIE--GS-
A0A1C5XJA7      IPSNTG-I--SDM-NIENQIGMYN--------------------AAKLKRDRLIS--DS-
R7CUW4          IPSNTG-L--SDM-NIESQINLYN--------------------TAKLKRDRLIS--DS-
D7J4K6          IPSGTG-I--SDA-AVEGQINQYN--------------------ALKLKRDKLIA--DS-
Q8ABP9          IPSGTG-I--SDA-AVEGQINQYN--------------------ALKLKRDKLIA--DS-
A0A174C2Q8      IPSGTG-I--SDA-AVEGQINQYN--------------------ALKLKRDKLIA--DS-
D6D2Z5          IPSGTG-I--SDA-AVEGQINQYN--------------------ALKLKRDKLIA--DS-
A0A1T3EDR4      LPSNMG-L--SGG-NIEQQIQAYN--------------------SFFLKRNRLME--GG-
A0A174SDD8      IPSNIG-L--EDL-NIESQIARYN--------------------ETLLRRNRLMN--GS-
A0A1H7RFH3      IPSNIG-L--EDL-NIETQISRYN--------------------ETLLRRNRLMN--GS-
A0A412GR09      IPSNIG-L--EDL-NIETQISRYN--------------------ETLLRRNRLMN--GS-
A0A139L1N2      IPSNIG-L--EDL-NIETQISRYN--------------------ETLLRRNRLMN--GS-
A0A174TVL8      IPSNIG-L--EDL-NIETQISRYN--------------------ETLLRRNRLMN--GS-
A0A1H8BJR6      IPSNIG-L--EDL-NIETQISRYN--------------------ETLLRRNRLMN--GS-
R9H6G0          IPSNIG-L--EDL-NIETQISRYN--------------------ETLLRRNRLMN--GS-
A0A081PBV5      IPNNTG-L--VDV-NIENRINEYN--------------------TASLRRNRLLE--GS-
A0A1I2AN85      IPNNTG-L--VDV-NIENRINEYN--------------------TASLRRNRLLE--GS-
A0A1H6CKR6      IPSNTG-L--VDQ-SIESIITEYN--------------------TLLLRRNRLTA--GN-
A0A235E1C0      IPSNTG-L--VDN-NIEDIISEYN--------------------TLLLRRNRLMS--GN-
R6D982          IPGDIG-L--TDA-VIEGQIARYN--------------------EALLRRNRLRS--GS-
A0A078PL82      IPGNIG-L--TDI-NIESQIARYN--------------------ETLLRRNRLVS--GS-
A0A078QKV9      IPGNIG-L--TDI-NIESQIARYN--------------------ETLLRRNRLVS--GS-
A0A1F0I8C4      IPGNIG-L--TDI-NIESQIARYN--------------------ETLLRRNRLVS--GS-
A0A3A5RIJ2      IPGNIG-L--TDI-NIESQIARYN--------------------ETLLRRNRLVS--GS-
A0A0B8T471      IPSNTG-L--VED-NIEAQITEYN--------------------EVLLKRNRLVG--GD-
A0A0D5BSQ0      IPNSTG-L--VDA-NVETQITEYN--------------------TALLKRNRLAE--GG-
A0A1T3F6P5      IPNNTG-L--VDS-GVEGQIAEYN--------------------KALLKRNRLAE--GG-
A0A0W8EPA0      IPNNTG-L--VDS-GVEGQIAEYN--------------------KALLKRNRLAE--GG-
A0A365UKN1      IPNNTG-L--VDS-GVEGQIAEYN--------------------KALLKRNRLAE--GG-
A0A2T5RP38      IPNNTG-L--VDA-SVESQIAEYN--------------------MALLKRNRLAE--GG-
A0A1A6CF06      IPNNTG-L--VDT-GVESQIADYN--------------------TALLKRNRLAE--GG-
A0A1T3D6S8      IPNNTG-L--VDT-GVESQIAEYN--------------------TALLKRNRLAE--GG-
A0A376E091      IPNNTG-L--VDT-GVESQIAEYN--------------------TALLKRNRLAE--GG-
A0A1P8E011      IPNNTG-L--VDA-SVETQINDYN--------------------TTLLRRNRLIE--GS-
A0A1V3N3U3      IPNNTG-L--VDG-GVEAQITEYN--------------------RALLRKNRLVE--GS-
C2FUH6          IPSNTG-L--VEA-NIENQITDYN--------------------TTLLRRNRLVE--GS-
A0A239XXC4      IPSNTG-L--VDN-NIEGIISEYN--------------------TLLLRRNRLMS--GN-
A0A2X2J8S4      IPNNTG-L--IDG-NIEGQIQAYN--------------------TLQIRKNKLME--DG-
A0A3C0S618      IPNNTG-L--IDG-NIEGQIQAYN--------------------TLQIRKNKLME--DG-
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ----------MGK-LTELVSERAE--------------------LDFS------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A3D4RLG4      ----------KYK-ATSKICRKKN--------------------WRWSLSNAITELMTTT
A0A3N2LCI3      ----------NVD-IQSQITDYNN--------------------LVLQRNSLLAK-----
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
                                                                            

A0A1H6Z2F8      -APGHPDIRSIEKQMEVLRTNLFDAIQNQKQELA-------------------------L
A0A2P8G5K0      -APEHPQLRSLEKQIEVLRNNLLDAIGLQIQELT-------------------------V
A0A3D4CJE1      -TPDSEILKTLNLQIEAQRDLIIESLRSLLDKLL-------------------------T
R5DEG6          -SSKNPVVQDLNNSLIAMKQTIIRSVDNLIVGLN-------------------------I
A0A1G1TG88      -TGATEAVQQKNAQMDYTLSSILRQITQARKALA-------------------------N
A0A3M1TXY5      -KERSPKVQNIDAKINNVRQAILKNVNTSIRANN-------------------------I
A0A2E0VQ27      -TLQHPLILNLDQKIKETRAFLNESVNSTLENLQ-------------------------Q
R6U429          -SSENPLVLDYNNSIAALKIAINRSIENLISTLK-------------------------L
A0A350V3E4      LVKNSKSLKDINNKVAELKRSLDEKLNILKEGANSNSPEEMRSLTSKYFETKVLNNQNKI
A0A212J9Z9      -GAKNPLYNKTIDELNDLRVKILQEIQVSQINLQ-------------------------N
F5IV23          -GAKNPLYNKTIDELNDLRVKILQEIQVSQINLQ-------------------------N
F8X2T0          -GPKSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------D
A0A1M3LAG1      -GPKSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------D
A0A212K6G4      -GPKSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------D
A0A1M5DFS8      -GEAHPLYAKSEQSMNNLRIKILEDLRNAQDKVQ-------------------------E
A0A2V3PNY7      -GSAHPMYAKSEQSLTNLRINILEELRALQDRVQ-------------------------N
A0A015VNG0      -STENPLVVDMDQALASMRGAIIKSIDNQIVTLN-------------------------A
A0A142HHS5      LEAVQGPLAQLKFAQATLQHQLVQAQKQLRGQIA-------------------------L
A0A1M6MYT6      --SEHPTIVRLNAQIASVKNSLRENVDNIISQSD-------------------------M
A0A2P8CDS1      --PDHPRMRQLNIQMETTKRTLLENSRNIMHQSE-------------------------I
A0A353WYK7      -KTNTFAYRKKKEEINFLRERIIGYVEESRKGIY-------------------------D
A0A136LSC7      -NENTFAFRQKEREVSLVKDELFNQLSTLKKEWL-------------------------A
A0A355BP94      -KDNTFAYQQKDQELNAARTALFTQLAEIKKQWL-------------------------G
A0A161LWY6      -TPQNPFYAKYQEELNKLKGSLTDALRNVRAAFS-------------------------I
A0A239K409      -EKINPIILSIDQQLQSLRVNILENIHNIKGGLV-------------------------L
A0A1G9B1T9      -RQSLPAIEELDAKVKSIRAQLHENVNNLIATTK-------------------------Y
A0A2W4RDE8      -REGNPLAQVIELKITNLKASITENVSNIIDATN-------------------------I
A0A1V5S1J9      ---KSPLYAKYTRDIDAVKAQMYEALKNIRVGLD-------------------------I
A0A0A2EYC8      ---KNPQYDIVFNQISQTKAQLNELISSVSDIYK-------------------------I
A0A2G6H6Y4      ---KNPQYEIVIAQIEQIKKQLKELIASVSDVYS-------------------------I
A0A1M3DPL8      ---KNIFHSKYTREIDNLKTAINEVIKNTKASIN-------------------------I
A0A1V5F519      ---KNLYYAKYTKAIENVKTSIFELIKNMRASLE-------------------------I
A0A2G6R1T9      ---KNPVYKKLTREINNIKASINEAIKSMRKSIQ-------------------------I
A0A0L8VEV2      -QEKNPKLILVNNQIEMVKRNLQENLKNLINNAI-------------------------V
A0A1I2A9Z9      -QEKNPKLILIGNEIEMVKRNLRENLKNLINNAI-------------------------I
A0A3D0FMX4      ---KNIYYDKYTTDMQNIKVAILEVLSSMRASMD-------------------------I
A0A1M3MEI8      ---KSMFHSKYTREIETVKNAINEMVRNMQVSMD-------------------------I
A0A1J5HQM0      ---KNMYYAKYTRDIDHIKVAINEVTKNMRASLE-------------------------I
E4T131          ---ANPYYAKFTKQIETSKLTILEVIKSMRASLE-------------------------I
F4KR18          -QTSNPVVQSNNQKLKSLQSSINLAIDHMQDDLN-------------------------M
A0A350PNH9      -SEQNPLVADYDQSLASMRHSIVTSIDNFVVTLN-------------------------S
A0A354LNT9      -SEQNPLVADYDQSLASMRHSIVTSIDNFVVTLN-------------------------S
A0A389LWV6      -GSENPIYKRYKLQLTDIKSSINQSIVSMKNSIG-------------------------I
A0A2W7RD29      -TDSSPIVIEQQKRIVISKKNTLELVKSAISNID-------------------------I
A0A3N2NDY8      -SDTNPLVVDYDGQIKGLREAIVNAINGQIVALN-------------------------K
L1M9T3          -SAQNPAVMDLETQLGSIRRGIIQSLDNELDMLK-------------------------T
D7JEV9          ---KNPQYDVVISQIRQIKTQLNELINSVSDVYK-------------------------I
A0A2W7QSQ0      -QPNNPQLLSLNDQIVNVKSNILANISSIKSNLL-------------------------I
R7F6L5          -GANNPQVVEKDEALRTMKRNIQHTAATYATSLN-------------------------T
C9LKL0          -SPNSPLVKDLDSKLTTMRNTILSSVRSYVKTLE-------------------------M
A0A3D0QPV7      -TSKSTYMKSLDYQIDIQLKMINQAITSLKNQFS-------------------------K
A0A3C0I8F1      -TDNNATLKVKRTQLIKYQKELRAQINEAQRMLN-------------------------K
R5JJI4          -SNKNPIVIDLNNSLGAMKQTIIRSVDNLIVGLN-------------------------I
A0A1F3D6P8      -AEKNLFLGQIDNKIKVQKQAIIETVTNNLNTLN-------------------------L
A0A356Z058      -AEKNLFLGQIDNKIKVQKQAIIETVTNNLNTLN-------------------------L
A0A3D1BT36      -VQKSLFLEQIENKINLQKQTIIENVKNNLNTLS-------------------------L
A0A352ME00      -PQKNIFIGQIDSKIDFQKQIILENFTNNLNTLT-------------------------L
A0A3D3HL11      -AEKNLFLGQIENKIRLLKQAIIENVKNNLNTLN-------------------------L
A0A3D2HF71      -LESTGPLRVLEGNIANTRIAISNNIADGLANIE-------------------------K
B5CTK0          -SDKNPVVVNLNNSLSALKQTIIRSIDNTIVALN-------------------------V
A0A229I3A5      -SEQNPLVADYDQSLTSMRKSISASLDNFVVTLK-------------------------T
A0A3R6HJB3      -SEQNPLVADYDQSLTSMRKSISASLDNFVVTLK-------------------------T
A0A0A2DQN2      -SQDNPIVERYNQSMHVARAAVARALKDAAAAIS-------------------------I
A0A0A2F2N5      -MEDHPMVQKYAKAMEQTRMSISHTLEGYIKSLD-------------------------L
L1NGW4          -STENPVIAEYDRGLAQIRQNAISSLNQYANVLR-------------------------V
Z4WRA0          -STENPVIAEYDRGLAQIRQNAISSLNQYANVLR-------------------------V
U2K8K9          -STQNPVIAEYDATLDQLRKSATEILNQQASALR-------------------------A
A0A069ZM60      -STENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------M
J6GV98          -STENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------M
A0A134B4F8      -STENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------M
A0A134B8C7      -STENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------M
A0A1M6B6D5      -KEDAPVFNDIDRQIDAVKIVLLENIRSSKSLMN-------------------------E
A0A451FS66      -KEGAPVFNDIDRQINAVKSVLLENIRSSRSLKA-------------------------D
A0A2E3GN39      -TPEHPTVVLIERNLDKARATLIAQVEINIDKFQ-------------------------Q
A0A3D1MEL0      -TPEHPTVVLIERNLDKARATLIAQVEINIDKNQ-------------------------Q
F0R0C9          -SEQNPLVKDLDQSLASMRRAIITSVDNLMVTLD-------------------------T
A0A2A4N9A6      -TELGPNTKLINGQIKANKKILLYSIK-AIRATL-------------------------F
A0A368D1N7      -TPEHPTVVLIERNLDKARATLIAQVEINIDKNQ-------------------------Q
A0A3B8TU58      -TPEHPAIVLIERNLDKARVTLVAQVRINIERYQ-------------------------Q
A0A1T5IIR6      -STTSPAVLKLENTLGSLRSNILGMISNLQTSLE-------------------------I
A0A3E0QD27      -TDKNAAVISLEQDIDFQKKNLVMSIQNARLSIR-------------------------E
A0A0M1W1I6      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
I8WPR6          -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A0K2HKS3      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
B6W3W8          -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A1Y3Z9Z6      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A076IRY8      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A3A6AD54      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A3A6MIU7      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
I8WPP8          -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A372Y7D2      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A3E4JJC9      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A3E4WDQ0      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A414H9P2      -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
C3R5A8          -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
D1JY72          -SDKNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------V
A0A1C5XJA7      -SDKNPVVEELNSSLRAMKQSIIRAVDNMIVSIN-------------------------V
R7CUW4          -SEKNPVVEELNNSLRAMKQTIIRAVDNMIVSLN-------------------------V
D7J4K6          -SESNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------M
Q8ABP9          -SESNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------M
A0A174C2Q8      -SESNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------M
D6D2Z5          -SESNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------M
A0A1T3EDR4      -NNKNPVVRDLDASLVSLRQEIQRSLDHSIRGLV-------------------------Q
A0A174SDD8      -SSNNPVVQELNRTMQTMKQNIYRALDNLSTTLR-------------------------L
A0A1H7RFH3      -SSNNPVVQELNRTTQTMKLNIYRALDNLSASLR-------------------------L
A0A412GR09      -SSNNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------L
A0A139L1N2      -SSNNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------L
A0A174TVL8      -SSNNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------L
A0A1H8BJR6      -SSNNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------L
R9H6G0          -SSNNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------L
A0A081PBV5      -SSENPIVQDLNITLAAMRKNIYRAMENAVSGLQ-------------------------I
A0A1I2AN85      -SSENPIVQDLNITLAAMRKNIYRAMENAVSGLQ-------------------------I
A0A1H6CKR6      -SSENPIVQDLNTALNALRDNISRAVDNVLTGYR-------------------------I
A0A235E1C0      -SSENPIVQDLNNALSQVRQNIARAIDNVISGFR-------------------------I
R6D982          -GGNHPVVQELTRSVETMRQNINRSINNQVTSLK-------------------------L
A0A078PL82      -SSNNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------Q
A0A078QKV9      -SSNNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------Q
A0A1F0I8C4      -SSNNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------Q
A0A3A5RIJ2      -SSNNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------Q
A0A0B8T471      -NSANPIVKDMDAALRAIRDNISRSVDNAAMGLR-------------------------I
A0A0D5BSQ0      -NTSNPVVLDLDEALKAMRNNIGRAVDNTLRGLN-------------------------V
A0A1T3F6P5      -NTANPVVLDLDDALAAMRTNIGRAVDNALRGLN-------------------------I
A0A0W8EPA0      -NSSNPVVLDLDDALGAMRTNISRAVDNAVRGLN-------------------------I
A0A365UKN1      -NSSNPVVLDLDDALAAMRTNISRAVDNALRGLN-------------------------V
A0A2T5RP38      -NTLNPVVVDLDEALKSMRNNINRAVDNALRGLT-------------------------I
A0A1A6CF06      -NSANPVVLDMDEALNSMRNNISRAVDNALKGLN-------------------------I
A0A1T3D6S8      -NSANPVVLDMDESLNAMRNNISRAVDNALKGLN-------------------------I
A0A376E091      -NSANPVVLDMDESLNAMRNNISRAVDNALKGLN-------------------------I
A0A1P8E011      -SDANPVVQDLDRALQAMRGNIGRAVDNAIGGLK-------------------------I
A0A1V3N3U3      -STANPVVQDLDKALAAMHENISSAVDNAVAGLD-------------------------L
C2FUH6          -STENPIVQDLDKALGAMRGNIDRAVENATEGLR-------------------------V
A0A239XXC4      -SSENPIVQDLNNALSQVRQNIARAIDNVISGFR-------------------------I
A0A2X2J8S4      -NSENPIVKEIDKSLNTMRSGIERTLGNTISGLQ-------------------------V
A0A3C0S618      -NSENPIVKEIDKSLNTMRSGIERTLGNTISGLQ-------------------------V
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      VTADNPNIDRINLEISRVKSSLLENINNRVSSTE-------------------------F
A0A2T2UAJ4      GGKGVGYVAEQRRGLAQSRIEL--------NGLQ-------------------------A
A0A3D4RLG4      XTQKNVYYAKYTKDIENVKTAINEVVGSMRASLE-------------------------I
A0A3N2LCI3      SSDKNPLVVQLNEQMDQMRHAILASVDNSINALN-------------------------M
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      --------------MKNTNAAISENIETIRQQLI-------------------------S
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      -----------------------------------------------------------N
                                                                            

A0A1H6Z2F8      SISAIHAYGKGFEAEISRLPGHQR--ALLSQSREQGIQQELYLFLLKKRMETAISRSANI
A0A2P8G5K0      NAAAIRKYGKESEAEISKLPAHQR--AFLAQSREQGIQQELYLFLLKKRVETAISRSANI
A0A3D4CJE1      QRNEVAQKIKEFEQKFYNIPAKEL--EYARLERMFSIDEKFFTLLLEKRTEYSISEAGFV
R5DEG6          KIKNIRAQEEQTSRRISAVPTQQK--EVLSVERRQKIKEELYLYLLNKREENELTQRMTE
A0A1G1TG88      RIALLDRQQNKLDAKQQGLPSRAT--EQARLQRPLALAEGTYTMLMGKKVDYNIQKAGTT
A0A3M1TXY5      AISNVNERIEALRTRLRRLPESER--ILTNIKRNFDHSSEVHKYLLQKRAETAIALATDI
A0A2E0VQ27      KTLELESQIAEVNQKVERFPEKER--QLVVLQRQVALNEALYNYLMRKYTELSIMQQSDL
R6U429          QADKVAAEETNIMNKISNTSGQEL--QLLSIERQQKIKEELYIYLLQKREENEIASLVNV
A0A350V3E4      KESLLRGYLNKYQEKFNKLPAQSI--EYANLERERLANEKVYLMLLEKYQEALINEESQP
A0A212J9Z9      QKDALVRKYEVLQLKIDNLPPQER--DLIKFQREFRVNEMYHQYLTQRQYEAKIQKASNT
F5IV23          QKDALVRKYEVLQLKIDNLPPQER--DLIKFQREFRVNEMYHQYLTQRQYEAKIQKASNT
F8X2T0          QKDLLVKKYQNLDLKLDNLPPQER--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT
A0A1M3LAG1      QKDLLVKKYQNLDLKLDNLPPQER--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT
A0A212K6G4      QKDLLVKKYQNLDLKLDNLPPQER--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT
A0A1M5DFS8      KKENLNSRLASVESEMSTLPAQER--EYARYEKRYQVNDAYYTYLRNKRYEATIQKASNI
A0A2V3PNY7      KKESLDNNTKEIEDKMATLPAQER--EYIRYEKRYQVNDAYYTYLRQRRYEATIQKASNI
A0A015VNG0      QIKSLQQTEQQTTSRIAANPTQAK--YLLSVERQQKVKEALYLFLLQKREENELSQAFTA
A0A142HHS5      ----LDTQQGKLSNELQLIPGKET--ELERLKRPLGLYGNSYQMLLEKKVEYNIKNAGTT
A0A1M6MYT6      ALENLNQRIRQFEAQVRRLPATER--NYVNIERKYKLNNETYIFLMQKLSEAQIAKASNI
A0A2P8CDS1      TLNDLTKRIDNLQQRTRNLPSVER--NYVNIERRYQLNNDTYTFLLQKLSEAQIAKASNM
A0A353WYK7      KLDEINLKKNRLETDFSSLPSKST--EYAKTERYYDLYEEFYLSLMKNKAQFELAQAGTV
A0A136LSC7      DMAELGKRKEKLERAFAEMPDKNT--QFSKNQRYYKLYEEFYLTMMQSKAEFEIAQAGST
A0A355BP94      AMLELNQKKESLEKKFASMPDKST--QYSKNQRFYKLYEEFYLSMMQAKAEFEIAQAGST
A0A161LWY6      EKKDIDTQSRKASGQLATLPDIET--QMNSFERQFKMNDTYYTYLLQKRAEAQIQRASNV
A0A239K409      TRRNLKDRTNLYDAKINSVPLVER--ELQEIDRQRGIKQQLYKYLLEKREESSLALATSA
A0A1G9B1T9      KIESVENQIEELDSQINLLPKNEQ--ELINIERKFQFSDNQYNYLLQKRTEVGIAVASNA
A0A2W4RDE8      ALNDLNQRIARLNAQLERLPRNER--ELVKIQRRYDFSDNVYNYLLEKRAEAGIAIASNV
A0A1V5S1J9      QKADMQNRLQKLSAGMQELPYKEQ--QLLNIQRKFKINDDYYTFLVQKRADAQIQKASNS
A0A0A2EYC8      ESDAYQKDLNELNNLLIAAPNKEL--RMLDYERRYKINDSYYTFLLQKRSEAQIRKASNS
A0A2G6H6Y4      ETDLYKKDLNTLKSELVEAPSKEL--RMLDYQRRFRINDEYYTYLLQKRAAAEILKASNT
A0A1M3DPL8      QKDDLNTRLASVQKQIETLPEQEL--EMVGIERNYRMNDSYYTMFLQKRAEAQILKASNT
A0A1V5F519      EKNEVNRLLADVNSQIAELPKKEL--EIIGIERNYKVNDNYYTFFLQKRAEAEIQKASNT
A0A2G6R1T9      EKQDIDSKIAAVRSKMNMLPKKET--QMTALTRQYKIDDNYYNFFISKKAEAQIQKAANS
A0A0L8VEV2      QIQGLDRRVDQVNRQLSAHPKTEQ--QMMNMQRMYDLNNELYTFLLKKRAEAAITHASNV
A0A1I2A9Z9      QVQGLDRRIEKVNQQLTAYPKTEQ--QLMNMKRMYDLNNELYTFLLKKRAEAAITHASNV
A0A3D0FMX4      EKKDLELRFSEVRAGINALPEKEL--EMVALERNYRIDDNYYTFFLQKRAESEIQKASNT
A0A1M3MEI8      QKKDLNRRYAEVQQEINQLPAKEL--EMIGIERRYKMNDSYYTLFLQKRAEAEILKASNT
A0A1J5HQM0      EKNDLKEKNDKVNKEIEQLPSKEI--EMTSIARKYKMDDNYYTFFLQKRAESEILKSSNT
E4T131          EKSDFNKRLSVVNKQIEELPEKEL--EQIAIQRKYKMDDNYYTFFLQKRAESEILKASNT
F4KR18          QQNKLKYHYDQSSNHLRSVPSKER--GLSDRVRIQSIKENLYVYLLQKREETALALVSNY
A0A350PNH9      QLGNLQANEAQTTSQIASNPSQAK--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA
A0A354LNT9      QLGNLQANEAQTTSQIASNPSQAK--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA
A0A389LWV6      EEADLNQRYSKLSAEVASLPDKER--KLLTHERDFKINDSYNTYLLQRRIESQIQLASNM
A0A2W7RD29      SIDDLNYRISEISKDFRKLPFTEQ--NLIKIEREFTLNEGIYNFLLQKRAEAAISKASNI
A0A3N2NDY8      SLRNMEGAKGAAESQLASGSTQAK--YLLSVERQQKVKESLYLYLLQKREENELTQKFTA
L1M9T3          QQRATEASHSEATSRISANPRQAS--YLLSVERQQKVKESLYIFLLQKREENELSQAFTA
D7JEV9          EKSSYQSDLSALNKLLVEAPNKEL--RMLDYERRYKINDSYYTFLLQKRSEAQIRKASNS
A0A2W7QSQ0      SKRNFETTLNENSYKAQSIPGIER--ELVEISRNTDLKQEQYQYLLRKRDEAVLTLEVTG
R7F6L5          RLSGVRSQESVTNSRLATAPRQAN--YLLSVERQQKVKESLYLFLLQKREENELAQAFKS
C9LKL0          RAKSARSNESVINGEVSRAPGLER--RALSIGRQQNLKEALYTYLMNKREEVALQLAVND
A0A3D0QPV7      RKGSLKDKIRQYETIYYGLPEKEI--EHARMERMFAINEKYHTMLLEKKTEYEISLAGQT
A0A3C0I8F1      EIGALQSKFSRAQGEFLKIPSKET--ELKRIKRLHTIYEAFYSQMLNKKAEIGISRSAIV
R5JJI4          QLKNIREQEEQTTKRIEAVPTQQK--YVLTVERQQKIKEELYLYLLNKREENALTQAITE
A0A1F3D6P8      SLNELNYRADKLSREISQLPRTEL--NMVGLQRKFDLSDVIYTYLLQKRSEAAITMASNY
A0A356Z058      SLNELNYRADKLSREISQLPRTEL--NMVGLQRKFDLSDVIYTYLLQKRSEAAITMASNY
A0A3D1BT36      TLNELDYRAEKLSSQIARLPRTEL--NMVSMQRQYNITDAIYTFMLQKRSEAGIAMASNH
A0A352ME00      SLNELDYRQNKLSKEASSLPRTEM--NMVSMKRKFDLNDEIYTFLLQKRSEAQISLASTR
A0A3D3HL11      TQNELDYRESKLSGEISRLPRTEL--NMVSMQRQFNLTDQIYTFLLEKKAEAAIAMASNY
A0A3D2HF71      SISEADKRLNEVEREIMKLPSTER--QMINIQRKFDINNTVYTFLLEKRAEAGIARASTV
B5CTK0          KLKNLQAQEARTASRIAAVPTHQK--YILSVERQQKIKEELYLYLLNKREENALAQSITE
A0A229I3A5      QLGTLQANEAATTSQIASNPNQAK--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA
A0A3R6HJB3      QLGTLQANEAATTSQIASNPNQAK--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA
A0A0A2DQN2      KLKEMRYQDNQAYAELVTLPPKER--QWLDAERQYKMKEALYTQLLSKREENLFAQTITN
A0A0A2F2N5      QLREIEIRNRQGLAEMMAVPNKQR--QWLDIERQQRMKEALYTQLLSKREENTLAQTAQS
L1NGW4          RLKDAQGTQSSLLSQLPDVSNKGR--EKAEIDRKIAIRERLYTELLNKREEYALMQAMTQ
Z4WRA0          RLKDAQGTQSSLLSQLPDVSNKGR--EKAEIDRKIAIRERLYTELLNKREEYALMQAMTQ
U2K8K9          RLKSVERDQSALFSKLPGVTEEGR--TKADIDRRLAIQEGLYTELLSKREEYALRQSMTQ
A0A069ZM60      RLKDIQGQQSSLLSKLPEVSNQGR--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ
J6GV98          RLKDTQGQQSSLLSKLPEVSNQGR--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ
A0A134B4F8      RLKDAQGQQSSLLSKLPEVSNQGR--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ
A0A134B8C7      RLKDAQGQQSSLLSKLPEVSNQGR--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ
A0A1M6B6D5      EIRTINRDIGRYEAEIRKLPKEQQ--ELLKIERRYNLSEGTYNMFLAKRSEAGLVKAANV
A0A451FS66      EINSINQDIGRYESEIRKLPKEQQ--DLLNIERRYNLSEGTYNLFLAKRSEAGLVKAANV
A0A2E3GN39      EKDAVVAEINKLLEELDLLPLFEA--EYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIV
A0A3D1MEL0      ERDAVVAEINKMLEELDLLPLFEA--EYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIV
F0R0C9          RIRSLQRSEQQTTERLAANPSQAK--YLLSVERQQKVKEALYLFLLQKREENELSQAFTA
A0A2A4N9A6      AQLALIDKAVRQKQKLDSEVNFDAAIEYLRVSTAYKMEKKYYERLLEKHANLQIHAAGII
A0A368D1N7      ERDAVVAEINKLLEELDLLPLFEA--EYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIV
A0A3B8TU58      ERQLMIDEINKILEELDVLPLFEA--EYLRLKRDYETKAMFYNNLIERKSSFSLSKAGIV
A0A1T5IIR6      QRRDLSDRERNAVAKFSSMPTKER--QMLEIQRQQSIKQELYLFLLNKREENALSQAMAD
A0A3E0QD27      KINNIDERIREFEGNFLKLPSQEA--ELSRLSRLFEINQKFYQLLLEKKVEFSITKAGII
A0A0M1W1I6      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
I8WPR6          KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A0K2HKS3      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALGQATTE
B6W3W8          KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALGQATTE
A0A1Y3Z9Z6      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALGQATTE
A0A076IRY8      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A3A6AD54      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A3A6MIU7      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
I8WPP8          KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A372Y7D2      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A3E4JJC9      KLNEARSRAGEAQWRGTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A3E4WDQ0      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
A0A414H9P2      KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
C3R5A8          KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALSQATTE
D1JY72          KLNEARSRAGEAQWRVTNIPRQQQ--QMLSIERQQRIKEELYLYLLNKREENALGQATTE
A0A1C5XJA7      KRNDAQNREMRVQERLSAMPTKER--QMLSIERQQKIKESLYLFLLNKREENALSQAMAD
R7CUW4          KRNDAQNREMRAQSRVTSIPTKER--QMLSIERQQKIKESLYLFLLNRREENALSQAMAD
D7J4K6          KRNDARSRQEQAQARFTTVPTKER--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD
Q8ABP9          KRNDARSRQEQAQARFTTVPTKER--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD
A0A174C2Q8      KRNDARSRQEQAQARFTTVPTKER--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD
D6D2Z5          KRNDARSRQEQAQARFTTVPTKER--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD
A0A1T3EDR4      RRRQASALEQRALGQMLKVPSKER--EQYSIYRSHAVKENLYLYLLNKREENALNAAIGE
A0A174SDD8      KKQDYSLQENQVRQKVQAVPRKQR--EMLSVERQQKVKESLYIFLLNKREENALSQAMVD
A0A1H7RFH3      KKQDYSLQENRVRQKVQAVPRKQR--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD
A0A412GR09      KKQDYSLQENRVRQKVQAVPRKQR--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD
A0A139L1N2      KKQDYSLQENRVRQKVQAVPRKQR--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD
A0A174TVL8      KKQDYSLQENRVRQKVQAVPRKQR--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD
A0A1H8BJR6      KKQDYSLQENRVRQKVQAVPRKQR--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD
R9H6G0          KKQDYSLQENRVRQKVQAVPRKQR--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD
A0A081PBV5      KINNLKKEQTQARNKAMAVPAKQR--MMLSVERQQKVKEELYLLLLNKREENAINQAMTE
A0A1I2AN85      KINNLKKEQTQARNKAMAVPAKQR--MMLSVERQQKVKEELYLLLLNKREENAINQAMTE
A0A1H6CKR6      KVRNLRQEENAAIGRARSMPAKQR--MMLSVERQQKVKEELYIFLLNKREENAINQAMTD
A0A235E1C0      RMSNMKDEENAAIGKARSLPSKQR--IMLSAERQQKVIEELYIFLLNKREENAINRAMTD
R6D982          KRTEISGQERLARRKVRDVPGKQR--EMLSVERQQKVKESLYLFLLNKREENALNQSMVD
A0A078PL82      KKNDYTVQENRVRQKVQAVPRKQR--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD
A0A078QKV9      KKNDYTVQENRVRQKVQAVPRKQR--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD
A0A1F0I8C4      KKNDYTVQENRVRQKVQAVPRKQR--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD
A0A3A5RIJ2      KKNDYTVQENRVRQKVQAVPRKQR--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD
A0A0B8T471      RIRNLQQEEAASRAKAQSLPAKQR--MMLSIERQQKVKEELYILLLNRREENALNQAMTD
A0A0D5BSQ0      RLNNAKQEEATAQSKTLQIPQQER--AILSIERQRKIKEELYLFLLNKREENALNEAIAE
A0A1T3F6P5      KLNNTRQEEGVAQSKMLQMPQKER--TMVSVERQRRVKEDLYMFLLNKREENALNEAVTE
A0A0W8EPA0      KLNNTRQEESIAQGKMLQMPQKER--TMVSVERQRRVKEDLYMFLLNKREENALNEAVTE
A0A365UKN1      KLNNTRQEEGIAQGKMLQMPQKER--TMVSVERQRRVKEDLYMFLLNKREENALNEAVTE
A0A2T5RP38      KMRNAQREEEQAIGKTLQMPKKQR--AMLSVERQHKVKEELYLYLLNKREENALNEAMTD
A0A1A6CF06      KLNNARQEGRTAQAKVLQMPQKER--TMLSIERQHKVKEELYLFLLNKREENALNEAITE
A0A1T3D6S8      KLNNARQEGRTAQAKVLQMPQKER--TMLSIERQHKVKEELYLFLLNKREENALNEAITE
A0A376E091      KLNNARQEGRTAQAKVLQMPQKER--TMLSIERQHKVKEELYLFLLNKREENALNEAITE
A0A1P8E011      KAGNMKKEENVARGKAMQVPQKQR--VMLSVERQQKVKEELYLYLLNKREENAINQAMTE
A0A1V3N3U3      KIRNAQQEESMAKGKALQVPKKQR--IMLSVERQQKVKEELYLYLLNKREENALNLAMTE
C2FUH6          KMQKARSEEQQARGKVIQMPQKQR--IMLSVERQQKVKEELYVFLLNKREENALNKAMTD
A0A239XXC4      RMSNMKDEENAAIGKAKSLPSKQR--IMLSAERQQKVIEELYIFLLNKREENAINRAMTD
A0A2X2J8S4      KKNNAVKEENRASGKSRQMPQKQR--LVLSIERQQKVKESLYVFLLNKREENAINQAMTD
A0A3C0S618      KKNNAVKEENRASGKSRQMPQKQR--LVLSIERQQKVKESLYVFLLNKREENAINQAMTD
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      ELESVEDQIRTANGRLSRLPRNER--MLTQMGRTYESINELYSYLQKKKTEAEIALANLT
A0A2T2UAJ4      RLDVLNERLRENRQKLEQIPTQSI--KLAQPQRERRSTEQIYSFVQEKLQEARLAEQSEI
A0A3D4RLG4      EKKDLQNRYKEVEKEIPNLPTKEL--QMVAIERNYRIDDNYYTFFLQKRAETEIQKASNT
A0A3N2LCI3      QISSLQGSQASTTSKIASNPSQAK--YLLSVERQQKVKESLYLFLLQKREENELSQAFTA
A0A2T4XEQ1      ---------------------------------DVNIAESIYLTISRQYAETALWEQTQF
A0A2K8ZAP1      NRNQLVANNQRMEGMIRTVPGKER--ALLNITRQQGIKNNLYTYLLQKREETALSAASRV
A0A348PT57      --------------------SKEI--EYARIERVYNSNEKYYTLLLEKKTEYAISEAGFI
A0A3D3LSK1      KIGIVNSLSSQYNAQIKTLPSQVI--EYAKLERDKLAAEKLYAALESNYQESLINERTQT
                                                                            

A0A1H6Z2F8      -ANARVIDPP-KAS-PLPVSPNRQLTILVAFLAGLLAPACVIYVG-QIFNNKITSKDDI-
A0A2P8G5K0      -ANARVIDPP-KAS-RLPVYPNRELTILIAVFTGILTPLGVLYTS-QIFNNKITSKEDI-
A0A3D4CJE1      -PQHTILEQA-EIP-NVPIKPNKKLIFVVFVFGSLVLGIGFVVIK-YLFHNEITSVADIT
R5DEG6          -SNARIIDPA-AGS-NAPVAPKAMMILLASVVLGCAIPAGILWLL-MVSDTKVRSRKDV-
A0A1G1TG88      -ADFQILFPA-SEP-RVPISPVRLMVYAIGLAGGLFLGLGLIAVR-YLLHNTITNTREL-
A0A3M1TXY5      -ANKFVVDEAKQVG-SGPVSPKVGLIYAVAFVLSLGLPLAIMLVY-DFFNEKISGDQDI-
A0A2E0VQ27      -FPHKIIEHA-VRP-KATVAPNKSLYYGMAFLLALLAGMFYAYLR-SYVKETVSSKDEL-
R6U429          -GNTRLVMEP-AGE-DMPQSPNKKMIMLIALILGAGIPFGIFFMI-NQLDTRVKTRNDL-
A0A350V3E4      -NNVKIIDYG-KVP-KAPSKPNRFLIITIGLLIGLGLGYGFALLR-NILDVSVKSPEDL-
A0A212J9Z9      -PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEEC-
F5IV23          -PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEEC-
F8X2T0          -PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEEC-
A0A1M3LAG1      -PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEEC-
A0A212K6G4      -PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEEC-
A0A1M5DFS8      -PDNFVLEEPRQLG-GPVNGDEKKKTYTFYLAIGLAIPLIFVICKEELFNYAISTKEDC-
A0A2V3PNY7      -PDNFIMEAPRQKG-GPVNGDEKRKNYTFYFFIGLGLPLLFVIAKEEIFNLVISTKEDC-
A0A015VNG0      -YNTRIVTPS-HGS-MLPTSPVRRNIFMVAFALGLLIPVVIIFMR-ENMNTRVRGRKDL-
A0A142HHS5      -ADFQILSPA-FAP-EEPISPKKLLVYAIGLAGGLILGLGLIGTR-YLMHNTITSVNEL-
A0A1M6MYT6      -PDSQMIEEAKMAG-TGPVEPQKRKIYALALLLALAFPTGIIILL-DLLNTKILSKDDV-
A0A2P8CDS1      -PDNEIIDPARMEG-NTPISPNNMTIYLVALLFGIFLPAGGIILK-NEFDNKVRTPEDL-
A0A353WYK7      -TDFKILSSA-SLP-SNPIAPNKILIWAGAIIASVILSFLFIIIR-YLLHNSVSSEKDI-
A0A136LSC7      -PDFKILSPA-TLP-IKPISPSKVMVLGIGFVAAIVLCLFFIGLV-YLLNNKITSVKEV-
A0A355BP94      -PDLKILSSA-ILP-GRPVAPNRYLILGIGLVAGLVINFFFISIV-YLLSNKITSLQEI-
A0A161LWY6      -PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIPLLIIILK-EYLKTKVMDKRDI-
A0A239K409      -PNSLVLRPA-IIE-GVPVEPKKQTVFLLAFIAGLGVPLASIFIK-NAFNRKVQQRADV-
A0A1G9B1T9      -STKKVVEEARLDG-RTPVSPNKILILLTAIVLGLALPVGALILA-DMFQDKISSREEV-
A0A2W4RDE8      -VEKSVVDEAMMVG-SAPVSPNKRMIYAAAFILGFGGALGLLILK-DFLNDNIVTHEDL-
A0A1V5S1J9      -PDNIILDKA-RLA-SMTNAGEKNKAYTMFLAIGLLVPVAIIVLL-ELMVPYIRTESEV-
A0A0A2EYC8      -PDNAVMQKA-RTM-SLINAKEKQNKYIVFLLIGLAVPAALIILK-ELLNNAIRTEKDI-
A0A2G6H6Y4      -PDNTVLQTA-MIS-GQLNDKEKRTNYLIFIVLGLMIPVVLIVLK-EFMNSAVRTEKDV-
A0A1M3DPL8      -PDNNILDRA-RTT-SVTNQGTKSKTIMMYFLIGILLPSVFIILK-ELLNNTIRTSRDV-
A0A1V5F519      -PDNNILDQA-RTV-SLINADVKSNTMFMFILLGILIPSLIIVLK-EVLNNTIRSIKDI-
A0A2G6R1T9      -PDNEVVEQA-RVR-FVVNGGKKKETTMTYLLFGLMIPAIFLIAR-ELLNNTIRGQKDV-
A0A0L8VEV2      -SDTEVLDEA-RPELAELMGPYLTFNVAGGLLAGLFVPFMVIMLA-TYFYDRIKSAEDI-
A0A1I2A9Z9      -SDTQVLDEA-RPELASRLGPNLVINVAGGMLAGLFIPFVVIMLA-TYFYDRIKSAEDI-
A0A3D0FMX4      -PDNDRLDKA-RIL-ECTNAGAKNANRTKYLLLGLIIPFLFVILR-ELLNNKVRTTREA-
A0A1M3MEI8      -PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVPAGFVVVK-ELLNVRIMTNRDV-
A0A1J5HQM0      -PDNNILDRA-RII-AVTNDGTQSKTTLTFLIIGLLIPAAFVALR-EFSNGTIRSNKDI-
E4T131          -PDNDILDKA-RIV-GVTNSDKRSKTTMVFLLFGLLIPTFIVILI-ELLNNTVHSTKDV-
F4KR18          -ANALLFDPP-YSS-IGPVGPNKIKIFAAAGMGGLAIPFFLILVL-ELLKNSVQTEEDL-
A0A350PNH9      -YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIPVVVIFIR-ENMNTTVRGRNDL-
A0A354LNT9      -YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIPVVVIFIR-ENMNTTVRGRNDL-
A0A389LWV6      -PDNLVLDNA-RTT-GLVNAGDISNTYVYFVVTGLILTIIFIFLKEVLLKTSIQSRSEV-
A0A2W7RD29      -NNNKIIEQA-KAN-ALPIGPRKLNFYGYAIIITFLLPVIITFLQ-ETVFKKLVDPSEI-
A0A3N2NDY8      -DNTRIITPP-TGS-LQPVAPKVKFILAICMFFGLCVPGVAIYII-SATDTKVRSRKDL-
L1M9T3          -YNTQIIETP-HVT-GTPATPVSKKILGIALLLGLGIPAALIFAR-EGFNTTVRGRKDL-
D7JEV9          -PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIPAVLIILK-ELLNNAIRTEKDI-
A0A2W7QSQ0      VSSAQMVDPP-IAS-LKPVKPNKLMIMAAALGLGLSLPLGLILVN-YLVTSKVTSKRVI-
R7F6L5          -YNTQVVRQP-AGP-GAPISPVSTNTYLIAVLIGLIIPSGVYVVK-ANLDNKVRSREDV-
C9LKL0          -ANVRLVEDP-LGS-NTPISPSRSTIILISLLIGLLIPTLILTIR-RLMDITVSGRHDV-
A0A3D0QPV7      -TGNQILEQA-TIP-KLPVSPKKRMIVIAFFFIGILFSSVMIVIR-YLMHNEITTLHEI-
A0A3C0I8F1      -PEFVILAPA-SQP-TKPIYPVPTNIYSLGLAAGVVLSLLLVAIR-YLLNNTVANQKEL-
R5JJI4          -SNARIIDPA-SGS-SVPVAPKSMMILLAAIVLGGTIPMIVLWLL-NVTDTKVRTRKEL-
A0A1F3D6P8      -PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIPTTFIFIR-NFFNNKISSIYDL-
A0A356Z058      -PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIPTTFIFIR-NFFNNKISSIYDL-
A0A3D1BT36      -PDYEVLESARSIT-SSIIKPKKMINYIASFFLGLLIPSLIIILK-DFFNEKITRAYEI-
A0A352ME00      -PDYEIVEPARTIT-SRIVAPKSAINYMMALFFGLLLPTLYLMIR-DFFDDKIRSINDA-
A0A3D3HL11      -PDYEILEPARDVT-ASIIAPRTNLNWLIALFMAFMVPTIYIILK-NFFNEKISSVRDV-
A0A3D2HF71      -SDNRIIDYAGVYS-STMIKPKERQNFMLAIILGLFFPGIGILLL-DYFNNKIIDKKDI-
B5CTK0          -SNVRTIDPA-SGS-NTPIAPDRMRIWMISFLIGIGIPAVFLMLL-KMTDTKVRTKKDI-
A0A229I3A5      -YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIPMVVIYIR-EKANTTVRGRKDL-
A0A3R6HJB3      -YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIPMVVIYIR-EKANTTVRGRKDL-
A0A0A2DQN2      -NNAYILDLG-VGT-SAPISPVPSRSILLGIVLGLFIPAAYAILK-LLTDTKIHSRRDV-
A0A0A2F2N5      -NNAYVMDFD-TGS-NSPISPNTTRTLLISFAIGLFIPTAFFLLK-LLADTKVRTRKDV-
L1NGW4          -DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALPTIGLIIR-LLADNKVRTRKDI-
Z4WRA0          -DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALPTIGLIIR-LLADNKVRTRKDI-
U2K8K9          -DSAYILDMN-DAPNTPPVSPNTLRTIVLAFLLGLALPTIFLIVR-LLTDNKVRTRKDI-
A0A069ZM60      -DSAYVLDMD-DAP-SKPISPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRSRKDV-
J6GV98          -DSAYVLDMD-DAP-SKPVSPNALRVALIAILIGLVLPSVYLIIR-LLADNKVRSRKDV-
A0A134B4F8      -DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRSRKDV-
A0A134B8C7      -DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRSRKDV-
A0A1M6B6D5      -SDVLVIDPAKDTG-GGQIGPNTQLNYMMAGLIGFFVPILLIFVR-AFFDTKVESVKDL-
A0A451FS66      -SDVVIIDTAKDTG-GGKIGPNTQLNYVMAGLLGLFIPLFIIFGM-AFFDTKVEYVKDL-
A0A2E3GN39      -SDYIILEMP-KIA-EKHVAPDDSFIRFVGLAIGAILSLILVVFR-YVTHKEIINIEDI-
A0A3D1MEL0      -SDYIVLEVP-KIA-EEHVAPDDSFIRFVGLAIGAILSLILVVFR-YITHKEIINIEDI-
F0R0C9          -YNTRVITPP-TGS-MLPTAPVRRNILLVAFALGLLIPVVIVFVR-ENMNTKVRGKKDL-
A0A2A4N9A6      -NDVVILAEA-SVP-KIQEYPSPVYAMLTGIISFLMLSLITVIFR-YMLHNKISHLSDI-
A0A368D1N7      -SDYIILEMP-KIA-EQHVAPDDSFIRFVGLAIGAILSLILVVIR-YITHKEIINIEDI-
A0A3B8TU58      -SDYTILENP-KIA-KNHISPNDSFIRFVGLAIGAILSLILVVFR-YITHKEIINIEDV-
A0A1T5IIR6      -DNIRVVDPA-VAN-LTPTSPQRMKIVMLAILIGLLIPGVILIAR-LFLDTKIRTRKEI-
A0A3E0QD27      -SNNIVLERG-KPA-VNPLSPNRRLVIAGSLLLGFIISFLIIFVK-YLFYNEITTLDEI-
A0A0M1W1I6      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
I8WPR6          -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A0K2HKS3      -TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDI-
B6W3W8          -TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A1Y3Z9Z6      -TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A076IRY8      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A3A6AD54      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A3A6MIU7      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
I8WPP8          -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A372Y7D2      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A3E4JJC9      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A3E4WDQ0      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A414H9P2      -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
C3R5A8          -TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDI-
D1JY72          -TDARVLDPA-GGG-DAPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDI-
A0A1C5XJA7      -NNARVIDSA-EAT-KYPISPNRNKILALGILLGLALPTVSFLVI-MFMDTRIHSRKDI-
R7CUW4          -NNARIIDSA-EGG-DSPISPRRNRILLLGLLVGIALPGVGCLLV-LFLDTRVHGRKDI-
D7J4K6          -NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDL-
Q8ABP9          -NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDL-
A0A174C2Q8      -NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDL-
D6D2Z5          -NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDL-
A0A1T3EDR4      -AKLHVVDHA-VIS-HVPISPNILISVFTGLGIGFLVWVALLLLR-LFLNTTVKSREEI-
A0A174SDD8      -NNARVLDPV-SGS-NIPISPNKYKKLMLGVGCGVIVPSVILLLM-LILDTGVHNRKEV-
A0A1H7RFH3      -NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEI-
A0A412GR09      -NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEI-
A0A139L1N2      -NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEI-
A0A174TVL8      -NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEI-
A0A1H8BJR6      -NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEI-
R9H6G0          -NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEI-
A0A081PBV5      -DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALPAIVFLLM-LMLDTGVRSRKDI-
A0A1I2AN85      -DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALPAIVFLLM-LMLDTGVRSRKDI-
A0A1H6CKR6      -DNIKVIDSA-NTS-NYPFYPSLLKKLALGIGIGLAIPTAILLLI-LMLNTKIRYRKDI-
A0A235E1C0      -DNIRVIDSA-SGS-DAPFYPSKFKKVAIGVAIGIAVPAAILLLM-LLLNTKIRNRKDI-
R6D982          -NNARIIDSA-SGS-NAPFYPNKYKKLLLGGGMGILIPTVILLLI-LIVDTRVRNRKDM-
A0A078PL82      -NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEI-
A0A078QKV9      -NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEI-
A0A1F0I8C4      -NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEI-
A0A3A5RIJ2      -NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEI-
A0A0B8T471      -DNLRVVDPP-SGS-EAPIYPSKARKVMTGVGFGVVLPTVVLLLL-LLLDTKVNGRKDI-
A0A0D5BSQ0      -SNLRIVDPP-TGL-DFPVSPNKLKKLSIGVAIGAVLPAVVLLSM-LMLNTGVRGRQDL-
A0A1T3F6P5      -ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGTVLPAVVLLSM-LMLNTGVRGRQDL-
A0A0W8EPA0      -ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGAVLPAVVLLSM-LMLNTGVRGRQDL-
A0A365UKN1      -ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAMGAVLPAVVLLSM-LMLNTGVRGRQDL-
A0A2T5RP38      -ENIRVVDPA-SGP-DVAVYPNRLKKIFTGVALGTAVPAVILLSM-LVLNTGVRGRQDL-
A0A1A6CF06      -ANLRIVDPP-VGD-AYPIYPNRLKKVFTGVAIGTVLPMIVLLSL-LLLNTAVRGRQDL-
A0A1T3D6S8      -ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAIGTVLPMIVLLSL-LLLNTAVRGRQDL-
A0A376E091      -ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAIGTVLPMIVLLSL-LLLNTAVRGRQDL-
A0A1P8E011      -DNIRVIDPA-IVS-FDPVAPSRMRKLGLGMAIGFILPAIVIMTL-SILDTGVRRRQDI-
A0A1V3N3U3      -DNIRIIDRA-SVA-TSPIFPSKFRKVATGIGIGLILPTVILLFL-LVFNTGVRSRQDV-
C2FUH6          -DNIRIIDPA-SGS-DAPVYPVRFKKVMTGVGIGIVLPAAVLLCL-LIFNTGVRGRQDI-
A0A239XXC4      -DNIRVIDSA-SGS-NLPFYPSKLKKVAIGVAIGIAVPAAILLLM-LLLNTKVRNRKDI-
A0A2X2J8S4      -DNIKVIDPA-SGS-FAPVYPNKFKKVGLGVAIGLVIPSLLLILM-LVVDSGVRNRKDL-
A0A3C0S618      -DNIKVIDPA-SGS-FAPVYPDKFKKVGLGVAIGLVVPSVILILL-LIVDSGVRNRKDL-
A0A1T4NDR5      ------------------------------------------------------------
A0A2U0UJ71      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      ---------------MIPTAPVKKNIALVAIVLGLLIPVVIVFIR-ENMNTKVRGRKDLE
R7JFY1          --------------------------------MAIPAGILWLR---WANDTRIRSMKDVQ
A0A2M7VVW6      ------------------------MIMATGVLLGIVISLIILILK-YVLKNTISTMDEIT
A0A413V760      --------------------------------LGIPMGVFWLL---NVTDTKVRTRKELD
A0A3D5KRM7      -----------------------------------------------------------M
A0A3M1NUH2      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2U0UG39      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A3M1Y2F5      -VDLMIIDPA-RYT-GKESRNSRMLIMALALILAIGLPAGFLVVL-SYFSDKVSTYQELK
A0A2T2UAJ4      -GYAEIIRSA--AP-GRPVGPDTRRNLLLGLMLGLVAGGGLVVLR-EQLDTRIYQPDDLR
A0A3D4RLG4      -PDNAVLDKA-RTT-YITNAKQQRKTMISYLALGFLLPLVLSVLI-ELIYNKLRIPKEVE
A0A3N2LCI3      -YNTRVVNKP--AS-FGPTAPNTRNILMMSFLLGLAIPFGVVYLM-ESNNTKVRGRKDVE
A0A2T4XEQ1      -GLGRPLDYA-VAP-LSPFKPNKRLFILIGIFLGGAVGVGLAFGR-EFLNRTIDGLDKLK
A0A2K8ZAP1      -SDSRIVDPA-HTT-SQPVKPVKLMIFALFAVVGLVIPIGVITAK-DTVNNHVLRRSDVE
A0A348PT57      -SENRVLRRA-STS-RIPISPVKPIIYASFLALGLILSFLLIGIR-YILNNDISGVHDLS
A0A3D3LSK1      -IKSYVIDPG-YDD-NSPIGPDRRNMNIFGIIAGLIIGLAFALMR-IYFNKNLSTPEELE
                                                                            

A0A1H6Z2F8      -SRQC-DVTI--IGEISQQSRA----D---------------------RLSRNNVRSLLR
A0A2P8G5K0      -QRQC-DVMI--LGEISQQSRT----G---------------------LLKVADNRSLIK
A0A3D4CJE1      QEGKA-KLGV--LGVIPKYKKEIPVSQ---------------------LIIDKNPKSVIS
R5DEG6          -EGVL-SVPF--LGEIPMRDKK-DKNE---------------------VVVHENGRDSVS
A0A1G1TG88      -ERST-QAAV--LGVIPTYDKEKMEVSR--------------------LVVNDNPKSAIS
A0A3M1TXY5      -EACT-NIPI--LGYIARYEKSNN------------------------YIIEKDSRTSFA
A0A2E0VQ27      -EEKLPQYPI--IGEVY-------------------------------RLTRKTPPGF--
R6U429          -TN-M-QVPF--LAEIPQLGQGAGILNKMRKKMCDDANTK--------IVVAPSNRNSIN
A0A350V3E4      -EN-I-GISL--IGWVPTFMREPKAGRHTHTEQE--------------LVLAYNSDSVPA
A0A212J9Z9      -EKIS-GFPV--IGTIENVSKKLNN--GV-------------------VLVKNYPKSSFA
F5IV23          -EKIS-GFPV--IGTIENVSKKLNN--GV-------------------VLVKNYPKSSFA
F8X2T0          -EKIS-GLPV--IGTIENISKKLAG--GV-------------------VLVKNFPKSSFA
A0A1M3LAG1      -EKIS-GLPV--IGTIENISKKLAG--GV-------------------VLVKNFPKSSFA
A0A212K6G4      -EKIS-GLPV--IGTIENISKKLAG--GV-------------------VLVKNFPKSSFA
A0A1M5DFS8      -ERLS-GLPV--IGTIENISKKMSSN-ST-------------------TLVKNFPKSSFA
A0A2V3PNY7      -ERLS-GLPV--IGTIENISKKLSSSGST-------------------TLVKNFPKSSFA
A0A015VNG0      -ES-V-TVPF--IGEIPLFARKKKGLFGKKPQEVKA------------IVVKEGSRDIIN
A0A142HHS5      -ERNT-KASV--LGVIP----------TYDKEQLNISR----------LIVDKNPKSSVS
A0A1M6MYT6      -EALT-DYPI--IGHV------------FNNRKESESH----------TLVLDKPNSPAS
A0A2P8CDS1      -ENLT-KYPI--LGHI------------IHDDQAAISH----------TALLDHPNSPVG
A0A353WYK7      -EHIT-PTSI--LGSIPFVEKLKGRDSDR-------------------LVIDKVPKSEIS
A0A136LSC7      -ERGI-NLPM--LGAIP---ASHHTVQSL-------------------FHVIDNPKSIVS
A0A355BP94      -ERTI-HVPV--LGVIP---EMRRNTTSP-------------------FYIVENPRSIVS
A0A161LWY6      -EKLS-PFPY--IGSLP---HATHDDAT--------------------ITVLKRPKSAIA
A0A239K409      -ERAT-TAPV--LGEVS---YNDTKDV---------------------IVVSESSKTAIA
A0A1G9B1T9      -ANII-SMPL--VGEVP---RLRRK--EN-------------------ALVYSRPRSAAA
A0A2W4RDE8      -EQYT-RIPF--LGVVS---HGSRR--EQ-------------------SNVVANALSPVG
A0A1V5S1J9      -ISMA-PKQYQLLGVIM---HTDRKT--P-------------------VIVDKYPKSAIT
A0A0A2EYC8      -EKAI-KNKFQIIGTVR---HTKHKADEK-------------------VIAAKYPNSYFV
A0A2G6H6Y4      -DIAT-KNRFDIIGSVL---HTKHKTEDK-------------------VIAPKYPNSYFV
A0A1M3DPL8      -EK---MSAFPLIGLVR---HTNSTD--P-------------------YLIVNNPRSSFT
A0A1V5F519      -EK---RSVFPVIGMIR---HAKNDL--P-------------------DLTLKNPKSSFT
A0A2G6R1T9      -EK---NSKFPIIGNIR---HTKKAN--P-------------------LLTLKHPRSSFT
A0A0L8VEV2      -EEYT-DIPV--IGNIV---NSGIG--SEY------------------LAAIDNPRSAIA
A0A1I2A9Z9      -EEYS-DIPV--IGNIV---NTGIG--AEF------------------LAAIDNPRSAIA
A0A3D0FMX4      -EALS-HYKL--LAQVR---HTRGS--NP-------------------TEVVDHPRSSYA
A0A1M3MEI8      -EKYS-SFPL--IGMIR---HTNSD--NP-------------------FIVAANPRSSFT
A0A1J5HQM0      -EKNS-KFTM--IGSVR---HTNSN--DP-------------------LITINNPRSAFT
E4T131          -EKNS-VFPL--IGAVR---HTKST--DP-------------------LVVSKNPRSAYT
F4KR18          -KSML-PEKT-IMGVIN---HQKGK--KQ-------------------HSLLSKSQNTLT
A0A350PNH9      -KN-I-TIPF--LGEIP---YCISR--KNRPTLLQRIQFWKKPKETLQIVVKAGKRDIVN
A0A354LNT9      -KN-I-TIPF--LGEIP---YSISR--KNRPTLLQRIQFWKKPKETRQIVVKAGKRDIVN
A0A389LWV6      -EKIS-ELPI--LGTIE---HTERKEM---------------------MVLYKYPKSSFA
A0A2W7RD29      -EKLL-NIPV--IGSIP---VAEGK--TN-------------------VQLVDYPNSKVA
A0A3N2NDY8      -DR-M-SAPF--AGEIP---FVGKKSIKDRMARLLPAKKNSKELERVVVAVKEGSRDAVS
L1M9T3          -ED-M-SVPL--VGELP---FKGKK--RPVWQRWRKQTIVAQPN----MVVADQQRDIIN
D7JEV9          -ERAT-RNRFPTIGSVR---HTKHK--ADER-----------------VIASKYPNSYFV
A0A2W7QSQ0      -EKIL-NAQI--LGEIA---KNDQN--GV-------------------IAISPKSISPAA
R7F6L5          -EN-I-GIPF--IGEIP---QKGRK--KLGKDSSSERQ----------VVVRADSTNVIN
C9LKL0          -EEAT-TIPL--VGELP---TWEEG--GDDG-----------------LITTCSSDAPIV
A0A3D0QPV7      -TRIS-NASLGILGIIP---KYKED--IPVSQ----------------LIVDKNPKSLIS
A0A3C0I8F1      -EKII-IAPV--LGVIP---FHNKQ--KNAKYSK--------------LVILDNPKSTIN
R5JJI4          -DNIL-TIPF--LGDIP---RHGTR--KGEDTDA--------------IVVHESGRDSVS
A0A1F3D6P8      -ESLI-NQSG--MGVIF---NNNYK--SE-------------------AVVLEAPKSAIA
A0A356Z058      -ESLI-NQSG--MGVIF---NNNYK--SE-------------------AVVLEAPKSAIA
A0A3D1BT36      -EDVL-GKPV--LSTIY---NNSFK--YE-------------------DVVHKAVGSPIA
A0A352ME00      -EYML-HRSV--MSVIY---SNNLK--SE-------------------AVVAEFPKSAIS
A0A3D3HL11      -EHMI-GQPV--MNLIY---TNFYK--TE-------------------SVVKDYPGSSIA
A0A3D2HF71      -EKRT-SAPI--IGFIG---HNTFK--TD-------------------LPAVEHTGSSLA
B5CTK0          -ENKL-SIPF--LGEIP---KYQGK--DD-------------------IIIHENGRDSIS
A0A229I3A5      -KK-V-NVPF--LGEIP---FSISR--KNRPTLEQRIKFWKKPKEVRMIVVKAGKRDIVN
A0A3R6HJB3      -KK-V-NVPF--LGEIP---FSISR--KNRPTLEQRIKFWKKPKEVRMIVVKAGKRDIVN
A0A0A2DQN2      -VDQV-SLPF--LGEIP---LNTTK--KGG--EG--------------IGVSEQGTDLTS
A0A0A2F2N5      -LERV-SIPY--LGDIP---QSDTN-------LF--------------VAVEPQGSDAIT
L1NGW4          -LDRL-TIPF--LGDIP---KEDAP--GRK--QP--------------RGAREQGSDETS
Z4WRA0          -LDRL-TIPF--LGDIP---KEDAP--GRK--QP--------------RGAREQGSDETS
U2K8K9          -LDRL-TIPF--LGDIP---KEER----AKSGHT--------------RGVREQGGDETS
A0A069ZM60      -MDRV-SIPF--LGDIP---REEKR--GGKKSQP--------------RGVREQGGDETS
J6GV98          -MDRV-SIPF--LGDIP---KEEKR--GGKKAQP--------------RGVREQGSDETS
A0A134B4F8      -MDRV-SIPF--LGDIP---REEKR--GGKKSQP--------------RGVREQGSDETS
A0A134B8C7      -MDRV-SIPF--LGDIP---REEKR--GGKKSQP--------------RGVREQGSDETS
A0A1M6B6D5      -EAIT-PIPM--IGVIG---KNHSE--TV-------------------LAVLSKPKSAIA
A0A451FS66      -AKIT-PIPL--FGVIG---KNHSG--NI-------------------LAVLSHPKSAIA
A0A2E3GN39      -TSQT-ETSL--LGVI-----------QRYSEKLPMSS----------IVVTNRPKSGIS
A0A3D1MEL0      -TSQT-ETSL--LGVI-----------QRYSEKLPMSS----------IVVTNRPKSGIS
F0R0C9          -E-CL-SMPF--AGEIP---LA-----GESRRKHLFAS--KTYDAPRGIVVKQGKRNIIN
A0A2A4N9A6      -DRST-NATV--LGIIP---QF-----KR--EEMPISQ----------LVVEKNPKAGIT
A0A368D1N7      -TSQT-ETSL--LGIIQ---RY-----S---EKLPVSS----------IVVTNRPKSGIS
A0A3B8TU58      -TSQT-ETAL--LGVIQ---RY-----S---EKLPMSS----------IVVTNRPKSGIS
A0A1T5IIR6      -EENI-DVPF--LAEIP---LNGTL--RGIVFKQGKHK--QGHDDPSPFVYDPTSHTVFT
A0A3E0QD27      -NLYT-DAAL--LGIIP---KY--------KNEIPVSQ----------LLVDKNPKSAIS
A0A0M1W1I6      -EDVV-TVPF--LGEIP---KDSSK--RKIENKKTAHG----------IAVRAQGRDIVS
I8WPR6          -EDAV-TVPF--LGEIP---KDSSK--RKIENKKTAHG----------IAVRAQGRDIVS
A0A0K2HKS3      -EDAV-TVPF--LGEIP---KDSSK--RKIENKKTAHG----------IAVRAQGRDIVS
B6W3W8          -EDAV-TVPF--LGEIP---KDSSK--RKIENKKTAHG----------IAVRAQGRDIVS
A0A1Y3Z9Z6      -EDAV-TVPF--LGEIP---KDSSK--RKIENKKTAHG----------IAVRAQGRDIVS
A0A076IRY8      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
A0A3A6AD54      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
A0A3A6MIU7      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
I8WPP8          -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
A0A372Y7D2      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
A0A3E4JJC9      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
A0A3E4WDQ0      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
A0A414H9P2      -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
C3R5A8          -EDAV-TVPF--LGEIP---KDSSK--GKTENKETAHG----------IAVRAQGRDIVS
D1JY72          -EDAV-TVPF--LGEIP---KDSSK--RKIENKKTAHG----------IAVRAQGRDIVS
A0A1C5XJA7      -LGAV-SVPF--LGEIP---LD-----KN-YKSSRKGA----------ANAYGYGDNVVT
R7CUW4          -EKAV-SVPF--LGEIP---LD-----KEAARQHGRTA----------KASVGQDDSIVS
D7J4K6          -KGAV-SIPF--LGEVP---QD-----KE--AAKAGVA----------V---GEEDGMLA
Q8ABP9          -KGAV-SIPF--LGEVP---QD-----KE--AAKAGVA----------V---GEEDGMLA
A0A174C2Q8      -KGAV-SIPF--LGEVP---QD-----KE--AAKAGVA----------V---GEEDGMLA
D6D2Z5          -KGAV-SIPF--LGEVP---QD-----KE--AAKAGVA----------V---GEEDGMLA
A0A1T3EDR4      -ESAL-NIPF--LGEIP---YS-----RS--KSESGMG----------VFVYHTGKDALS
A0A174SDD8      -ESIV-SAPF--LADIP---QT-----PK--AMANVHE----------VVGRARGLDALS
A0A1H7RFH3      -ESIV-SAPF--LADIP---QT-----PK--AMANVHE----------VVVRARGLDALS
A0A412GR09      -ESIV-SAPF--LADIP---QT-----PK--AMANVHE----------VVVRARGLDALS
A0A139L1N2      -ESIV-NAPF--LADIP---QT-----PK--AMANVHE----------VVVRARGLDALS
A0A174TVL8      -ESIV-SAPF--LADIP---QT-----PK--AMANVHE----------VVVRARGLDALS
A0A1H8BJR6      -ESIV-SAPF--LADIP---QT-----PK--AMANVHE----------VVVRARGLDALS
R9H6G0          -ESIV-SAPF--LADIP---QT-----PK--AMANVHE----------VVVRARGLDALS
A0A081PBV5      -EEVL-SVPF--LGEIP---FT---------LKDKGGE----------AVVEEKGRDYTS
A0A1I2AN85      -EEVL-SVPF--LGEIP---FT---------LKDKGGE----------AVVEEKGRDYTS
A0A1H6CKR6      -EDNI-SVPL--VGEIP---FS-----TD--LKTAKSD----------IVIKEQGTDEVT
A0A235E1C0      -EDAV-SVPF--LAEIP---FS-----TE--MKSAKSE----------IVIKEQGVDEVT
R6D982          -EAVV-SAPF--LAEIP---KS-----AE--KVTEIND----------IMVRARGQDALS
A0A078PL82      -EASV-SAPF--LADIP---QV-----SK--TEADAQE----------VMVRARGLDPLS
A0A078QKV9      -EASV-SAPF--LADIP---QV-----SK--TEADAQE----------VMVRARGLDPLS
A0A1F0I8C4      -EASV-SAPF--LADIP---QV-----SK--TEADAQE----------VMVRARGLDPLS
A0A3A5RIJ2      -EASV-SAPF--LADIP---QV-----SK--TEADAQE----------VMVRARGLDPLS
A0A0B8T471      -EEAV-SVPF--LGEIP---FS-----KQ--TIRANDD----------VVVNEQGRDPAT
A0A0D5BSQ0      -EDVL-SVPF--LGEIP---LM-----RS--RKQGKSD----------VLVSKSGRDPLT
A0A1T3F6P5      -ENVL-TVPF--LGEIP---LA-----KG--RRQGNGD----------ILVSQSGRDPLT
A0A0W8EPA0      -ENVL-TVPF--LGEIP---LA-----RG--RRQGNGD----------VLVSQSGRDPLT
A0A365UKN1      -ENVL-TVPF--LGEIP---LA-----RG--RKQGNGD----------VLVSQSGRDPLT
A0A2T5RP38      -ENVL-SVPF--LGEIP---LA-----RG--RRQGKGD----------ILVSGSGRDPLT
A0A1A6CF06      -ENVL-SVPF--LGEIP---LA-----RS--RRQGKGD----------ILVSKTGRDPLT
A0A1T3D6S8      -ENVL-SVPF--LGEIP---LA-----RN--RRQGNGD----------VLVSQSGRDPLT
A0A376E091      -ENVL-SVPF--LGEIP---LA-----RN--RRQGNGD----------VLVSQSGRDPLT
A0A1P8E011      -EEAI-DVPL--LGEIP---LA-----TN--KRTSQNN----------ILVSAMGRDPLT
A0A1V3N3U3      -ETVL-SVPF--LGEIP---LS-----KR--KSEQHAV----------FRVEKTGRDPLT
C2FUH6          -ESVL-DIPF--LGEIP---QA-----GK--RKTDSNK----------VLVSKTGRDVLT
A0A239XXC4      -EDAV-SVPF--LAEIP---FS-----TE--MKTAKSD----------IVIKEQGVDEVT
A0A2X2J8S4      -EEGL-SVPF--LGEIP---LA-----KK--NKHTVGN----------VSVSQTGRDALT
A0A3C0S618      -EDGL-SVPF--LGEIP---LA-----KK--NKHTVGN----------VSVSQTGRDALT
A0A1T4NDR5      ----------------------MTNVENKMLKDLISIY---------------DSSNPAT
A0A2U0UJ71      ----------------------------MQTINIETNQ---------------QDDYQVR
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A1V5S5I3      SL----SLPF--AGEIPLAVSGKGKKKVHNAKKIVIRQ---------------GNRDIVN
R7JFY1          DRT---ALPL--LGEIP----ALEKNQE----KLVVKE---------------GSRDAVS
A0A2M7VVW6      KFSNG-AVGI--LGTVP----TY--NREIPISQLVINR---------------DPKSVIS
A0A413V760      GVL---TIPF--LGNIP----RHGNNKGEDSDGIVVRE---------------NSRDSVS
A0A3D5KRM7      VENSE-SDSL--DNIRYSKTRIMPLDAEVLQDNRIIMG---------------LYNDQRA
A0A3M1NUH2      -------------------------------------------------------MSPVV
A0A1V6HYH8      ------------------------------------------------------------
A0A359ATS6      -------------------------------------------------------RDVIN
A0A2U0UG39      ----------------------------MQTINIERLR---------------KLDYRAN
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      -----------------------------------------------------------S
A0A3M1Y2F5      --KAT-PIPV--LGTV----------IKNDDGLEVIKQS--------------TSYSPLA
A0A2T2UAJ4      --EH--GHHV--LGVVPSMTPLIDDEFGGQETIEIDGRSVNTL-----LAMLVSPMSAAA
A0A3D4RLG4      --RLS-SFPL--IGSL--------RHVRSQNPTLVQK----------------NPRSSYT
A0A3N2LCI3      --HL--AVPF--LGELPQDGHEKKKEAGEANTIVVKG----------------GKLDIIN
A0A2T4XEQ1      ---GS-GYPI--LAVIPDFTEYVKKKYEEKSKVAVKGRLVSTN-----WFSLLDNISPVT
A0A2K8ZAP1      ------EVTQ--IPIIGEV--IKERQLGTESFVFKS-----------------RMHSVIG
A0A348PT57      RLMNP-RISL--LGVVPKY----SKNIPLSQLIIDK-----------------NPKSVMA
A0A3D3LSK1      ---SK-GVSL--LSWIPNIEQITDKSDPTNDFIVAK-----------------KPSSQIS
                                                                            

A0A1H6Z2F8      EQFRSLRTNI-------QFV--VGER------QN-TVVLLTSSMADEGKSFVAMHLAHSL
A0A2P8G5K0      EQFRSLRTNI-------QFT--TGER------PH-MVILLTSAMANEGKSFVAMHLAHSL
A0A3D4CJE1      ESFRTIRANL-------QFI--SNKP------GS-KVMAITSTVSGEGKTFVAINIAGII
R5DEG6          EAFRIVRTNM-------DFM--RVKE------KNMQVVMFTSFNPGAGKTFVSINLAMSF
A0A1G1TG88      EAIRSIRTNL-------DFI--SSA-------KKKRLISVTSTISGEGKTFVTVNLAGII
A0A3M1TXY5      ESFRSLRVKM-------LFV--VEG-------DKKKVIGVTSSSSGEGKTFCATNLAATL
A0A2E0VQ27      SLVSGLTANL-------RDL--PKPETK----GQAQLFVLSSNMPNEGKTFVSARIAKAM
R6U429          EAFRVLRTNL-------DFM--TGGQ------EGCHKVMITSFNPTAGKTFVLMNMAATM
A0A350V3E4      EAFRTLRTRL-------QFS--KLEP------EPIKTILITSSIPREGKTIISSNLAASF
A0A212J9Z9      ESFRNMRVRI-------EYM--AQR-------ENKITVLVTSTEPADGKTFIATNIASVY
F5IV23          ESFRNMRVRI-------EYM--AQR-------ENKITVLVTSTEPADGKTFIATNIASVY
F8X2T0          ESFRNMRVRI-------EYM--AQR-------ENKITILVTSTEPADGKTFIATNVASVY
A0A1M3LAG1      ESFRNMRVRI-------EYM--AQR-------ENKITILVTSTEPADGKTFIATNVASVY
A0A212K6G4      ESFRNMRVRI-------EYM--AQR-------ENKITILVTSTEPADGKTFIATNVASVY
A0A1M5DFS8      ESFRNMRIRL-------EYM--AQK-------ETGISVLVTSAEPGDGKTFIAGNIASVY
A0A2V3PNY7      ESFRNMRIRI-------EYI--AQK-------ETGISTLITSAEPGDGKTFIAGNIASVY
A0A015VNG0      EAFRVLRTNL-------EFM--TGKD------KRSNVIVVTSFNPGSGKSFLTMNMAVSF
A0A142HHS5      EAIRSIRTNL-------DFI--SPS-------NKKRLISVTSTISGEGKTFVTVNLGGII
A0A1M6MYT6      EPYSAIRTKL-------ELI--TKG-------KEHAVIAVTSSFPSEGKTYNAINIASSV
A0A2P8CDS1      ETYRALRMKL-------KFM--LNG-------TEQPVIAVTSTGSDEGKTFTAMNLAASF
A0A353WYK7      EAFRSIRTNL-------EFI--KRT-------DKNTVIAITSTVSGEGKTFVTVNLGGVI
A0A136LSC7      EAIRTLRTNL-------EFF--NTG-------EKCKVITITSTVSGEGKSFLAMNLGGVL
A0A355BP94      EAIRTLRTNL-------DFF--TSS-------ETNKIIVISSTVSGEGKSFLAMNLGGIL
A0A161LWY6      EAYRMVRTRI-------KFV--SRQ-------MDASCVIVTSTESGDGKTHFCLNYASMC
A0A239K409      ELFRLIRTNL-------QFV--VQG-------GERKVILVTSSVSGEGKTFFSLNLGASL
A0A1G9B1T9      ESFRTIRSNL-------LLQ--NHVN------GASKTLLVTSSVSNEGKTLCSVNLASSF
A0A2W4RDE8      ESFRSLRVNL-------QYL--TLG-------KEVNVIGITSSRESEGKTYCSVNLAAAM
A0A1V5S1J9      EAFRVIRTRI-------EFL--SGK-------SKGISVMVTSSQSGDGKSYISANIAGVF
A0A0A2EYC8      EQLRVIRTKI-------ELI--LKR-------KERITMLVSSTESGDGKTYISLNLAGVF
A0A2G6H6Y4      EQLRVIRTKV-------EII--LGR-------KEAITMLISSTESGDGKTYMSLNLAGVF
A0A1M3DPL8      EMFRIIRTRI-------EFI--AKR-------KTDITIMVTSSESGDGKTYFCINLACIY
A0A1V5F519      EMFRVIRTRV-------EFV--VRR-------KTDIVMMVTSVDAGDGKTFFSTNMAGVY
A0A2G6R1T9      EMFRVIRTRI-------EFI--VQR-------KTGIMMLGTSTESGDGKTYVNINLASVY
A0A0L8VEV2      ESFRELRTNL-------QFI--VPGLK-----NKSLVIGVNSVIPGEGKSFTAANLASMI
A0A1I2A9Z9      ESFRELRTNL-------QFV--APKKN-----NECTIIGVNSVISGEGKSFTSANLASMI
A0A3D0FMX4      EQLRALRTRI-------EFV--VRR-------KTGIMVLTTSAQSGDGKTYLSTNLAALY
A0A1M3MEI8      EMFRIIRTRI-------EFI--TQR-------KDKITIMVTSSESGDGKTYFSLNLASVY
A0A1J5HQM0      EMFRVIRTRI-------EFI--VQR-------KKNIMVAVTSSESGDGKTYFSINMAGVY
E4T131          EMFRIIRTRI-------EFI--VQR-------KTNIIVMTTSTESGDGKTYFSINLASVY
F4KR18          ERFRTLRTNL-------QFH--QR--------EKTKSILVTSSTSDEGKTFVATNLAMSF
A0A350PNH9      EAFRVLRTNL-------EFM--IGTH------PEQNVIILTSFNPGSGKSHLAGNIAMSL
A0A354LNT9      EAFRVLRTNL-------EFM--IGTH------PEQNVIILTSFNPGSGKSHLAGNIAMSL
A0A389LWV6      ENFRHLRSRM-------IYL--TKR-------DSPIVMLITSTEPRDGKTFVACNLASAY
A0A2W7RD29      ESFRLLRTNL-------NFI--LPN-------SESTVLLVSSVLPAEGKSFTSVNLATAF
A0A3N2NDY8      ESFRIVRGNI-------DFM--IRGK------EGGNVIMITSFNPGSGKSFISFNLSASF
L1M9T3          EAFRTVRTKL-------EFS--MGFD------NGCKVIMVTSMNPGSGKTFITANLSTAY
D7JEV9          EQLRVIRTKI-------EFI--LKR-------KEKITVLISSTESGDGKTYISLNLAGVF
A0A2W7QSQ0      EQLRMIRSNL-------KFQ--SG--------DNNKVILVSSSMSGEGKTFFCLNLAATL
R7F6L5          EAFRVVRTNL-------DFF--LTSDK-----KGAQVIMVTSANPGSGKTFITMNLAVAL
C9LKL0          EAFRMLRYGL-------NFM--R---------HSAKVCVVTSSTPGQGKSFISRNLAAIM
A0A3D0QPV7      EAFRTIRTNM-------QFL--TAD-------KDAKLVSVTSTISGEGKTFVAINLAGMI
A0A3C0I8F1      EALRSVRTNL-------DFV--LNKSGGLNDTSTSKVISITSTISGEGKTFVAANLAGII
R5JJI4          EAFRIIRTNM-------EFM--RVKS------DNLQVVMFTSANPGAGKTFVSSNLAMSI
A0A1F3D6P8      ESFRNLRSSL--------FL--KLKS------EKSKVIVITSSQPKDGKSFISFNLAASI
A0A356Z058      ESFRNLRSSL--------FL--KLKS------EKSKVIVITSSQPKDGKSFISFNLAASI
A0A3D1BT36      ESFRNLRSNL--------FF--RSKT------NPLKVILVTSCQPQDGKSFVAMNLASSI
A0A352ME00      ESFRNLRSSL--------FL--KSDH------EKSKVILITSSQPQDGKSFVSLNLSSSI
A0A3D3HL11      ESFRNLRSSL--------FL--KFRS------EPQKVIMITSAQPQDGKSFVSSNLAASI
A0A3D2HF71      ESLRSVRTNL-------KYF--MKD-------ISNPVIAVSSTITGEGKTFVAVNLAAII
B5CTK0          EAFRIIRTNM-------DFM--RMKK------DNMKVVTFTSMMPGAGKTFVSMNLALSF
A0A229I3A5      EAFRVLRTNF-------EFT--IGTH------PEQNVIVFTSFNPGSGKSHIAANMAMSL
A0A3R6HJB3      EAFRVLRTNF-------EFT--IGTH------PEQNVIVFTSFNPGSGKSHIAANMAMSL
A0A0A2DQN2      EAFRILRSNM-------DFM---GQNG-----VMPKRIVLTSFGAEAGKSYISYNLAKSL
A0A0A2F2N5      EAFRVLRTNM-------GFM--KKYGR-----TSGQRIMCVSFGANAGKTFTTYNLARSL
L1NGW4          ESFRVLRENL-------RFM--IGSGD-----TPSKKIIFTSFGESAGKSYVSYNLAKTL
Z4WRA0          ESFRVLRENL-------RFM--IGSGD-----TPSKKIIFTSFGESAGKSYVSYNLAKTL
U2K8K9          EAFRVLRENM-------RFM--IGSAA-----GKTKKIIFTSFGESAGKSYVSYNLAKTL
A0A069ZM60      EAFRVLRENM-------RFM--IGTGG-----KKAKKVIFTSFGESAGKSYVSYNLAQTL
J6GV98          EAFRVLRENM-------RFM--IGTGG-----KKAKKVIFTSFGESAGKSYVSYNLAQTL
A0A134B4F8      EAFRVLRENM-------RFM--IGTGG-----KVAKKVIFTSFGESAGKSYVSYNLAQTL
A0A134B8C7      EAFRVLRENM-------RFM--IGTGG-----KVAKKVIFTSFGESAGKSYVSYNLAQTL
A0A1M6B6D5      EAFRSLRSSL-------QFL--YKQQG----ITGAKTVLLTSSVSGEGKTFCSINLASIF
A0A451FS66      EAFRSLRSSL-------QFL--YKQHG----VTGAKTVLFTSSVSGEGKTFCSINIASIF
A0A2E3GN39      ESFRGVRSNL-------EFL---DAD------KGFRSIAVTSTIPGEGKTFVAINLAAII
A0A3D1MEL0      ESFRGVRSNL-------EFL---EAE------KGFRSIAVTSTIPGEGKTFVAINLAAII
F0R0C9          EAFRVLRTNL-------EFM--TSEN------EKANVILLTSFNPGSGKTFLSLNIAGSL
A0A2A4N9A6      EALRSLRANL-------QFI---STN------PGPKIMAITSTISTEGKTFVAINMAGII
A0A368D1N7      ESFRGVRSNL-------EFL---EEE------KGFRSIAVTSTIPGEGKTFVAINLAAII
A0A3B8TU58      ESFRGVRSNL-------EFL---AAE------KNFRSIAVTSTIPGEGKTFVAINLAAII
A0A1T5IIR6      EAMRMLCTNL-------SFL--DSGK------KAPFVIATTSYSSSSGKTFITANMASCL
A0A3E0QD27      ESFRSVRTNL-------QFI---SNE------PGPKVVAITSTISGEGKTFVAINLAGVI
A0A0M1W1I6      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
I8WPR6          EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A0K2HKS3      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
B6W3W8          EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A1Y3Z9Z6      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A076IRY8      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A3A6AD54      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A3A6MIU7      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
I8WPP8          EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A372Y7D2      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A3E4JJC9      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A3E4WDQ0      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A414H9P2      EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
C3R5A8          EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
D1JY72          EAFRIIRTNM-------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSSNLAASF
A0A1C5XJA7      EAFRILRTNM-------SFM--AKKD------RPLQVITFTSFNSGAGKSFVAFNLADSL
R7CUW4          EAFRILRTNM-------AFM--SRKD------RPTQVITFTSFNEGAGKTFISCNLAMSF
D7J4K6          ESFRILRTNM-------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISRNLAMSL
Q8ABP9          ESFRILRTNM-------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISRNLAMSL
A0A174C2Q8      ESFRILRTNM-------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISRNLAMSL
D6D2Z5          ESFRILRTNM-------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISRNLAMSL
A0A1T3EDR4      EAFRILRTNI-------TFM--VNSG------ISPQVITYTSFSAGVGKTFNTLNLAASF
A0A174SDD8      ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
A0A1H7RFH3      ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
A0A412GR09      ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
A0A139L1N2      ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
A0A174TVL8      ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
A0A1H8BJR6      ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
R9H6G0          ESFRILRTNL-------GFM--LSQT------QERKVITLTSFNIGAGKTFISINLAASL
A0A081PBV5      EAFRILRTNI-------GFM--AA-G------KEQRVITFTSFNIGAGKTFTAINLAASF
A0A1I2AN85      EAFRILRTNI-------GFM--AA-G------KEQRVITFTSFNIGAGKTFTAINLAASF
A0A1H6CKR6      EAFRIFRTNL-------GFM--SAGD------KSQKVITFTSFNVGAGKTFSVINLGVSL
A0A235E1C0      EAFRIFRTNL-------SFM--SSGD------KKQKVITFTSFNVGAGKTFSVINLGVSM
R6D982          ESFRILRTNL-------GFV--ASQS------PGQKVVTLTSFNVSAGKTFVSVNLSASL
A0A078PL82      EAFRILRTNL-------GFM--ISQP------QEQKVITLASFNMGAGKTFVSVNLAASL
A0A078QKV9      EAFRILRTNL-------GFM--ISQP------QEQKVITLASFNMGAGKTFVSVNLAASL
A0A1F0I8C4      EAFRILRTNL-------GFM--ISQP------QEQKVITLASFNMGAGKTFVSVNLAASL
A0A3A5RIJ2      EAFRILRTNL-------GFM--ISQP------QEQKVITLASFNMGAGKTFVSVNLAASL
A0A0B8T471      EAFRILRTNI-------GFM--SSAE------REIRVITFTSFNVGAGKTFTAVNLAASL
A0A0D5BSQ0      EAFRILRTNI-------NFM--AKNG------EPPRVITFTSFSAGVGKTFSALNLATTL
A0A1T3F6P5      EAFRILRTNI-------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVLNLAATL
A0A0W8EPA0      EAFRILRTNI-------NFM--TKDE------HPPQVITFTSFSAGVGKTFSVLNLAATL
A0A365UKN1      EAFRILRTNI-------NFM--TKNE------HPPKVITFTSFSAGVGKTFSVLNLAATL
A0A2T5RP38      EAFRILRTNI-------NFM--TKDD------APPKVLTFTSFSAGVGKTFSVLNLATTL
A0A1A6CF06      EAFRILRTNI-------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVLNLAATL
A0A1T3D6S8      EAFRILRTNI-------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVLNLAATL
A0A376E091      EAFRILRTNI-------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVLNLAATL
A0A1P8E011      EAFRILRTNM-------SFM--AREG------KHPQTITLTSFIPGVGKTFTSLNLSSTL
A0A1V3N3U3      EAFRILRTNI-------NFM--SREG------RAPQVITFTSFGVEVGKTFSSINLSATL
C2FUH6          EAFRIIRTNI-------GFM--SRNG------NSPQVITFTSFSIGAGKTFTALNLAATL
A0A239XXC4      EAFRIFRTNL-------SFM--SSGD------KKQKVVTFTSFNVGAGKTFSVINLGVSM
A0A2X2J8S4      EAFRILRTNI-------NFM--SRGG------VPPKVITFSSARVGAGKTFSVINLATTL
A0A3C0S618      EAFRILRTNI-------NFM--SRGG------VPPKVITFSSARVGAGKTFSVINLATTL
A0A1T4NDR5      EAYRALRTNI-------MYK---NFD------APIKVINITSATQGEGKSTTCLNLAVVF
A0A2U0UJ71      ESYRNLRTNI------------FLSG------KDTKVVMFTSCGPNEGKSTVTMNLASSI
A0A2T2TDL4      -------------------LQLGRPD------ETNTTVLVTSPGSGDGKSLTAANLATVT
A0A3D1AEJ6      ---------M-------DFM--RVKQ------DNIKVITTTSTSVGSGKTFVSSNLAASL
A0A1V5S5I3      EAFRVLRTNL-------EFMLDAKTG------GKAGVTLFTSFNPGSGKTFLAMNTAAVF
R7JFY1          EAFRILRANM-------DFM--RGGD------EHMQVLLFTSMNAGAGKTFISSNLAASL
A0A2M7VVW6      EAFRTIRTNL-------QFI--S-KS------EESKLMAITSTISGEGKTFCAINLSGII
A0A413V760      EAFRIIRTNM-------DFM--RVKA------ANLQVVMFTSANPGAGKTFVSSNLAMSI
A0A3D5KRM7      DLFRVLRTNI-------LKQ---LRE------NNWNSFFITSATPGAGKSWVATNLAIAI
A0A3M1NUH2      ESYRHLRTNI-------QFS---RPD------TVVETIVVTSPSVEEGKSTTAANLAVVM
A0A1V6HYH8      ---------------------------------------MTSTISGEGKTFVAINLGGIL
A0A359ATS6      EAFRVVRTNL-------EFMD-GSGE------PDSNVLMLTSFNPGSGKTFLTMNMAISL
A0A2U0UG39      EAYKNLRTNI-------QLC---GS--------DIKVIMLTSTTPGEGKSTVSFNLAVSL
A0A2E0MDX6      ---------M-------QFI---ANN------EGSKIITVTSTISGEGKTFVAINLGGII
A0A2M7KCE1      EAFRSVRSSL-------EFI---KNI------KESKTIAISSTISGEGKTFIALNLGGIY
A0A3M1Y2F5      ECFRAVRVHIYNKLTNKREK--IDVS------ERGILLGVCSTWSDEGKSFCAANLAASF
A0A2T2UAJ4      EAYRRIRTNL-------RFA--KPDD------D-LQTMAVSSADKGDGKTTTCANLALAL
A0A3D4RLG4      EMLRTIRTKI-------EFI--VGRK------Q-NIVLSITSTQSGDGKTFLATNLAALY
A0A3N2LCI3      EAFRVLRTNV-------EFM--CNSS------EGNKVIAMTSFNPGSGKSFVSMNLGMAI
A0A2T4XEQ1      ESYRRLHNNI-------IYS--QPDL------EV-KTILVTSPGKGEGKTTTAVNLAGIL
A0A2K8ZAP1      EQIRALRTNL-------LFL--NGDA------QKNQVILFTSSISGDGKSFMSLNLGASL
A0A348PT57      EAFRTLRTNL-------DFF--QTDN------EK-KIIAVTSTISGEGKTFVAINLGGIL
A0A3D3LSK1      EAFKALRTRI-------TFS--KLED------KPLKTILVTSSLPSDGKTIVSVNLAGSF
                                                         *     **:    . .   

A0A1H6Z2F8      ALASRK-VLLVDFDLRKPTLASLLNL---RP-----EGVTEHIALEK--DLL---IQQ--
A0A2P8G5K0      ALAGKK-VLLVDFDLRKPSLATLLNL---RP-----NGVTECIASGH--EPL---IQQ--
A0A3D4CJE1      AYSGKK-VIILDLDMRKPKIHLGFNVE--ND-----RGMSTLLIGN---DSLNNCIKH--
R5DEG6          ALTHKK-VVLVDLDIRKGTLSSHVQV---SD-----MGVTNYLSGRI--DNVDEIIQK--
A0A1G1TG88      AMSGQR-VIVLDLDMRKPKVNLAFGAE--NV-----KGVSTILIDR---HSVAECIQH--
A0A3M1TXY5      AHAGKQ-TLLIDTDLRRPKVQTYFRTE--HH-----AGLSDFLCGEV--DYVNEIIHS--
A0A2E0VQ27      AAYGYK-VLLLDLDVRKPELHEELGMD--NS-----DGFCEAIKSDR--HALDLVQ----
R6U429          ALKGAK-VLLLDLDLRKGTLGKALEHNK--------SGISAFLNGKL-----ESIVPE--
A0A350V3E4      ALSS-R-VLLLDCDFRKPRMHNIFNMK--RY-----PGLCDYLFGT---VTIEEAVRE--
A0A212J9Z9      QLMGKK-VIIVDLDLRRPSVAKTLQID--SQ-----KGISNYLIGQ---VTLDEIIYS--
F5IV23          QLMGKK-VIIVDLDLRRPSVAKTLQID--SQ-----KGISNYLIGQ---VTLDEITYS--
F8X2T0          QLMGKK-VIIVDLDLRRPSVGKTLQVD--AQ-----KGISNYLIGQ---VTLEEIIIS--
A0A1M3LAG1      QLMGKK-VIIVDLDLRRPSVGKTLQID--AQ-----KGISNYLIGQ---VTLDEIIIS--
A0A212K6G4      QLMGKK-VIIVDLDLRRPSVGKTLQID--AQ-----KGISNYLIGQ---VTLDEIIIS--
A0A1M5DFS8      QLTGRR-VVLIDFDLRRPSVAKLLNLQ--SK-----KGVSNFLIGQ---VSLDEITVT--
A0A2V3PNY7      QLTGKK-VVLIDFDLRRPSVGKLLSIE--SK-----KGVSNYLIGQ---VTLDEITIT--
A0A015VNG0      AIKGKK-VLVIDGDLRHGSASSYIDSPA--------KGLSDYLGGRI--DNLNEIIVA--
A0A142HHS5      ALSGQR-VVILDLDMRKPKVNLAFDAE--NV-----RGISTILIDR---HTVAECIQH--
A0A1M6MYT6      ALSNKT-AVILDLDLRKSRINEDIGLK--IE-----KNVVDYILGK---ATLEEITHK--
A0A2P8CDS1      ALLGQK-AVLLDLDLRNSKMAEMHNYD--KN-----RGVSNYLLGE---MRLEDITFR--
A0A353WYK7      SLLKSK-VVLVDLDMRKPRLQKVFYHN--IQ----AKGVSTILIEK---HSVEECILK--
A0A136LSC7      ALSRKR-VILVDLDMRKPKSEKYPTGN--DS----SMGMSTILIKK---NNWQECVLK--
A0A355BP94      AMSNKK-VILLDLDMRKAKEILHARVT--DP----SKGISTLLIHK---TTLEESITK--
A0A161LWY6      AMTGEP-TILVDMDLRKPSVSKRLSLE--NE-----TGITNCMLGQ---VSLDDAIIK--
A0A239K409      ALTGKN-VVVLDFDLRKQSILADLGLA--CE-----FGITDYLSFNT--VTVEEMLNQ--
A0A1G9B1T9      AVANNR-TIIIDADLRRPRVHNILEKT--NG-----VGLSNYLQGT---ADMSEIIQP--
A0A2W4RDE8      ANSRRR-TILIDADMRRPKVASYFQLE--ND-----KGLSNYLIGE---ASLKEIINE--
A0A1V5S1J9      AMTGRK-TILVDLDMRKPSINTGL---YLSV----NKGISNYLANQ---ISLDEAIVK--
A0A0A2EYC8      ALQKKK-VLLIDFDIRKPNLTRNLGD-IIKT----KSGFVNYMIGD---CTIEEAIES--
A0A2G6H6Y4      GLQNKK-VLLIDFDIRKPNLTENLQESLSKH----KVGFVNYMIGE---CSLEEAIDT--
A0A1M3DPL8      AMASPK-TLLVDMDIRKPSVYQTI---GCDN----NMGVSNFLANQ---CSLDEIIVR--
A0A1V5F519      GMTGHK-TLLIDMDIRKPAINRRF---NVNH----PKGVTNYLINE---CTLDEIINV--
A0A2G6R1T9      GMTGKK-TLLIDMDIRKPSVGDRL---GISE----KAGVTNYLIGE---NELDDLIIK--
A0A0L8VEV2      ALNNKR-VLLIDCDLRKPSLHNRLKYK--NK-----EGLSTYLTDFS---SFDDIFRQ--
A0A1I2A9Z9      ALNNKK-VLLVDCDLRKPSLHNRLKYK--NK-----EGLSTYLTDFS---TFEDIFRQ--
A0A3D0FMX4      AMSGKK-TLLMDMDIRKPNIHEKLGTS--IE-----KGLTNYLIGE---ISKQEMIQH--
A0A1M3MEI8      GLASPR-TLLVDLDIRKPSIHKRLGVE--NS-----LGLTNFLVGQ---CKAQDIIMR--
A0A1J5HQM0      SMASKK-VLLVDLDIRKPSIHERFNIN--PS-----QGITNFLVGQ---ATLDEVIIH--
E4T131          AMASKK-TILVDMDIRKPSVNQRFNIV--HP-----LGVTNYLVGQ---CALDEIILK--
F4KR18          ALAKKK-TIVVDFDLRKPSISKYFEGN--AE-----IGLSSFLINQ---LEVEEVIQT--
A0A350PNH9      AIKKKK-VLVIDGDLRRGATSMLVGSPG--------EGLSDYLNGRT--DDLEGIICHGE
A0A354LNT9      AIKKKK-VLVIDGDLRLGSTSMLVGSPG--------EGLSDYLNGRT--DDLEGIICHGE
A0A389LWV6      QMTGKK-TLMIDFDLRRPALSKALDLD--TQ-----KGLSNFLIGKA--SLADVVISH--
A0A2W7RD29      ALTELK-VLIIDCDLRKPKVSDYLGVD--NT-----AGLSNYLSRR---VDDESTIVK--
A0A3N2NDY8      ALKGKK-VLVVDGDLRHGSASQFVDMPS--------KGLSNYLTGNT--DNWQSLVVP--
L1M9T3          ALKGKR-VLVMDLDLRKASLSQYVGNPQ--------IGLSNYLSGQI--NDWHKIIIP--
D7JEV9          ALQNKK-ILLIDFDIRKPNLTKNLGGMVKNK-----LGFVNYMIGDC---SLNEAI----
A0A2W7QSQ0      SIVDKK-VVVVDLDLRRPSIFKSLNIK--SK-----HSLFDYLNHDI--KDLKEIITP--
R7F6L5          ALKHKR-VLMIDFDLRRAALSNAFGSPR--------EGIANYLCGAD--QMSDIVQHN--
C9LKL0          GMANKR-VLLVDADIRKRTLSSKFGRS---------NGLTGWLVDEEEKLSLDEIIIK--
A0A3D0QPV7      AFSGKK-VVILDLDMRKPKIHIGFGTD--NE-----VGMSSLLIGRD--QLEQCIR----
A0A3C0I8F1      AMLNLK-VLIIDFDMRRPKVHIAFDREEEDN----LKGTSTILIGRH--TPQECIQHT--
R5JJI4          AQTNKK-VVLVDVDIRKGTLSGIFSNPS-GR-----MGLTHYLSGRT--DGLDDIIGA--
A0A1F3D6P8      AIVGYK-TIIIDCDLRKPTLHEKFKED--NS-----SGISNFMVKNA--TVTEIIR----
A0A356Z058      AIVGYK-TIIIDCDLRKPTLHEKFKED--NS-----SGISNFMVKNA--TVTEIIR----
A0A3D1BT36      ASVGHK-TIILDCDLRRPTLHDKFKID--NE-----GGITKYLTDKN--VDNDIIL----
A0A352ME00      ASVGYK-TVLIDCDLRRPTLHIKLKED--NA-----KGISNFMIKKA--TADEIIR----
A0A3D3HL11      ASVGHK-TVLLDCDLRRPTLHEKLKIV--NS-----VGLSNYMVNNA--STKEIIK----
A0A3D2HF71      ALPGKK-VLLIDLDLRKPKAHKILGNND-NT-----EGISKYLIGES--KIEDIIIKT--
B5CTK0          ALTDKK-IILMDLDIRKGTLSAHSKR---KE-----LGVTDYLSGKI--ADLNQIIVK--
A0A229I3A5      AIKKKK-VLLIDGDLRHGSTSMLIHS---PG-----EGLSDYLNGRI--ADIHDILYKGE
A0A3R6HJB3      AIKKKK-VLLIDGDLRHGSTSMLIHS---PG-----EGLSDYLNGRI--TDIHDILYKGE
A0A0A2DQN2      VFAGKS-VVLIDIDIRKRTLTRKLNFE--HN-----MGLTSYLSGMD--VSIDELIQQ--
A0A0A2F2N5      IFADKK-VVIVDLDLRKGMMSKRLEMS---G-----RGMTNYLSDDS--IKIEDVLRQ--
L1NGW4          TFSGST-VVIVDLDLRKGTLSRRAHVA---G-----QGVTEYLVDKA--MPVEKIIHK--
Z4WRA0          TFSGST-VVVVDLDLRKGTLSRRAHVA---G-----QGVTEYLIDKA--MPVEKIIHK--
U2K8K9          TFSGHR-VVLVDLDLRKGTLSHRAGII---G-----KGVTEYLSDPT--VQVDQIIRK--
A0A069ZM60      TFAGHS-VVLVDLDLRKGTLSRRIGLA---G-----MGATEYLSNPD--VRLDQILRK--
J6GV98          TFAGHS-VVLVDLDLRKGTLSRRIGLA---G-----MGATEYLSNPD--VRLDQILRK--
A0A134B4F8      TFAGHS-VVLVDLDLRKGTLSRRIGLA---G-----MGATEYLSNPD--VRLDQILRK--
A0A134B8C7      TFAGHS-VVLVDLDLRKGTLSRRIGLA---G-----MGATEYLSNPD--VRLDQILRK--
A0A1M6B6D5      ALSDKK-TIIIDLDLRKPKVGAAFNIQ--NS-----MGVVNYLINEA---DLDGIIQK--
A0A451FS66      ALSEKR-TVIVDLDLRKPKVSGAFNMD--NS-----IGVVNYLINEA---DLDTITQK--
A0A2E3GN39      AMQGKR-VLLVDVDLRKPRIHKIFDLP--NS-----AGMSTLLNKRS--TKEDITFST--
A0A3D1MEL0      AMQGKR-VLLVDVDLRKPRIHKIFDLP--NS-----AGMSTLLNKRS--TKEDITFST--
F0R0C9          ALKGKK-VLIIDGDLRKASVSAFIDS---PK-----TGLSDYLGRKT--DAIDTAVVE--
A0A2A4N9A6      ALSGKK-VIILDLDLRKPRIHKAFEID--NA-----KGMSTILIGKD--KVEDCIFKS--
A0A368D1N7      AMQGKR-VLLVDVDLRKPRIHKIFDLP--NS-----SGMSTLLNKRS--IKEDIIFST--
A0A3B8TU58      AMQGKR-VLLVDVDLRKPRVHKIFNLP--NS-----AGMSTLLNKRS--IKEDVTFST--
A0A1T5IIR6      ADAQKR-VILVDTDMRKRSLSGVFALKH-KT-----KGLSNYLYDLD--LTLDDILFK--
A0A3E0QD27      AFSEKR-VVIIDLDMRKPKIHLGFNVE--NT-----KGMSTILIGKD--EA-DNCIRK--
A0A0M1W1I6      AQTDKK-VILIDMDIRKGTLTSHTRLHT-EE-----KGMTSFLAGKA--TT-DEIIKH--
I8WPR6          AQTDKK-VILIDMDIRKGTLTSHTRLHT-EE-----KGMTSFLAGKA--TT-DEIIKH--
A0A0K2HKS3      AQTDKK-VILIDMDIRKGTLTSHTRLHT-EE-----KGMTSFLAGKA--TT-DEIIKH--
B6W3W8          AQTDKK-VILIDMDIRKGTLTSHTRLHT-EE-----KGMTSFLAGKA--TT-DEIIKH--
A0A1Y3Z9Z6      AQTDKK-VILIDMDIRKGTLTSHTRLHT-EE-----KGMTSFLAGKA--TT-DEIIKH--
A0A076IRY8      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
A0A3A6AD54      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
A0A3A6MIU7      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
I8WPP8          AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
A0A372Y7D2      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
A0A3E4JJC9      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
A0A3E4WDQ0      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
A0A414H9P2      AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
C3R5A8          AQTDKK-VILIDMDIRKGTLTSHTRLHT-KE-----KGMTSFLAGKA--TT-DEIIKH--
D1JY72          AQTDKK-VILIDMDIRKGTLTSHTRLHT-EE-----KGMTSFLAGKA--TT-DEIIKH--
A0A1C5XJA7      AYTKKK-VILIDLDIRKGSLSHRMHK---HG-----VGMTNYLADET--IALDDIIHD--
R7CUW4          VYARKR-VVVIDLDIRKGTLSRHLGE---HR-----TGVTNYLADTT--VTVDDIIRK--
D7J4K6          VLTRKR-VVLVDLDIRKGTLSRHFHK---HP-----VGVTNYLADDS--IRLDDIIHT--
Q8ABP9          VLTRKR-VVLVDLDIRKGTLSRHFHK---HP-----VGVTNYLADDS--IRLDDIIHT--
A0A174C2Q8      VLTRKR-VVLVDLDIRKGTLSRHFHK---HP-----VGVTNYLADDS--IRLDDIIHT--
D6D2Z5          VLTRKR-VVLVDLDIRKGTLSRHFHK---HP-----VGVTNYLADDS--IRLDDIIHT--
A0A1T3EDR4      SYMKKR-VVLVDLDLRKGTLSTRVGLE--GK-----AGVSHYLSGLL--RDINTVIYH--
A0A174SDD8      VQTEKK-IVLLDLDLRKGKLSEMSHCT--QV-----KGVAHYLSNPS--IEVNDIILR--
A0A1H7RFH3      VQTEKK-IVLLDLDLRKGKLSEMAHCR--QV-----KGVAHYLSDSS--VEVTDIIVQ--
A0A412GR09      VQTEKK-IVLLDLDLRKGKLSEMAHCR--QV-----KGVAHYLSDSS--VEVTDIIVQ--
A0A139L1N2      VQTEKK-IVLLDLDLRKGKLSEMAHCR--QV-----KGVAHYLSDSS--VEVTDIIVQ--
A0A174TVL8      VQTEKK-IVLLDLDLRKGKLSEMAHCR--QV-----KGVAHYLSDSS--VEVTDIIVQ--
A0A1H8BJR6      VQTEKK-IVLLDLDLRKGKLSEMAHCR--QV-----KGVAHYLSDSS--VEVTDIIVQ--
R9H6G0          VQTEKK-IVLLDLDLRKGKLSEMAHCR--QV-----KGVAHYLSDSS--VEVTDIIVQ--
A0A081PBV5      RYLNKK-VLLLDLDLRKGTLSNRVNAQKEKG-----LGVTNFLANPK--VTVDDIIYQ--
A0A1I2AN85      RYLNKK-VLLLDLDLRKGTLSNRVNAQKEKG-----LGVTNFLANPK--VTVDDIIYQ--
A0A1H6CKR6      TYLKKR-VVLVDLDLRKGTLSNITKFP--MP-----IGATHYLSDSA--ITVDEIIYK--
A0A235E1C0      TFLKKK-VVLVDLDLRKGTLSNITKFP--MP-----IGVTHYLSDSA--ITVDEIIYK--
R6D982          VQADKK-VILIDLDLRKATLSLIAKARGNGI-----KGMAHYLSNKS--ISMDDIIMK--
A0A078PL82      VQAEKK-IIMIDLDLRKGRLSHFAHAK--RV-----KGVAHYLSNPL--VSADDIILH--
A0A078QKV9      VQAEKK-IIMIDLDLRKGRLSHFAHAK--RV-----KGVAHYLSNPL--VSADDIILH--
A0A1F0I8C4      VQAEKK-IIMIDLDLRKGRLSHFAHAK--RV-----KGVAHYLSNPL--VSADDIILH--
A0A3A5RIJ2      VQAEKK-IIMIDLDLRKGRLSHFAHAK--RV-----KGVAHYLSNPL--VSADDIILH--
A0A0B8T471      TFLLQN-VVLLDLDLRKGTLSDHLKLG--SV-----KGVTHFLADPA--VSLDHITYK--
A0A0D5BSQ0      SYLEKK-VVVIDLDLRKGTLSSRIDLL--HG-----KGVSHYLSSPS--VSVDEVLHK--
A0A1T3F6P5      SYLDKK-VVVLDLDLRKGTLSSRTGLL--HG-----KGTSHYLSNSS--IQISDILHK--
A0A0W8EPA0      SYLDKK-VVVLDLDLRKGTLSSRTGLL--HG-----KGTSHYLSNSS--IKISDILHK--
A0A365UKN1      SYLDKK-VVVLDLDLRKGTLSSRTGLL--HG-----KGTSHYLSNSS--IKISDILHK--
A0A2T5RP38      SFLEKK-VVVIDLDLRKGTLSSRVDLL--HG-----KGSSHYLSSPS--ISIDEIIHK--
A0A1A6CF06      SYLDKK-VVVIDLDLRKGTLSSRVDLL--HE-----KGTSHYLSNSS--ISVDEILQK--
A0A1T3D6S8      SYLDKK-VVVLDLDLRKGTLSSRTGLL--HG-----KGTSHYLSNPS--IKISEILHK--
A0A376E091      SYLDKK-VVVLDLDLRKGTLSSRTGLL--HG-----KGTSHYLSNPS--IKISEILHK--
A0A1P8E011      SFLNKK-VIVVDMDLRKGTLSERMGII--HG-----KGLSHYLSDVN--LELEEIIHY--
A0A1V3N3U3      SFMEKR-TVVVDLDLRKGTLSSRLGLL--DK-----IGCSHFLADAT--VTLDTVIYP--
C2FUH6          SFLDKK-ILILDLDLRKGTISSRVNVK--SA-----LGVSHYLSNSQ--VAIDDIICK--
A0A239XXC4      TFLKKK-VVLVDLDLRKGTLSNITKFP--MP-----IGVTHYLSDSS--VTVDEIIYK--
A0A2X2J8S4      SFLNKR-VIMVDLDLRKGTLSSRIPVP--VR-----KGITHYLSDKE--LNLSEVIYK--
A0A3C0S618      SFLNKR-VIMVDLDLRKGTLSSRIPVP--VR-----KGITHYLSDKE--LNPSEVIYK--
A0A1T4NDR5      SQLNKK-VLVMDLDLRIPTIHKKLRIR--NT-----MGITDLLNGRA--TVDN---VV--
A0A2U0UJ71      ADGGKR-VLFIDCDLRKSVLVGRYRVK--KG----VKGLTHFLSGQ---NTLEEVIYQ--
A0A2T2TDL4      AQAGHS-TLLIDGDLRRPRLHEVFDVS--RT-----PGITEALQ-----NDLDEHAMK--
A0A3D1AEJ6      AMTGKK-VLLMDMDIRKGTLGKGVDTH--KNIEGYDIGLTSYLSKIV--TKVESLIIQ--
A0A1V5S5I3      ALKGKR-ILVIDGDLRHGSASAYLGSR--HK------GLSDYLGKRE--NNLDGLIQE--
R7JFY1          VLTHQK-VVLLDLDIRKGTLGKQAGYR--GE------GITNYLSGKV--TDVTSLICQ--
A0A2M7VVW6      AMSGKK-VIILDLDMRKPKIHLGFGVK--ND----K-GMSTILI-DK--DQIKECIHH--
A0A413V760      AQTNKK-VVLVDVDIRKGTLSGIFSNS--SN----RMGLTHYLSGST--DKLDDIIGR--
A0A3D5KRM7      ALEGNQTVLLVDADLRHPSICNHLGLN--CK----F-GLIDYLSGVT--SLEQ--ILI--
A0A3M1NUH2      AEAGRR-TVLIDADLRRPRVHQLFGRE--LG----P-GLAHFLVQEP--RFDE--ELV--
A0A1V6HYH8      ALSNKK-VLIIDTDLRRPKMSITFNNL--ND----F-GLSNYLLGEC--NIEQ--CIK--
A0A359ATS6      AIKGKS-VLVIDGDLRRGSISD--YVD--TP----KIGLSDYLGKRI--DTPEEIIVV--
A0A2U0UG39      AEAGKK-VIFIDADLRKSVLVGRYKIN--TS----VKGLTHFLSGIN--KFEE--VMY--
A0A2E0MDX6      AFSEKK-VIILDLDMRKPKTHIGFNVQ--NT----I-GMSTLLIGQS--SLED--CIQ--
A0A2M7KCE1      SFQGKK-TILIDLDLRKPRFHLCFNTD--NS----K-GLSTILIGKN--KVHD--CIK--
A0A3M1Y2F5      GIGGYN-TLLVDLDLRNPSQPEYFRYP--RQ-----MGISNGLLGPE--RSHWKKWII--
A0A2T2UAJ4      ASAGKR-TIVVDADLRRPWMHEMLNVD--RD-----LGLSQVLYEGE--LDPE---AY--
A0A3D4RLG4      GMTGKK-TLLIDLDIRKPNIHEKLGVD--AG-----LGVTNYLIGEC--EIED--ILH--
A0A3N2LCI3      ALKGKK-VLIVDGDMRHGSTSAYMGSP--AK------GLADYLGGAV--SEVDTLIVK--
A0A2T4XEQ1      AESGKR-VLIIDFDFRRPNLHKTLGES--QT-----PGILELLFDGV--HFDD--VIR--
A0A2K8ZAP1      ALVNRK-TVIVDMDMRKPKLHKSLHIE--NK-----LGLSNYLTGEA--DLDN--LLH--
A0A348PT57      AFSDKK-VIILDLDMRKPRIHKGFNST--NE-----YGMSTYLSNRD--NLKD--IIR--
A0A3D3LSK1      ALDNKK-VILIDCDLRKPRVHTVFEFD--RF-----PGLSDFLFHHV--NFED--IVR--
                        :.:* *.*                     .    :                 

A0A1H6Z2F8      -C-ANGPPFDFIAAGMQS--MDDTMLSPKIAGLIPALKAGYD--YVLLDSPPVGLVADAR
A0A2P8G5K0      -N-SSETSFDFLAAGQQSPGTGEIILSPKVADLISTLKIRYD--YVLLDSPPVGLVADAR
A0A3D4CJE1      -S-AL-KGLDFITAGPIPPNPSELIINGNLTEIIEELKQTYD--LVIIDNPPIGLVTDAL
R5DEG6          -G-ELYDKLDIIHAGPVPPNPAELLLSDRLEALIAELRERYD--YIILDNVPAGVVADAV
A0A1G1TG88      ---TSIDALQFISAGPTPPNPSELILSPRFDQMLNELYESYD--VVMIDTPPVGLVTDGI
A0A3M1TXY5      ---THIENLHIIPAGNPSNNPTDLISNSRMKELVEACMDEYD--HIIFDTPPIGLVSDYL
A0A2E0VQ27      -N-TSDENLYFIPAGQYDDSLEGKVFSAKALDIIHDLRWHFD--MVIVDVAPIGLFDDSI
R6U429          IQ-NIKENLDLISVGSLPPNPAELLVSEKFDKMMDELSARYD--YIFMDCPPVDIVADTS
A0A350V3E4      ---TSFPNLHIMTCGTIPTNPAELIASKHMQTFLNMMKPKYD--YILIDSPPLATVTDAE
A0A212J9Z9      ---HPDYGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLVSDAY
F5IV23          ---HPDYGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLVSDAY
F8X2T0          ---HPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAY
A0A1M3LAG1      ---HPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAY
A0A212K6G4      ---HPDYGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAY
A0A1M5DFS8      ---HPEYEFDVITAGTLPPNPSELIKTKKTKDLIEYLKTKYD--YVVVDCSPIGLVSDAY
A0A2V3PNY7      ---HPEYEFDVITAGTLPPNPSELIKTKKTKDLLDHLKSKYD--YVIVDCSPIGLVSDAY
A0A015VNG0      -D-SKHESMDILPVGTIPPNPTELLFDERLKQVIDTVRERYD--YVLIDCPPIELVADTQ
A0A142HHS5      ---TSIESLDFISAGPTPPNPSELILNPRFDLMIQELYRTYD--VILIDTPPVGLVTDGI
A0A1M6MYT6      ---TKHPRLKVIPAGPHPPNPLQMLTDKNLSGLIDQLKKQYD--VVIVDTPPVGMVADFF
A0A2P8CDS1      ---STHPYMWLIPSGSFPPNPGELLADKKLKELIELLKEEYD--VIVIDSSPL-LVADLF
A0A353WYK7      ---TNLENLDYISSGPIPPNPSELIHTGSFDKMIGDLKSKYD--VVIIDTPPVGLVTDGI
A0A136LSC7      ---TSLENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYD--YVVIDTPPVGLVTDGV
A0A355BP94      ---TDMAGFDYIPSGPHPPNPSELLLSKAFEDLLAELRTRYD--YIVIDTPPVGLVTDGI
A0A161LWY6      -K-SPEINFDLLLAGTIPPNPGEMIRSPKLLELINELKMRYH--YVIIDTSPVGIVSDAY
A0A239K409      -S-DQVPNLFIVGSGAIPVNPAELMMSNRVEQLFEELQKKFD--YILIDTAPVGQVSDAF
A0A1G9B1T9      ---TDQENLYVITAGKSDGHPGEILLSERLPQLINKLKMEFK--FVVLDTPPVKIVTDAL
A0A2W4RDE8      ---TGIKGYDVITSGPIPPNPLDLIGTPRMAELLNELKQSYH--TIIIDSPPIGFVSEYI
A0A1V5S1J9      ---HPDYKFDILPVGVVPPNPGELIKSDNMNNLISILKETYD--YIVFDTSPIGLVTDAY
A0A0A2EYC8      ---TP-YGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYD--YVVIDSSPLGLVADAY
A0A2G6H6Y4      ---TG-YGFDFLKAGVMPPNPGEFVRSPKLEQMITELKSMYD--YIIIDTSPLGLVTDSY
A0A1M3DPL8      ---PDGAEFDFITAGTVPPNAGELIRSDNLKDMFDELRKRYE--YIIVDTSPIGVVADAY
A0A1V5F519      ---VPEVNYDVIFAGTVPPNPAELIRSEKIIEMMGELRKRYD--YIILDSSPIGLVTDSF
A0A2G6R1T9      ---NDDFSFDVLLGGTVPPNPGELIRSEKLKGMLKELRTRYE--YIIIDTSPI-------
A0A0L8VEV2      ---TRVENLQFVSAGPIPPNPSELLENGKFEELIERCRDMFD--YIVFDNPPLSLVSDGI
A0A1I2A9Z9      ---TRVDNLQFVSAGPIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIVSDGI
A0A3D0FMX4      ---DPSYEFDIIYAGSIPPNPGELIRSDQVVELLEELRSEYD--YIVIDSSPIGLVTDAY
A0A1M3MEI8      ---PDGAGFDFIPAGTIPPNAGELIRSEKLRTLFAKLKEYYD--YIIVDTSPIGVVADAY
A0A1J5HQM0      ---IPELEYDFLPGGTVPPNAGELIRSEKLVEMFQELRNRYE--FIVVDTSPIGIVADAY
E4T131          ---LPKVDFDILPAGSIPPNPGELIRSEKLGKMFEELRTRYD--FIIVDSSPIGMVTDAY
F4KR18          -S-GDLPNLDYISGGPFIPNVSEQLTEQQLSVLFAYLKSKYD--VIIIDSSPIGVVSDGM
A0A350PNH9      EY-GLVKDFDVLPIGTMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIVADTQ
A0A354LNT9      EY-GLVKDFDVLPIGTMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIVADTQ
A0A389LWV6      ----PDFGFDILPAGTIPPNPSELINSEMTKKLLSFLSKEYE--YIILDCSPVGLVSDAH
A0A2W7RD29      -A-TSIPGLSCITSGPYPPNPSELIANKEIIKLLIKMKDQFD--IIILDTPPLGIVSDSM
A0A3N2NDY8      -V-AGQNGMSVMPIGHRPPNPSELLDNGRIGQFLDEARKEYD--YIFVDCPPTDVVVDTQ
L1M9T3          -----LGQVDCLPSGVIPPNPAELLSTSRFRDLIETVRQEYD--LIFIDCPPVEIVADAE
D7JEV9          -E-STPYGFDFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLVADAY
A0A2W7QSQ0      -S-GINSNMDIIGLNKSIENASEIITSQKIIKLINSLKSSYD--HIIIDTSPIGLVADAY
R7F6L5          -V-NDVEGLDLIGVGNLPPNPSELLYSERLKTLLSTMEQEYD--FIFFDCPPIEVVADSR
C9LKL0          -D-GVAKQVDFLPAGMLPPNPSELLMSSRLEALVEEARELYD--FIIIDTTPILAVSDAS
A0A3D0QPV7      -K-SEMENLHFITAGPIPPNPAELIINGKLDSILEELKRIYD--IVIVDLPPVGLVTDGI
A0A3C0I8F1      ----PIENLDFIPSGPIPPNPSELILRPICDEFIKQLTLSYD--VIILDTPPIGLVTDGV
R5JJI4          -S-EEYGKLDIIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADAS
A0A1F3D6P8      -N-TSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLVADAT
A0A356Z058      -N-TSVENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLVADAT
A0A3D1BT36      -K-TFVDNLDFIPAGPVLPNSSELIEAGALDKLIQYLEDNYE--YIIIDTTPSGMVADAA
A0A352ME00      -N-TAITNLDFISAGPVIPNPSELMESGILDNLINYLKTKYD--YIIIDTTPVGIVADAI
A0A3D3HL11      -K-TDVDNLWFIPAGPILPNSSELIEAGVLDSLIEELKQQFD--YVIIDSTPAGLVADAT
A0A3D2HF71      ----EVENLWYAPAGPIPPNPAELIESESMKEFIDKAKKDFE--FIIIDTPPAAVVTDAL
B5CTK0          -G-KLHANLDMIYAGAVPPNPAELLLSERLDQMIEELRTRYD--YIIVDNVPAGMIADAA
A0A229I3A5      EN-GLVKNFDVIPIGTIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVVADTP
A0A3R6HJB3      EN-GLVKGFDVIPIGTIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVVADTP
A0A0A2DQN2      -D-PNCEMLSIIPAGTIAPNPTELLLSKRLDSLIDELGRRYD--YVIMDNVPFGVVADAS
A0A0A2F2N5      -D-KNCPSLHVIPIGSSAPNPAELLMSERLDALMDELSARYD--YVLIDGVPFGIVADAT
L1NGW4          -D-PNFSKLAIIPAGAIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSVADAA
Z4WRA0          -D-PNFSKLAIVPAGAIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSVADAA
U2K8K9          -D-PNAPKLSVIASGAVPPNPAELLLGERLDELADKLSEQFD--FVVFDNVPFGSVADAA
A0A069ZM60      -D-PNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAA
J6GV98          -D-PNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAA
A0A134B4F8      -D-PNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAA
A0A134B8C7      -D-PNAPKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAA
A0A1M6B6D5      -T-EI-DTLDVITSGPIPPNPSELLLGERLDQLLGLLKDQYD--YIILDSPPMGLVSDAL
A0A451FS66      -T-EV-DYLDVIPSGPTPPNPSELLIGERMDEFMERLKERYD--YIILDSPPIGLVSDAM
A0A2E3GN39      -S-E--ENLWAVPAGPIPPNPSELIGGEPFINFIDEVKTSFD--VVIFDTPPIGLVTDSI
A0A3D1MEL0      -P-E--ENLWAIPAGPIPPNPSELIGGDSFVNFLDEVKTSFE--VVIFDTPPIGLVTDAI
F0R0C9          -A-PQCPGLYILPVGTLPPNPTELLAEDRFGKLVAGLRDRYD--YIFIDCPPIEIVADTQ
A0A2A4N9A6      -N-I--DTLHFIPSGPIPPNPAELIINQRTEELLAVLRKQYD--LIVIDTPPIGIVSDGI
A0A368D1N7      -P-E--ENLWAIPAGPIPPNPSELIGGDSFVNFLDEVKTLFE--VVIFDTPPIGLVTDAI
A0A3B8TU58      -S-E--ENLWAIPAGPIPPNPSELIGGDSFVNFIEEIKTSFD--VLVFDTPPIGLVTDSI
A0A1T5IIR6      -D--VKSGIDFIPAGAVPPNPTELLGRPRLEELIEALRQKYD--YILLDGVPIQMLADPI
A0A3E0QD27      -S-NL-TNLDFITAGPIPPNPSELILSRKMVELVEYLKSKYD--VVIIDTPPVGIVTDGV
A0A0M1W1I6      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAA
I8WPR6          -N-EICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAA
A0A0K2HKS3      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAA
B6W3W8          -N-EICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAA
A0A1Y3Z9Z6      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAA
A0A076IRY8      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
A0A3A6AD54      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
A0A3A6MIU7      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
I8WPP8          -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
A0A372Y7D2      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
A0A3E4JJC9      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
A0A3E4WDQ0      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
A0A414H9P2      -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
C3R5A8          -N-EICENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAA
D1JY72          -N-EICENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAA
A0A1C5XJA7      ----CGKDYDFINAGTSAPNPAELLMDSRLDSMMEELRKRYD--YIVVDNVPVGLVADAT
R7CUW4          -----GEHFDIIASGPVAPNPAELLLDSRLDTLIAELRTRYD--YIIVDNVPVGIVADAT
D7J4K6          -D-GKFDNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIVADAT
Q8ABP9          -D-GKFDNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIVADAT
A0A174C2Q8      -D-GKFDNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIVADAT
D6D2Z5          -D-GKFDNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIVADAT
A0A1T3EDR4      -R-EIGLGVDVIPLGAIAPNPVELLLSKHLDELIEALKLKYD--YVIVDGVPMGIVADAN
A0A174SDD8      -D-AFGEGLDLVPIGVIAPNPTELLLSKRLDELVDKLRERYD--YIIVDNVPIGLVADAT
A0A1H7RFH3      -D-TFGEGLDLVPIGVIAPNPTELLLSKRLDKLVAELKERYD--YIIVDNVPIGLVADAT
A0A412GR09      -D-AFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADAT
A0A139L1N2      -D-AFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADAT
A0A174TVL8      -D-AFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADAT
A0A1H8BJR6      -D-AFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADAT
R9H6G0          -D-AFGEGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADAT
A0A081PBV5      -G-LVGGIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLVADAS
A0A1I2AN85      -G-LVGGIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLVADAS
A0A1H6CKR6      -D-RVDANIDIVPIGVIAPNPVELLLSERLDRLFVELKERYD--YIIVDNVPLGIVADAD
A0A235E1C0      -D-RTDAEIDIVPIGVIAPNPVELLLSDRLDTLINELKERYD--YIIVDNVPLGIVADAD
R6D982          -D-GFGERIDLIPVGVIAPNPAELLLSGRLDELIGHLRERYD--YIIVDGVPVGMVADVS
A0A078PL82      -D-AFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADAS
A0A078QKV9      -D-AFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADAS
A0A1F0I8C4      -D-AFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADAS
A0A3A5RIJ2      -D-AFGEGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADAS
A0A0B8T471      -A-NVGNGVDVIPIGVIAPNPVELLLSKRLDVLIAQLKERYR--YIVVDNVPIDLVADAA
A0A0D5BSQ0      -S-EVANGVDFVPIGAIAPNPVELLLSKRLDELINELKERYD--YVIIDGVPVGIVADAS
A0A1T3F6P5      -S-EVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADAS
A0A0W8EPA0      -S-EVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADAS
A0A365UKN1      -S-EVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADAS
A0A2T5RP38      -S-DVAEGVDFIPIGAIAPNPVELLLGKRLDELITKLKERYD--YVIIDGVPVGIVADAS
A0A1A6CF06      -S-ELLENVDVIPIGAIAPNPVELLLSKRLDELINELKNRYD--YIIIDGVPTGVVADAS
A0A1T3D6S8      -S-EVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADAS
A0A376E091      -S-EVAEGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADAS
A0A1P8E011      -N-LHGKNVDYISIGMEAPNPVELLLSKRLDQLISDLRNRYD--YIIIDGVPTGIVADAT
A0A1V3N3U3      -V-KGLEFLDCVPIGLIAPNPVELLLSARLDELIAELRKRYD--YIVVDGVPLGIVADAS
C2FUH6          -S-GIADNVDIISIGMVAPNPVELLLGKRLDELIADLRNRYD--YIIVDGVPVGLVADAS
A0A239XXC4      -D-RTDSEIDIVPIGVIAPNPVELLLSERLDQLIAELKERYD--YIIVDNVPLGIVADAD
A0A2X2J8S4      -T-EVSDNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEIIADAY
A0A3C0S618      -T-EISDNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEIIADAY
A0A1T4NDR5      -K-PVFKNIDVITTGTKIIYHSEFIQSTALMNFIERMKDEYD--IILLDCPPVGIVTDAL
A0A2U0UJ71      -T--NVPDMDVILAGPVPPNPSELLDSPLFKETVRQMREKYD--YVIIDTPPLGSVIDAA
A0A2T2TDL4      -R-PLIDNLCVLPAGTEVENPAKVLGSSRFRDFLQRAEQYFD--HVIVDSSPVLATADGP
A0A3D1AEJ6      -D-QDYPNIDIIRSGPEPPNPAELLLSPRLDELIRELREMYD--FIVIDNVPAGMVADAM
A0A1V5S5I3      -N-PDIPGFFLLPAGTIPPNPTELLAEPMFKEAIERLRGNYD--YIFIDCPPIDIVADTQ
R7JFY1          -D-ELVPGLDVIHAGPVPPNPAELLQNKRLDAMIAELRTRYD--YILLDNVPAGLVADAQ
A0A2M7VVW6      -S--ELTNLDFITSGPIPPNPSELIISGKLDEVIAELKKEYD--LVVLDNPPIGLVSDAM
A0A413V760      -S-EEYDKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADAS
A0A3D5KRM7      -H-PKIENLVLLPGKESKVNYSELISSPKMIEFIKETKSRYESRIIIFDVPPLFVADDAL
A0A3M1NUH2      -A-TPIDNLWIIPAGKVVPRSSELFATRVMRDFIESLRARFD--VIILDTPPVRVATDAA
A0A1V6HYH8      -G-TEINNLFYFPAGSLPEYPNELLTSSKMDELLENLKKYYD--IIILDTPPIGLISDTT
A0A359ATS6      -D-KKHPTLHILPVGTIPPNPTELLVEERLKELINRMRSRYD--YILIDCPPIDVVADTA
A0A2U0UG39      -A-TNVENFNVVFSGPVPPNPTELLGNKVFKTLIKVLRDLYD--YIIIDTPPIGSVIDSA
A0A2E0MDX6      -K-SHLENLHFITAGPIPPNPAELIISNKMTDVINELKNLYD--VIVIDTPPVGIVTDAF
A0A2M7KCE1      -K-SKIANLDYITAGPIPPNPSELTAGNEILNVINELKQIYD--VIIIDTPPLGLVTDAL
A0A3M1Y2F5      -K-DVESQIDILPAGPHLPNSIDLLDTGAFEELIEELPLHYQ--YVIVDLPPIMQASDYM
A0A2T2UAJ4      -A-TEVENLFVIPAGDTVPNPAELLGSNRMKEFVEALEAKFD--YVLIDTPPALLFSDVL
A0A3D4RLG4      -K-DTSYNFDFLLAGTIPPNPGELIRTDKLVSLLQELRKQYD--FIIIDTSPIGQVPDAF
A0A3N2LCI3      -T-PECQNMQVLPIGSIPPNPTELLESPRFGELIGELKSRFD--YVIIDCPPIEVVADAQ
A0A2T4XEQ1      -E-TAYPGIHCLTTGRRSPNPASVAQSDKLKSIVEGVKDQYD--YVVIDSAPYGIITDAA
A0A2K8ZAP1      -PIIGHENYYIITAGSLPLNPSELLSSPRLANLLQELKERFE--YILVDSPPIGLVTDSQ
A0A348PT57      -K-SELDGLHFITAGPIPPNPSELIISGNLTKGLDELKKIYD--IIIIDNPPVGLVTDGI
A0A3D3LSK1      -D-SGFDNLSVITAGTIPPNPSEMLGSLQMKKFLELVESKYD--IVILDSPPLISVTDSE
                                                        :    :..*  *        

A0A1H6Z2F8      LLGPYADMTLYIVRQHFT-------FIHQLAE-LQKASEQ-----LPDLQIVIN------
A0A2P8G5K0      LLGAHADMTLYIVRQHFT-------FIHQLAE-IQNARNQS---LLPDLHVVLN------
A0A3D4CJE1      YTISMADYPIYVLRANYS-------KKEYLKN-AYRIYEEN---NIHKLSLVLN------
R5DEG6          IVNRVADLTIYVVRAGRM-------DRRALPE-VEKLYREG---KLRNMSLILN------
A0A1G1TG88      LIMRRADIPIYIVRADYS-------RKAFIKN-MNRLMRTN---NLTRMCTILN------
A0A3M1TXY5      ILMHLTDYNIYVVRHNVT-------EVADLKL-INELFETG---KIQNIGLLLN------
A0A2E0VQ27      VLMRKSTANLFLIRKGTT-------RLRQLKP-INELLDSF---QIPNLYLVLN------
R6U429          IIAKHADYTVFVIRAGLF-------DKRALPA-VEDAYERG---VYNHMAVILN------
A0A350V3E4      LLSSYVDGTVVVSLASKT-------RLDLLVN-TIDTLNKI---NDTFIGVILN------
A0A212J9Z9      ILSEIADTTLFVVRRAKT-------NKSFFKS-VITQLKYD---GVEDIALVFN------
F5IV23          ILSEIADTTLFVVRRAKT-------NKSFFKS-VITQLRYD---GVEDIALVFN------
F8X2T0          ILSSMADTTLFVVRRAKT-------NKAFFKS-VITQLGFD---GVENIALVFN------
A0A1M3LAG1      ILSSMADTTLFVVRRAKT-------NKAFFKS-VITQLGFD---GVENIALVFN------
A0A212K6G4      ILSSMADTTLFVVRRAKT-------NKAFFKS-VITQLGFD---GVENIALVFN------
A0A1M5DFS8      ILSKYVDTSLFVVRRAKT-------NKAFFKS-VVNQMRND---GLDHVAIVFN------
A0A2V3PNY7      ILSKYVDTTLFVVRRGKT-------NKAFFKS-VVSQMRND---GLEHAALVFN------
A0A015VNG0      IIEKLADRTIFVVRAGLL-------ERSMLAE-LEKIYEEK---KYKNMSLILN------
A0A142HHS5      LIMRKADVPIYIVRANYS-------RKTFLKN-MNRLMRNN---QFTRMTTILN------
A0A1M6MYT6      LLRDMFDAAVFIVRHKST-------PKKPLKD-ILEELESH---QIEELGIIVN------
A0A2P8CDS1      QYSHLCNAYLYVSRQGVT-------PQPAIKS-ALQEISNQ---HIRNVGILLN------
A0A353WYK7      LALKKSDIALFVVRSGFS-------KKSFIQN-IDRLVKAH---HLDQSSIIFN------
A0A136LSC7      MAMKRSDLSIYVFRANYS-------HKDFLQN-LARVVTLN---KLTHVSSVLN------
A0A355BP94      MAMKRADLSIYVVRANYS-------RKEFLSN-LERIVSIN---KLSHVAVVLN------
A0A161LWY6      PLAPISDCVIYITRSRKT-------NKKFFKS-VINQLKTD---RMQHVGVVLN------
A0A239K409      SLSKYVDLTVCLVRYNYT-------PKHEIEN-INDILYNN---KFKQPMIVLN------
A0A1G9B1T9      VLSAYSDINILVARRGVT-------SKSQLMD-VEELHQNN---TLHNLYVVLN------
A0A2W4RDE8      ILMKYTDANIYVVRSDYT-------TKYNLDR-INKLYDER---KVTNISILLN------
A0A1V5S1J9      GIIESVDIILYAVRAEQT-------NKSFYKK-AMSQLEAN---NVKKVGLIFN------
A0A0A2EYC8      ALFSTVDIKLLIVRSLKT-------NKVEFTD-LAKRLYAD---NVEDIYVILN------
A0A2G6H6Y4      ALFPMVDVKLLVVRSFKT-------SKREFSE-LTRRLYMD---KVKNVYIILN------
A0A1M3DPL8      SFAALSDINLFVIRSNKT-------NKQFVKT-LSNQLKED---TKSRFYSILN------
A0A1V5F519      SLASLADVNLLVVRNNKT-------HKDFFKN-VVNQIVTD---KLSNFYVVFT------
A0A2G6R1T9      ------------VRNEKT-------NKAFFKR-INEQIVSD---KFNNFYIVLN------
A0A0L8VEV2      VIGQKVDINLFVTRQDYS-------KKNEVRF-IDHVNKKK---AMKNAGIILNDI----
A0A1I2A9Z9      IIGQKVDINLFVTRQDYS-------KKNEVKF-IDHVHRKK---SMKNPGIVLNDI----
A0A3D0FMX4      ALIERSDITLFVVRYNKT-------QRNFCRE-VLAQMEED---GKQNIYIVFSDLPHER
A0A1M3MEI8      SFADLSDINLFIVRSDKT-------HKLFLRT-LTAQLKSD---NVHDFYSILNDVELKS
A0A1J5HQM0      AIAHLSDINIFVARSGKT-------SKSHFAK-ISKQLKSD---NV-EAYCILNDVMSEE
E4T131          SLAQHSDVNLFVVRNGKT-------NKTFFKK-LCAQLKLD---NIPQLYTVLNDVLDDE
F4KR18          LLNNYVDNTLFVVRSNFT-------KKATIAK-AREIFEQN---KLVNPAIIFN------
A0A350PNH9      IIEKLADRTIFVVRSGLM-------QRSMLGD-IEQFYKDK---KFKNMSLILN------
A0A354LNT9      IIEKLADRTIFVVRSGLM-------QRSMLGD-IEQFYKDK---KFKNMSLILN------
A0A389LWV6      FLAKLADVVLYVVRNEKT-------NRNFFKHTISEFKGDV---TSGKMAIIYN------
A0A2W7RD29      SLFPLVDVSLLAFKCGYN-------NHKGIVE-LNKLKSND---FIKKVYCILN------
A0A3N2NDY8      IVEKYVDRTIFVVRAGLL-------DRKALEE-IDAIYRNK---RFKQMSIVLN------
L1M9T3          IINPVADLTLFVVRAGLM-------ERSFLND-IERWYLDK---KFHNLTLLLN------
D7JEV9          ALFSVVDIKLLVVRSFKT-------NKMEFTD-LSKRLYSD---NIEDIYIILN------
A0A2W7QSQ0      SLSEIVDLVVYVVRMNYT-------RVDNLHA-LAEIIDEN---IFKQNFVVLN------
R7F6L5          ILNEYVDTTIFVIRAGLF-------DRRMLKS-IRNLYAER---RYNNMCLLLN------
C9LKL0          IVDRVADVTLFVIRVGVQ-------VRAFLPE-LEKMNKDK---KYRHLCIALN------
A0A3D0QPV7      PIVQMADYPIYVFRANYS-------KKNFVQN-ADRLVNEN---NIQRLSVVLN------
A0A3C0I8F1      LLMQKAEVPIYIFKANYS-------KKAFSKS-INKLILKN---NFTNLSVVLN------
R5JJI4          IVNRVADLTIFVVRSGVM-------DRRQLPE-LEKMYREE---QLCNMCVVLN------
A0A1F3D6P8      QLIRYATHILLVTRINYT-------RKDILEH-VLKNFSSN---RITNYDAVLN------
A0A356Z058      QLIRYATHILLVTRINYT-------RKDILEH-VLKNFSSN---RITNYDAVLN------
A0A3D1BT36      QLIKYSSINLLVCRNNHT-------RKDVFNS-VLNFYKTH---NIENFDIIYN------
A0A352ME00      LMMKYASKVLMVIRNNYT-------RKDIFAN-VINNLKSN---KLTNYDIVYN------
A0A3D3HL11      LMIKYASYILLVCRNDYT-------RKDVFTD-VLNLFRTN---NITDYDIVFN------
A0A3D2HF71      LLADLADFYIFVVRQRFS-------SKNTVEL-IEELYRNE---TIGRIGIVMN------
B5CTK0          IVNRIADWTLYIVRAGVL-------DRKQLPD-VDALYKSG---QFTNMALILN------
A0A229I3A5      IYEQFADRTIFVVRAGLM-------ERSMLPE-VNALYKEK---KFKNMTLILN------
A0A3R6HJB3      IYEQFADRTIFVVRAGLM-------ERSMLPE-VNALYKEK---KFKNMTLILN------
A0A0A2DQN2      IVNRAADLTLFIIRAERM-------DRRMLPE-LERLYQEQ---VLTNMAIILN------
A0A0A2F2N5      IVNRVVDLTLFILRSGTV-------DRRVLPD-LQLLYDEK---ILNNMAIVLN------
L1NGW4          IANRIADLTIFVLRAARL-------DKRALPE-LQRLYDNE---ILRNMSIVLN------
Z4WRA0          IANRIADLTIFVLRAARL-------DKRALPE-LQRLYDNE---ILRNMSIVLN------
U2K8K9          IANRVADLTIFILRAAKL-------DRRALPE-LQRLYDDH---ILTNMAIVLN------
A0A069ZM60      IANRIADLTIFVLRAGRL-------DRRALPE-LQHLYDEN---ILTNMSIVLN------
J6GV98          IANRIADLTIFVLRAGRL-------DRRALPE-LQHLYDEN---ILTNMSIVLN------
A0A134B4F8      IANRIADLTIFVLRAGRL-------DRRALPE-LQHLYDEN---ILTNMSIVLN------
A0A134B8C7      IANRIADLTIFVLRAGRL-------DRRALPE-LQHLYDEN---ILTNMSIVLN------
A0A1M6B6D5      VLTKHVDATLYMVRQNYT-------HKNMLTF-VNEKFRRG---EVKHISIVIN------
A0A451FS66      EIIKYADATLYMVRHNRT-------RKNMLTF-VNEKYKRG---EIKHISIVLN------
A0A2E3GN39      PVISTVNNPIYVLRADYS-------HRSFVGH-IESTKENL---QVPSLSIIMNDYGRGV
A0A3D1MEL0      PVISGTNNPIYVLRADYS-------HRSFVGH-IESTKDNL---KVTNLSIVLNDYGRGV
F0R0C9          IIEKVADRTLFIVRAGLL-------ERSMLAE-LETIYQEK---RFKNMAVILN------
A0A2A4N9A6      DIIRKADYPLYIFRADYS-------KKDFVKI-MNKLMNDH---KISKLALILNESGGGS
A0A368D1N7      PVISRANNPIYVLRADYS-------HREFVGH-IESIKDNL---KVPNLSIVLNDYGRGV
A0A3B8TU58      PVISKVNNPIYVMRADYS-------HRSFVGH-IESTKENL---QIPNLSIIVNDYGRGV
A0A1T5IIR6      VLNRVVDINLFILRSGQL-------DRRILPQ-LDELNDKH---HLHNMAIVFN------
A0A3E0QD27      DVIQNADYPIYIIRAQYS-------KRMFINN-LNRLIEES---KVRNLAVVLN------
A0A0M1W1I6      ITNRIADLTIFVVRVGKL-------DRRMLPE-LEKIYRSG---QLNNMSLVLN------
I8WPR6          ITNRIADLTIFVVRVGKL-------DRRMLPE-LEKIYRSG---QLNNMSLVLN------
A0A0K2HKS3      ITNRIADLTIFVVRVGKL-------DRRMLPE-LEKIYRSG---QLNNMSLVLN------
B6W3W8          ITNRIADLTIFVVRVGKL-------DRRMLPE-LEKIYRSG---QLNNMSLVLN------
A0A1Y3Z9Z6      ITNRIADLTIFVIRVGKL-------DRRMLPE-LEKIYRSG---QLNNMSLVLN------
A0A076IRY8      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
A0A3A6AD54      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
A0A3A6MIU7      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
I8WPP8          ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
A0A372Y7D2      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
A0A3E4JJC9      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
A0A3E4WDQ0      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
A0A414H9P2      ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
C3R5A8          ITNRIADLTIFVVRVGKL-------DRRMLPE-VEKIYRSG---QLNNMSLVLN------
D1JY72          ITNRIADLTIFVVRVGKL-------DRRMLPE-LEKIYRSG---QLNNMSLVLN------
A0A1C5XJA7      IANRIADITIFVVRAGRL-------DKRQLPD-IEKLYQEK---VLNNMALILN------
R7CUW4          IANRIADLTVFVVRSGRL-------DRRQLPD-IESLYEDK---KLHNMALVLN------
D7J4K6          ITNRISDLTIFVVRAGRL-------DRRLLPD-MEELYRDN---KLRNMAIILN------
Q8ABP9          ITNRISDLTIFVVRAGRL-------DRRLLPD-MEELYRDN---KLRNMAIILN------
A0A174C2Q8      ITNRISDLTIFVVRAGRL-------DRRLLPD-MEELYRDN---KLRNMAIILN------
D6D2Z5          ITNRISDLTIFVVRAGRL-------DRRLLPD-MEELYRDN---KLRNMAIILN------
A0A1T3EDR4      IIDRISELTLFIIREGKL-------DRRMLAE-LENIYQER---KLSNLGIVFN------
A0A174SDD8      VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
A0A1H7RFH3      VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
A0A412GR09      VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
A0A139L1N2      VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
A0A174TVL8      VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
A0A1H8BJR6      VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
R9H6G0          VVNRITDLTLFIVRVGKI-------DRRQLPE-LERLYQEH---KLNNMAVVLN------
A0A081PBV5      IVDRISELTIFVVRSGKM-------DRRQLPE-IQSLYDQR---KISHMAVLLN------
A0A1I2AN85      IVDRISELTIFVVRSGKM-------DRRQLPE-IQSLYDQR---KISHMAVLLN------
A0A1H6CKR6      IVNRITDVTIFVVRAGKM-------DRRQLPD-IQKLYSSG---SLTNLAILLN------
A0A235E1C0      IVNRITDVTIFVVRAGKM-------DRRQLPD-IQKIYDSS---ALTNMAILLN------
R6D982          ISNRISDVTLFIVRAGKL-------DKRQLPE-LERLYQEH---KLNNMAVVLN------
A0A078PL82      VVNRISDLTLFIVRVGKL-------DRRQLPE-LERLYQEH---RLNNLAVVLN------
A0A078QKV9      VVNRISDLTLFIVRVGKL-------DRRQLPE-LERLYQEH---RLNNLAVVLN------
A0A1F0I8C4      VVNRISDLTLFIVRVGKL-------DRRQLPE-LERLYQEH---RLNNLAVVLN------
A0A3A5RIJ2      VVNRISDLTLFIVRVGKL-------DRRQLPE-LERLYQEH---RLNNLAVVLN------
A0A0B8T471      VVNRISELTVFVVRAGAM-------DRRLLPE-IEKIYRKG---KLNNMAILLN------
A0A0D5BSQ0      IIDRVADLTLFIIRVGKM-------DRRQLPE-IEKIYQEK---KLSNLAIVLN------
A0A1T3F6P5      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKLYQEK---KLSNLAIVLN------
A0A0W8EPA0      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKIYQEK---KLSNLAIVLN------
A0A365UKN1      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKLYQEK---KLSNLAIVLN------
A0A2T5RP38      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKIYQEK---KLSNLAIVLN------
A0A1A6CF06      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKIYQEK---KLSNLAIVLN------
A0A1T3D6S8      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKLYQEK---KLSNLAIVLN------
A0A376E091      IIDRVADLTLFIIRIGKM-------DRRQLPE-IEKLYQEK---KLSNLAIVLN------
A0A1P8E011      VVDRVSDLTLFVIRAGKM-------DKRQLPE-IQKIYAEK---RLSNLAIILN------
A0A1V3N3U3      IVDRISDLTLFMIRAGKM-------DRRQLPE-IEKIYRDR---KLSNLAVALN------
C2FUH6          IVNRISDLTIFMVRVGKM-------DRRQLPE-IEKIRQEG---KLSNMSVILN------
A0A239XXC4      IVNRITDVTIFVVRAGKM-------DRRQLPD-VQKIYDSS---ALTNMAILLN------
A0A2X2J8S4      ITDRVSELTIFVIRSGKM-------DKRELPD-IEKIYQSK---KLSNMAILFN------
A0A3C0S618      ITDRVSELTIFVIRSGKM-------DKRELPD-IEKIYQSK---KLSNMAILFN------
A0A1T4NDR5      IVSKYSDGTILVCESDKN-------DKKTLIR-VKYQFDEV---ESKVLGVVITKA----
A0A2U0UJ71      IVAQVCDGAVLVIAANQV-------SYKFAQN-VMGQLKKT---KIKIIGSVLNKV----
A0A2T2TDL4      LLSDLCETTLCVARAGTT-------TEAELDH-AMEVLSGI---GANVAGVVFNGF----
A0A3D1AEJ6      ISNRVTDLTLYIIRAGKM-------DRRMLPE-IEQLYREE---RLKNMAVILNGT----
A0A1V5S5I3      IIEKLADRTVFVVRAGLL-------ERDMLPE-LQRMYDEH---RFKNMALVLNGT----
R7JFY1          IVARLADLTICVIRAGVL-------DRRQIPA-LEMLSRR-----FPKFSLVLNYV----
A0A2M7VVW6      EMLKKADYPIYVFKSEYS-------RKNFINN-LNKLIVEN---GIKKLSIVLNGV----
A0A413V760      IVNRVADLTIFVVRSGVM-------DRRQLPE-LENMYRQE---QLRNMSVILNGV----
A0A3D5KRM7      LYMSYCDAALFVVEDEKN-------TVDEIKH-SMKILEET---NL--LGIVLNKS----
A0A3M1NUH2      LLATQCDLTLVVVRAGQT-------REGELEF-AMESLAAV---GAPAIGTVFNGF----
A0A1V6HYH8      KFVLLADTTVYVFRSEYS-------KKEFIVN-LEKLKQEL---NPKEIIIVLNGF----
A0A359ATS6      IIEKLADRTIFVVRAGLL-------ERSMLVE-LEKIYNEQ---KYKNMCVILNGT----
A0A2U0UG39      IVAQECDGVAYVMAANDV-------SYKYAQK-GLEQIKKT---DCKLLGVVLNKV----
A0A2E0MDX6      PIISKVDYPVYIVRAHFS-------KKVFLKN-IQMLRDKK---KIKNLSVILNGA----
A0A2M7KCE1      NIFKSCDYPIYVVKAHYS-------KRSFLYN-LNHLLLEK---HIENLSVVVNGI----
A0A3M1Y2F5      LVEKWLDFTAFVVR----------HQQTRLQD-LERINELFEQERIGKIGLLINHV----
A0A2T2UAJ4      GLAPRCDGTLLVVAAGETDGRAFDHAAEMLAD-GEADVAGAVLNQFDASSSVLQ------
A0A3D4RLG4      ALIEQTDLTLYVIRCMQTNKY---FCKNTLQQ-MEADYKDKVQLVFSDMPVEKKR-----
A0A3N2LCI3      IIDKFADRTFFVIRA----GL---FDRSMLPE-LDRLYEEK---KYRNMSFILNG-----
A0A2T4XEQ1      PMMKMADGIVVSVRFNKT------QTNELAQT-LEN----------------LENIHVSI
A0A2K8ZAP1      VIAPYADATIFVVRHDHT-------PKNYIKM-VDALYKEQ---RFQKLSIVLNGV----
A0A348PT57      ASLKLADYPIYIFRNEYS-------KKSFIDN-INRIFIEN---KITNLSAVLNSVDLSR
A0A3D3LSK1      ILYNLTDGTVLVAQAEKT------DKKAFFKT-YNQLKRIN---PHNLLGAVLNNF----
                                                                            

A0A1H6Z2F8      -GT---RDLHRYQ---------------YN---YY-------------------------
A0A2P8G5K0      -GT---RSLHRYQ---------------YN---YY-------------------------
A0A3D4CJE1      -SVDFEQGQYGYG---------------YG---YGYGYG-YGY-----------------
R5DEG6          -GTVYKHGTYGYH---------------YG---YGYGYG-YGY-----------------
A0A1G1TG88      -DAQSKGA-YGYG-------------YGYG---YGYGSGTYGQGYYEDHGSAPPPTLAQK
A0A3M1TXY5      -GVASLSD--------------------YGYLDTDYGINGYVKKGKKRKRYEAIN-----
A0A2E0VQ27      -GVRQKAKKGAYA--------------RYL----------------KKRKPAPALS----
R6U429          -GVDTTSKSYGYG------------HYGYG---YGYGYG-YGYGYGNNVQD---------
A0A350V3E4      -NFDYQAT--------------------YG---SYYKYYYYYYGSEKGKESAGTNGKSTN
A0A212J9Z9      -DVKGREG--YYGTSRY-----------YGDRTYYLKKNSYYHDDYFEN-----------
F5IV23          -DVKGREG--YYGTSRY-----------YGDRTYYLKKNSYYHDDYFEN-----------
F8X2T0          -DVKGREG--YYGTSRY-----------YGDKTYYLKKNSYYHDDYFES-----------
A0A1M3LAG1      -DVKGREG--YYGTSRY-----------YGDKTYYLKKNSYYHDDYFES-----------
A0A212K6G4      -DVKGREG--YYGTSRY-----------YGDKTYYLKKNSYYHDDYFES-----------
A0A1M5DFS8      -DVKGREG--YYGTSRY-----------YGDKSYYLKRNSYYHDDYFEK-----------
A0A2V3PNY7      -DVKGREG--YYGTSRY-----------YGDKSYYLKRNSYYHDDYFEK-----------
A0A015VNG0      -GTEGSGGRYGYR---------YGYRYGYH---YGYGYG-YHYGSDEKRGG---------
A0A142HHS5      -D---AKAQGSYG-------------YGYG---YGYGYG-YGYGTKGMGYYDETE-QKPT
A0A1M6MYT6      -NVYRTKSNRGYG-------------YGYG---YGYGYG-YGYGHDTDSNQ-----KKGK
A0A2P8CDS1      -DI--RINNQPLG-------------DRYN---YSYMYG-YGYKTQKPKNRPAAYWRKVN
A0A353WYK7      -ANRSSKN--------------------YGYGSYGKSYGYYE--EPEYLES---------
A0A136LSC7      -AIPLSGN--------------------Y----YG--YGYYE--DKTPRRK---------
A0A355BP94      -ALPTSGK--------------------T----YG--YGYYH--EDQKKRS---------
A0A161LWY6      -DIDANTG-------------------GYG---YNYSYQRYGYGTYGNNPV---------
A0A239K409      -GAK-----------------------KFNSNKYGYGYGYVKK-----------------
A0A1G9B1T9      -DVQATK--------------------GHG----------YYE-----------------
A0A2W4RDE8      -DVKYSRV------------------NGYS---YSYKYKQKKYKQRSYKAV---------
A0A1V5S1J9      -DVNLKKLEYS------------RYYDSYG----SYGKK-SGY-YY---YDKKFKSPRSQ
A0A0A2EYC8      -DVDKSKV---------------GYGYGYS----KYKKM-GNY-YVTEEFEQDDISMLEK
A0A2G6H6Y4      -DVDRSKTGYGYG---YG----YGYGYGYG----GSKKN-NAY-YVTAEFEKENTTAFQR
A0A1M3DPL8      -DVEIESASYSQY---YSRKYVYGRSKSYGLGTYGYGYG-YGY-TSSGRSKHKGN---NT
A0A1V5F519      -DVETD-----------------GNYYSYK---YGYSSK-YGY-YTS--KGQKNI---DE
A0A2G6R1T9      -DINITSKAYGR----------YGYGYGYG---YGYGYG-YGY-GYG--VKNKKD---NQ
A0A0L8VEV2      -HLSKHAHVGAYG-------------ADYS---HRKNSSYYYFDSSPSYTG---------
A0A1I2A9Z9      -HVSKHAHVGSYG-------------ADYS---YKKKSSYYYFESSPSYTG---------
A0A3D0FMX4      -SGRYNYNSKSYH---YG----YG--YGYG--YGGYGYG-YGYGYGSRKKG--------T
A0A1M3MEI8      -NSYSRYYSRKYA---YGNSRRYGTKSGYG--Y-GYGYG-YGYTKVSDKKN--------S
A0A1J5HQM0      -SRYSRYYSRRYG---YG----YG--YGYG--S-GYGYG-YGYGNTRKKKE--------A
E4T131          -SKYTKYKLYKYA---YL----FG--FSYG--Y-----------TSKKKKG--------D
F4KR18          -GVKKQND--AYG---Y----------SYK--DYGYA-----------------------
A0A350PNH9      -GTKAQGG--RYG-HYYR----YGYHYGYG---YGYHYG-SDKNGGAKIGK---------
A0A354LNT9      -GTKAQGG--RYG-HYYR----YGYHYGYG---YGYHYG-SDKNGDAKIGK---------
A0A389LWV6      -DVDLDGN--YYASRNY-----------YG--KSSYYHKHNSYYNNDEFVDEQNQN----
A0A2W7RD29      -GVDSHYH-------------------------IGSNKN-YGYYEVYKDNK---------
A0A3N2NDY8      -GTEAASR-KSYG--------------AYG--YYG-------------------------
L1M9T3          -GTTDALG--RYGYHKY----------GYG--YGGYGYGGYGYGK---------------
D7JEV9          -DVDKSKI-------------------GYV---YGYGYGMHKKMGNYYVTEEFEQDDVSI
A0A2W7QSQ0      -----DSN--EYS--------------GSK---FGYGYYSGKDTDVVSTRA---------
R7F6L5          -GTSVGHN---YG---YG----YGYGYGYG---YGYGYG-YAY-GDDNDKK---------
C9LKL0          -DVDVKAK-YGYG---YG----Y----GYG---YGYGYGNYSYGYGEQYNN---------
A0A3D0QPV7      -SVDTDRGSSGYN---Y----------GYG---YGYGYG-YGY-TYGGNYYTERTNATEK
A0A3C0I8F1      -AVNKRFS--------Y----------GYG---YGYGYG--AYYGKRSVAYYNDSESNYK
R5JJI4          -GVSYERRSYGYG---Y----------GYG---YGYGYG-YGY-GNEHHGNNKQGVAKRI
A0A1F3D6P8      -SLPLDTS--PYR--------------HYT--SY------YLKK----------------
A0A356Z058      -SLPLDTS--PYR--------------HYT--SY------YLKK----------------
A0A3D1BT36      -DVEIKES--RYG--------------RYH--GY------YKKPKAFTARK---------
A0A352ME00      -DLNLHKS--SYR--------------HYS--NY------YIKN----------------
A0A3D3HL11      -DLNLKKS--RYG--------------RYD--NY------YKQ-----------------
A0A3D2HF71      -DISLTGY-YGYG---LR----YGYAGGYG---YSYGYNYYGD-----------------
B5CTK0          -GVDFKHA-HKYG---Y----------GYG---YGYGYG-DTK-TKHKKKS---------
A0A229I3A5      -GTKAHGG--RYG-----------SHYGYG---YGYGYG-YNYNKEKNGGG---------
A0A3R6HJB3      -GTKAQGG--RYG-----------SHYGYG---YGYGYG-YNYNKEKNGGA---------
A0A0A2DQN2      -GVNHNSSSYGYG---YS----Y----GYG--YYGYGYG-YGHLGKKSLRK---------
A0A0A2F2N5      -GISSQNKGYGYG---YG----Y----GYG---YGYGYG-YGY-GNKKERS---------
L1NGW4          -GASDGGHGYGYG---YG----Y----GYG---YGYGYG-YGY-GN-KKKK---------
Z4WRA0          -GASDGGH--GYG---YG----Y----GYG---YGYGYG-YGY-GN-KKKK---------
U2K8K9          -GATESGH--GYG---YG----Y----GYG---YGYGYG-YGY-GNKKKKK---------
A0A069ZM60      -GATESGH--GYG---YG----Y----GYG---YGYGYG-YGY-GNKKKKK---------
J6GV98          -GATESGH--GYG---YG----Y----GYG---YGYGYG-YGY-GNKKKKK---------
A0A134B4F8      -GATESGH--GYG---YG----Y----GYG---YGYGYG-YGY-GNKKKKK---------
A0A134B8C7      -GATESGH--GYG---YG----Y----GYG---YGYGYG-YGY-GNKKKKK---------
A0A1M6B6D5      -EYVEKSG-K--G---Y----------GYG---YGYGYGGSSY-KSYGNGYHEAIKKPSL
A0A451FS66      -EYVEKSG-RGFG---Y----------GYG---YGYGYGDGSY-KSYGDGYHGPLGKKSL
A0A2E3GN39      SGSYYNYG-YGYG---YG----YGYGYGYG---YGYGYG-YGY-YSDSDNT-----RKKE
A0A3D1MEL0      SGSYYN---YGYG---YG----YGYGYGYG---YGYGYG-YGY-YSDPDNT-----RKKE
F0R0C9          -GTLDGNN--RYG---YK----Y----GYK---YGYHYG-YGS-KDYYNNE---------
A0A2A4N9A6      -----QYG-YGYG---YG----YGYGYGYG---YGYGYG-YGY-YAEDASRNKSLWERIT
A0A368D1N7      SGSYYNYG-YGYG---YG----YGYGYGYG---YGYGYG-YGY-YSDPDNTRKK-----K
A0A3B8TU58      SGSYYN-----YG---YG----YGYGYGYG---YGYGYG-YGY-YSDPDETREN-----E
A0A1T5IIR6      -GPQIKKR-RGYGFGSYG----YGYGYGYG---YGYGYG-YGY-GDEPKKK---------
A0A3E0QD27      -GVETSRF--RYG---YG----YGY--GYG---YGYGYG-YGY-YDDEAKKPLT-----T
A0A0M1W1I6      -GAIVKTS--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
I8WPR6          -GAIVKTS--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A0K2HKS3      -GAIVKTS--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
B6W3W8          -GAIVKTS--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A1Y3Z9Z6      -GAIVKTS--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A076IRY8      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A3A6AD54      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A3A6MIU7      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
I8WPP8          -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A372Y7D2      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A3E4JJC9      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A3E4WDQ0      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A414H9P2      -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
C3R5A8          -GAIVKTG--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
D1JY72          -GAIVKTS--GYG--------------GYG---YGYGYG-YGY-V-DGSES---------
A0A1C5XJA7      -GADLERH--GYG---Y----------G-S---YGYGYG-YGY-GNNKNK----------
R7CUW4          -GVDPHRH--GYG---Y----------GYG---YGYGYGRYGY-GNKKHGR---------
D7J4K6          -GVGPHRR----G---YG----Y----GYG---YGYGYG-YGY-GKHGRRK---------
Q8ABP9          -GVGPHRR----G---YG----Y----GYG---YGYGYG-YGY-GKHGRRK---------
A0A174C2Q8      -GVGPHRR--GYG---YG----Y----GYG---YGYGYG-YGY-GKHGRRK---------
D6D2Z5          -GVGPHRR--GYG---YG----Y----GYG---YGYGYG-YGY-GKHGRRK---------
A0A1T3EDR4      -GVRIGAF-------------------GYG---YGYG---------QELKG---------
A0A174SDD8      -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
A0A1H7RFH3      -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
A0A412GR09      -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
A0A139L1N2      -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
A0A174TVL8      -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
A0A1H8BJR6      -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
R9H6G0          -GTEKGSS--GYG---Y----------GYG---YNYGYG-YAA-T-QKKKG---------
A0A081PBV5      -GVRLNKG--GYG---Y----------GYG---YGYGYG-YGY-GNETKKT---------
A0A1I2AN85      -GVRLNKG--GYG---Y----------GYG---YGYGYG-YGY-GNETKKT---------
A0A1H6CKR6      -GVKFTNT--GYG---GY----GYGYGGYG---YGYGYG-YG----NRKKK---------
A0A235E1C0      -GVKFGSS-YGYG---YG----GYGYGGYG---YGYGYG-YG----QPKKK---------
R6D982          -GTKQGRR--GYG---Y----------GYG---YGYGYG-YSY-GNDEKKK---------
A0A078PL82      -GAKKGSR--GYG---Y----------GYG---YGYGI--------DVEKS---------
A0A078QKV9      -GAKKGSR--GYG---Y----------GYG---YGYGI--------DVEKS---------
A0A1F0I8C4      -GAKKGSR--GYG---Y----------GYG---YGYGI--------DVEKS---------
A0A3A5RIJ2      -GAKKGSR--GYG---Y----------GYG---YGYGI--------DVEKS---------
A0A0B8T471      -GIRKLKS--SYG---Y----------GYG---YGYGYG-YQK-E-KAGLR---------
A0A0D5BSQ0      -GMKLNGY--GY---------------GYG---YG-SYG-YGY-G-EEKKK---------
A0A1T3F6P5      -GMKLNGY--GYG---YG---------GYG---YG-SYG-YGY-G-EEKKK---------
A0A0W8EPA0      -GMKLNGY--GYG---YG---------GYG---YG-SYG-YGY-G-EEKKK---------
A0A365UKN1      -GMKLNGY--GYG---YG---------GYG---YG-SYG-YGY-G-EEKKK---------
A0A2T5RP38      -GLKLNGY--GYG---YG---------GYG---YG-SYG-YGY-G-EEKKK---------
A0A1A6CF06      -GLKLNGY--GYG---YG---------GYG---YG-SYG-YGY-G-EEKRK---------
A0A1T3D6S8      -GLKLNGY--GYG---YG---------GYG---YG-S---YGY-G-EEKKK---------
A0A376E091      -GLKLNGY--GYG---YG---------GYG---YG-SYG-YGY-G-EEKKK---------
A0A1P8E011      -GLKLGQS-------------------GYG---YGYGYG-YGY-G-REEGQ---------
A0A1V3N3U3      -GIKL--H--GPG---Y----------GYG---YGYGYG-YGY-G-NTEQQ---------
C2FUH6          -GLKQGRR--GYG---Y----------GYG---YGYGYG-YGY-S-NEKRH---------
A0A239XXC4      -GVKFGNN--PYG---YG----GYGYGGYG---YGYGYG-YS--A-QQKRG---------
A0A2X2J8S4      -GVNSGKR--GYG---Y----------GYG---YGYGYG-YRY-G-DDKKS---------
A0A3C0S618      -GVNSGKR--GYG---Y----------GYG---YGYGYS-YRY-G-DDKKS---------
A0A1T4NDR5      D----------FG-----------KKYYSH---YNYQYQPKARKRKKK------------
A0A2U0UJ71      DLSENGYYGRYYG-----------KYYGKY---YGSYYGHYNSEESPDKSFEKARKASSA
A0A2T2TDL4      D------ISMAYG-----------YKYRYR---HYDQYGPYDQYRSLPEEASA-------
A0A3D1AEJ6      --------GSGIG-----------YGYGYG---YGYGYGNDKDK----------------
A0A1V5S5I3      D-GGNSRYGYRYG-----------YHYDYG---SKSYYGK--------------------
R7JFY1          K-GHHGGYGYGYG-----------YGYGYG---Y--GYGNEKKRK---------------
A0A2M7VVW6      D-YSNKYYSYGYN-----------YNYSYG---NKDGYYYDDTQK--------EKLTKRI
A0A413V760      P-SDHKGYGYGYG-----------YGYGYG---YGYGYGNESHGHKHGRYESLKNLFSRF
A0A3D5KRM7      RQPIP--------------------SYKYG---YGYGYG---------------------
A0A3M1NUH2      DVSMA-----------------------YG---YKYRYRHYDRYTQYTSEYGTYGYRDVK
A0A1V6HYH8      --NDKFIKQSKYG--------------KYG---YEYKYDIYGYYTDNEEKQSNTKKSMKK
A0A359ATS6      TGNGG-----RYG-----------YGYRYG---YKYGYH-YGSEKKKTWWGNKG------
A0A2U0UG39      DMDDN-----KY----------------YG---KYYGKY-YGKYGEH-------------
A0A2E0MDX6      GGDKKYGGFRKYG-----------YGYGYG---YGYGYG-YGYGGNH-GYYEEK-PQKEK
A0A2M7KCE1      DIEKS-----RYG--------------GYN---YGYGYG-YGNSEYHTDYYDESITKKKK
A0A3M1Y2F5      ANPAQFRHGDASY-----------YTYGKK---YAKVYGAMHT-----------------
A0A2T2UAJ4      -------------------------SYGYN---YGYAYSYRRLYEYYRDEDKGAPEPSGI
A0A3D4RLG4      KRLGRKSYGYAYN------------SYGYG---YGYGYGGKNDYNYYSDDE---------
A0A3N2LCI3      SRNDQGRYGYSHT-----------YRYGYG---YGYGYG----YNYGSGEKKEE------
A0A2T4XEQ1      LGLSLVGYDHKIS-----------SDYYYQ---NKYKYYSYNDYLEYTEE----------
A0A2K8ZAP1      ------GKGESLS-----------YSYNYG---DYMDL----------------------
A0A348PT57      ARYGSYGRGYGAK-----------YGYGYG---YGYGYGYTSGNGYYSEDNEEEEPKLNF
A0A3D3LSK1      ------------K-----------FNTSYG---YYYNYYY-----YYSGDS---------
                                                                            

A0A1H6Z2F8      --------------------------------------------------------
A0A2P8G5K0      --------------------------------------------------------
A0A3D4CJE1      --GYYEDVPEKQVWWKAIFNKK----------------------------------
R5DEG6          --GYGQR------------KKK----------------------------------
A0A1G1TG88      LGRLFK--------------------------------------------------
A0A3M1TXY5      --------------------------------------------------------
A0A2E0VQ27      --------------------------------------------------------
R6U429          --------------------------------------------------------
A0A350V3E4      GVNTNGSQKEKIIKPN----------------------------------------
A0A212J9Z9      --------------------------------------------------------
F5IV23          --------------------------------------------------------
F8X2T0          --------------------------------------------------------
A0A1M3LAG1      --------------------------------------------------------
A0A212K6G4      --------------------------------------------------------
A0A1M5DFS8      --------------------------------------------------------
A0A2V3PNY7      --------------------------------------------------------
A0A015VNG0      --------------------------------------------------------
A0A142HHS5      LGKRIKSLFS----------------------------------------------
A0A1M6MYT6      TKTKGRSIFKPS--------------------------------------------
A0A2P8CDS1      SKKQAQTT------------------------------------------------
A0A353WYK7      --NLFATFKSLFSK------------------------------------------
A0A136LSC7      --RWIKIFGLK---------------------------------------------
A0A355BP94      --LIRKIFRS----------------------------------------------
A0A161LWY6      TKDYIKDYYEEE--------------------------------------------
A0A239K409      --------------------------------------------------------
A0A1G9B1T9      --------------------------------------------------------
A0A2W4RDE8      --------------------------------------------------------
A0A1V5S1J9      YLNYFDNTEEEL--------------------------------------------
A0A0A2EYC8      IIDKIGEKTKRIRNIHSSRLFK----------------------------------
A0A2G6H6Y4      VIEFVGDITKKIRNIKK---------------------------------------
A0A1M3DPL8      YFQYYQDDEKDI--------------------------------------------
A0A1V5F519      YRKYYDDNN-EI--------------------------------------------
A0A2G6R1T9      YTHYYNDDDIDI--------------------------------------------
A0A0L8VEV2      --------------------------------------------------------
A0A1I2A9Z9      --------------------------------------------------------
A0A3D0FMX4      N----HYYTDEDE-------------------------------------------
A0A1M3MEI8      DGTYYQYYQDDAHDI-----------------------------------------
A0A1J5HQM0      SEKYFQYYQDD-REI-----------------------------------------
E4T131          AEKYFHYYQDD-TEI-----------------------------------------
F4KR18          --------------------------------------------------------
A0A350PNH9      --------------------------------------------------------
A0A354LNT9      --------------------------------------------------------
A0A389LWV6      --------------------------------------------------------
A0A2W7RD29      --GLVNRVKNYLRSSK----------------------------------------
A0A3N2NDY8      --------------------------------------------------------
L1M9T3          --------------------------------------------------------
D7JEV9          LEKLIYKISDMTKKIRNIKK------------------------------------
A0A2W7QSQ0      --------------------------------------------------------
R7F6L5          -----KKKRKKS--------------------------------------------
C9LKL0          -----RKSKKKLSGRLLSKLRK----------------------------------
A0A3D0QPV7      KIRFFRRKNKK---------------------------------------------
A0A3C0I8F1      PIRWINRIYKRAMSFRK---------------------------------------
R5JJI4          INKLIAFFK-----------------------------------------------
A0A1F3D6P8      --------------------------------------------------------
A0A356Z058      --------------------------------------------------------
A0A3D1BT36      --------------------------------------------------------
A0A352ME00      --------------------------------------------------------
A0A3D3HL11      --------------------------------------------------------
A0A3D2HF71      --YVYSRYGHSGEGKYYIEE------------------------------------
B5CTK0          --------------------------------------------------------
A0A229I3A5      --KILNNWIIE---------------------------------------------
A0A3R6HJB3      --KS----------------------------------------------------
A0A0A2DQN2      --RFVERMKMFFVS------------------------------------------
A0A0A2F2N5      --GIFSRFRKS---------------------------------------------
L1NGW4          --GILYRLGLKK--------------------------------------------
Z4WRA0          --GILYRLGLKK--------------------------------------------
U2K8K9          --TLLQRLGIRR--------------------------------------------
A0A069ZM60      --GLLRRLGLR---------------------------------------------
J6GV98          --GLLRRLGLR---------------------------------------------
A0A134B4F8      --GLLRRLGLR---------------------------------------------
A0A134B8C7      --GLLRRLGLR---------------------------------------------
A0A1M6B6D5      WKRMKKSITKK---------------------------------------------
A0A451FS66      ADRIKNIFKQT---------------------------------------------
A0A2E3GN39      RSSLFSIFRKKS--------------------------------------------
A0A3D1MEL0      RSILFSRFRKKT--------------------------------------------
F0R0C9          --------------------------------------------------------
A0A2A4N9A6      NSKFISLLKN----------------------------------------------
A0A368D1N7      RSSLISRFRKKS--------------------------------------------
A0A3B8TU58      RTGFFSRFRKNS--------------------------------------------
A0A1T5IIR6      --RFLGIFKRK---------------------------------------------
A0A3E0QD27      WQAFKARLGKK---------------------------------------------
A0A0M1W1I6      --SWKRLFKKKS--------------------------------------------
I8WPR6          --SWKRLFKKKS--------------------------------------------
A0A0K2HKS3      --SWKRLFKKKS--------------------------------------------
B6W3W8          --SWKRLFKKKS--------------------------------------------
A0A1Y3Z9Z6      --SWKRLFKKKS--------------------------------------------
A0A076IRY8      --CWKRLFRKKS--------------------------------------------
A0A3A6AD54      --CWKRLFRKKS--------------------------------------------
A0A3A6MIU7      --CWKRLFRKKS--------------------------------------------
I8WPP8          --CWKRLFRKKS--------------------------------------------
A0A372Y7D2      --CWKRLFRKKS--------------------------------------------
A0A3E4JJC9      --CWKRLFRKKS--------------------------------------------
A0A3E4WDQ0      --CWKRLFRKKS--------------------------------------------
A0A414H9P2      --CWKRLFRKKS--------------------------------------------
C3R5A8          --CWKRLFRKKS--------------------------------------------
D1JY72          --SWKRLFKKKS--------------------------------------------
A0A1C5XJA7      --------------------------------------------------------
R7CUW4          --N-----------------------------------------------------
D7J4K6          --------------------------------------------------------
Q8ABP9          --------------------------------------------------------
A0A174C2Q8      --------------------------------------------------------
D6D2Z5          --------------------------------------------------------
A0A1T3EDR4      --GLWSRFLRMFRRV-----------------------------------------
A0A174SDD8      --GWWRRKGKK---------------------------------------------
A0A1H7RFH3      --GWWRRKGKK---------------------------------------------
A0A412GR09      --GWWRRKGKK---------------------------------------------
A0A139L1N2      --GWWRRKGKK---------------------------------------------
A0A174TVL8      --GWWRRKGKK---------------------------------------------
A0A1H8BJR6      --GWWRRKGKK---------------------------------------------
R9H6G0          --GWWRRKGKK---------------------------------------------
A0A081PBV5      --IWDKLFGKR---------------------------------------------
A0A1I2AN85      --IWDKLFGKR---------------------------------------------
A0A1H6CKR6      --SFFQKLLGR---------------------------------------------
A0A235E1C0      --GFFSRLFGKN--------------------------------------------
R6D982          --NWFFGKRKKESV------------------------------------------
A0A078PL82      --GWWSRMKKRMKR------------------------------------------
A0A078QKV9      --GWWSRMKKRMKR------------------------------------------
A0A1F0I8C4      --GWWSRMKKRMKR------------------------------------------
A0A3A5RIJ2      --GWWSRMKKRMKR------------------------------------------
A0A0B8T471      --GFFNRLFRR---------------------------------------------
A0A0D5BSQ0      --SVFDWFKRS---------------------------------------------
A0A1T3F6P5      --SVFDWFKRS---------------------------------------------
A0A0W8EPA0      --TIFNWFKRS---------------------------------------------
A0A365UKN1      --SIFDWFKRS---------------------------------------------
A0A2T5RP38      --SVFDWFKRS---------------------------------------------
A0A1A6CF06      --SIFSWFKRS---------------------------------------------
A0A1T3D6S8      --SVFDWFKR----------------------------------------------
A0A376E091      --SVFDWFKR----------------------------------------------
A0A1P8E011      --NSWRKIARSIRTIFTRKIKH----------------------------------
A0A1V3N3U3      --VWYKRWWRKIKS------------------------------------------
C2FUH6          --NLFSSLLEKIKGL-----------------------------------------
A0A239XXC4      --FFSRLFGKK---------------------------------------------
A0A2X2J8S4      --FWKKVFNK----------------------------------------------
A0A3C0S618      --FWKKVFNK----------------------------------------------
A0A1T4NDR5      --------------------------------------------------------
A0A2U0UJ71      RKNTNNASKPVKRQAGSVGEVAARKKANVAGNNTGVRKKPSADEFDGDFLMDYDEK
A0A2T2TDL4      --------------------------------------------------------
A0A3D1AEJ6      --------------------------------------------------------
A0A1V5S5I3      --------------------------------------------------------
R7JFY1          --------------------------------------------------------
A0A2M7VVW6      FKKKK---------------------------------------------------
A0A413V760      FKRS----------------------------------------------------
A0A3D5KRM7      --------------------------------------------------------
A0A3M1NUH2      ELLKDKES------------------------------------------------
A0A1V6HYH8      YFNYFYKKNK----------------------------------------------
A0A359ATS6      --------------------------------------------------------
A0A2U0UG39      -------ANK----------------------------------------------
A0A2E0MDX6      TTFNKIFSKK----------------------------------------------
A0A2M7KCE1      NIFTKIISHL----------------------------------------------
A0A3M1Y2F5      --------------------------------------------------------
A0A2T2UAJ4      RAWWGG--------------------------------------------------
A0A3D4RLG4      --------------------------------------------------------
A0A3N2LCI3      --------------------------------------------------------
A0A2T4XEQ1      --------KEEVA-------------------------------------------
A0A2K8ZAP1      --------TKKFD-------------------------------------------
A0A348PT57      LRNLRSKLKNDDN-------------------------------------------
A0A3D3LSK1      --------KKKNN-------------------------------------------
                                                                        

© 1998-2019