BYKdb

Dataset for cluster tad of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


B7BDT7      -----MATQNNISRPKQTDDFIRIQDLFYLCLNRWYWFVISLAVTVGVAVVYLLTTPPVY
B7B948      -----MNTEQETNTRVEE-SELNLGDILQTVLANWYWFVLSVVVCAGAAFLYLKWAPKVY
C2MBF7      MEYATDSIQQEPARSLEEASTLSLQDILMILKANWLFILLSLIVCLTLGFLYIKSSPHQY
                    :::     :  . : : *::     .* ::::*: *    ..:*:  :*  *

B7BDT7      TRSASLLIKEDSKGNSLGDAAGLMGDFDLFQTNT-----NVNNEIQSLQSPAVMLDVVKR
B7B948      TRTASVLIKDDAKGGAMSESAA-FEDLGLFGTKR-----NVDNEVLVFKSRRLMTEVARN
C2MBF7      SRSASLLIKNET-----PMSSA-MQQLAQFAGDKHAYSDDVSNQIIILSTERVVSETVRR
            :*:**:***:::       ::. : ::  *  .      :*.*::  :.:  :: :....

B7BDT7      LHLDVNYHTDGGFYKKVLYGRDCPYTVDFNDLQDNESVAFTINPSQNGQVLLTDFSRNGE
B7B948      LHLDVSYTVKDGLRTVELY-TQSPVQLSFPDAEEAQAFSLQAVPVSGKEVMLSGFTLGDQ
C2MBF7      LGLDVQYHYNAGLREKDLY-KQSPVSIRFVNADPDEKITLRVKPDKGSDSQVILYDIKSS
            * ***.*  . *:    **  :.*  : * : :  : .::   * .. :  :  :   ..

B7BDT7      DVAG---NITATLNDTVDAPIGRLVVKVA--NDSAIQDAPVYVSRRGYQDATGGYASNLS
B7B948      EVSD-GKPMKVALNDTVTTPIGRVVVVPSLYYGDKYFNTTVQVTKSPLQNVALLFQSGLQ
C2MBF7      LVGKVQEPITAPLGDTIATPIGQVVVEATPYYSNFPSYEVLKVQKENFHSIVDSYMRSLQ
             *.     :...*.**: :***.:**  :   ..      : * .   :. .  :  .*.

B7BDT7      VTLSDEKSTVINLSFKDVCIQRAEDVLNTVIAVYNENWI---------------------
B7B948      ATLASKTATIINLTLQDVSIPRAEDVINTLISAYNTDAINDKNQIVMNTSNFINDRLIVI
C2MBF7      VSLQQKDASVIKLTMQSSNPQLAEDFLSTLILVYTELEREDKVKVAESTQRFVDDRLAII
            .:* .: :::*:*:::.     ***.:.*:* .*.                         

B7BDT7      ------------------------------------------------------------
B7B948      EKELGDVDSDIESYKREHQLTDISSETGMYLQTSSQYRQEGLSLENQLSLAKYIKNYLTD
C2MBF7      SSELGQVDAEIEGFKQSQQIADIQAEAQEYIKGRSEIKTRLVELNNSISIAQFVRGHLKD
                                                                        

B7BDT7      ------------------------------------------------------------
B7B948      PGKNSDLIPANTGISDVNIESQIGEFNEMLLKRDKLIS----------------------
C2MBF7      KNQMEALIPANVGIASPAIEAAIAKYNELLLKRDQLQANSSSQNPLVQELNTQLAAQRLS
                                                                        

B7BDT7      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
C2MBF7      IITSIDNLISTLEVERQGILSEQSSYKGRITSVPMQERIVGSIYRQQKIKEELYLFLLNV
                                                                        

B7BDT7      ------------------------------------------------------------
B7B948      ------------------------------------------------------------
C2MBF7      REQNALSIESAESNARLIQAPTGPVAPVSPRVPIIMLAAGLLGLLIPTAIIYIRSIANNK
                                                                        

B7BDT7      ---------------------------------
B7B948      ---------------------------------
C2MBF7      VRGKADSRALHDYTCTRRGATLQGLQAPRQEYW
                                             

© 1998-2019