BYKdb

Dataset for cluster tadcd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

575 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1I3J6V0      ------------------------------------------------------------
A0A1H4ADG3      -------------------------------------MQTTTLDQLVPVKETK-------
A0A3D5KRY6      ------------------------------------------------------------
A0A1V5IPN7      --------------------------------------MDQNNQPSTVPQPEE-------
A0A1V3WH52      ------------------------------------MTEKTRPSAAPTSGSDE-------
A0A2K8Z965      ----------------------------------MTNESNYSYTTHQVVESEG-------
A0A418M8U8      ----------------------------------MNNQFQHSYVPYKMMEPEE-------
I2GTA4          ----------------------------------MNNQFNHSYVPYKMMEPEE-------
A0A2K8ZAJ2      -----------------------------------MNMNPNVYTPYQTADVES-------
A0A368JPA3      ----------------------------------MKSSNMYSYPMYPQGEINS-------
A0A3P1BT12      ----------------------------------MKSSNMYGYPMYPQGEITS-------
A0A3P1CI15      ----------------------------------MKSANMYNYPMYPQGEMSS-------
A0A1Q3PII2      -------------------------------------MLATKIPSTDLALSRD-------
A0A351BXT2      -----------------------------MNKPSLNGKSNHTAVNSPELRESK-------
A0A3D0MYJ7      ---------------------------------MNKNQDIFIDETKSGTETTI-------
A0A3D3LS70      -----------------------------------MSDKSNNIPSVLKKDKEI-------
A0A1G7ZF38      -------------------------------------MLANKTQIAD---FQD-------
C6VS52          -------------------------------------MLTTKGPTNDYPPFQD-------
A0A1G1TM36      ------------------------------------------------------------
A0A1V3WH27      -----------------------------------MSSYTTDNYGAAAPQQHE-------
A0A0D3L8Q3      ---------------------------------------MTDQDNLLLEDSEQ-------
A0A0K8QSK7      --------------------------------MEDPRLEIPGLPFFPEFEQSE-------
A0A1V6CN82      --------------------------------MTEYNDTDRTQDSAAQEELPV-------
A0A1M4XZ45      --------------------------------MTQSEINKN-NQINSSSDDDT-------
A0A399D319      --------------------------------MTQMDINKNGHQINQSQDDDS-------
A0A0P7X1V8      ------------MTDTNGHNTNGYNGRYRGEEIANQYSGQAGLQR--EDNDDE-------
A0A3B0C2S4      -------------MPILGCLFKIVSVFLPHIFNLKKRMAESPFSLDYDETEES-------
A0A416GA42      ----------------------------------MEQQNKQNVSG--SGLE---------
A0A3N2M1H3      -------------------------------------MDNTKTKP--EGISGFSD-----
A0A1T3IYP5      ---------------------------------MDTIKQKNYIIE--NKKEQS-------
A0A212K7W5      ------------------------------------------MKR--NTEEDF-------
F5IU11          ------------------------------------------MKK--NTEEDF-------
A0A352Z1R7      ---------------------------------MTSNVSIPPSQPLLRSGEN--------
A0A0A2F501      ---------------------------------MKQEENSRSAQGALAEQDSF-------
R5B7P0          ----------------------------------MENNINTDNNT--RQQEET-------
R5B0L5          -----------------------------------MEEPTEHTPQ--QLSTTQ-------
A0A374THP7      -----------------------------------------MLRR--NQADDF-------
A0A3R5XWG1      -----------------------------------------MLRR--NQGDDF-------
A0A414YFM3      -----------------------------------------MLRR--NQGDDF-------
A0A0A2EVS5      ------------------------------------MDEKVTTYK--RNVEEY-------
A0A1T4NAJ7      ------------------------------------MDEKVTTYK--RNVEEY-------
A0A2V1IJY1      ---------------------------------MAETIKSEARKS--VNAGSA-------
A0A3N2KCL3      ---------------------------------MAETIKSEARKS--VNAGSA-------
A0A255T941      -----------------------------------METNNNNQTN--EQNDDF-------
A0A1Y4CHN5      ----------------------------------MADNISANNQV--KQSEDF-------
A0A1Y3V692      ------------------------------------MIEKKTAVG--KPADDF-------
A0A174TYU6      ------------------------------------MIEKKTAVG--KPADDF-------
A0A1M6I2S6      ------------------------------------MIEKKTAVG--KPADDF-------
F3PXM2          ------------------------------------MIENKNAVG--KPADDF-------
A0A3E4ZNL4      ------------------------------------MMEKRINAG--KPVDDF-------
A0A174AHH7      ------------------------------------MIKNRTNAG--KPADNF-------
A0A174JCE8      ------------------------------------MIKNRTNAG--KPADNF-------
A0A3E4JMC4      ------------------------------------MIKNRTNAG--KPADNF-------
A0A412SND6      ------------------------------------MIKNRTNAG--KPADNF-------
A0A414IEQ9      ------------------------------------MIKNRTNAG--KPADNF-------
A0A415UKN5      ------------------------------------MIKNRTNAG--KPADNF-------
A0A0M1W8D8      ------------------------------------MIKNRTNAG--KPADNF-------
A0A3R6GKX5      ------------------------------------MIKNRTNTG--KPTDDF-------
A7V4S1          ------------------------------------MIKNRTNTG--KPTDDF-------
B0NU19          ------------------------------------MIKNRTNTG--KPTDDF-------
D4V601          ------------------------------------MIKNRTNTG--KPTDDF-------
A0A397WLT5      ------------------------------------MIKNRTNTG--KPTDDF-------
A0A3R6GM96      ------------------------------------MIKNRTNTG--KPTDDF-------
A0A015XH67      ------------------------------------MIKNRTNTG--KPTDDF-------
A0A078RZN2      ------------------------------------MIKNRTNTG--KPTDDF-------
A6L0K5          ------------------------------------MIKNRTNTG--KPTDDF-------
A7ACT5          ------------------------------------MIKNRTNTG--KPTDDF-------
A6KY94          ------------------------------------MIENRTSVG--KSAEDF-------
A0A173UQR8      ------------------------------------MIENRTSVG--KSAEDF-------
A0A3R6HK75      ------------------------------------MIENRTSVG--KSAEDF-------
A0A412B7D1      ------------------------------------MIENRTSVG--KSAEDF-------
A0A412VNY9      ------------------------------------MIENRTSVG--KSAEDF-------
A0A414LTU9      ------------------------------------MIENRTSVG--KSAEDF-------
I9Q4U4          ------------------------------------MIENRTSVG--KSAEDF-------
A0A373ISF0      ------------------------------------MIEKKAAAG--KPADDF-------
U6RF62          ------------------------------------MIEKKAAAG--KPADDF-------
A0A073I794      ------------------------------------MTEKKTTVG--KPVDDF-------
A0A108TH71      ------------------------------------MVEKKTPVG--KPADDF-------
I8VXH0          ------------------------------------MVEKKTPVG--KPADDF-------
A0A412S0N6      ------------------------------------MVEKKTPVG--KPADDF-------
A0A412IIJ0      ------------------------------------MVEKKTPVG--KPADDF-------
A0A0P0FM97      ------------------------------------MVEKKTPVG--KPADDF-------
R6KTP3          ------------------------------------MVEKKTPVG--KPADDF-------
A0A139LU87      ------------------------------------MVEKKTPVG--NPADDF-------
A0A1C6B3Y5      ------------------------------------MVEKKTPVG--KPADDF-------
E2NMQ4          ------------------------------------MVEKKTPVG--KPADDF-------
A0A412YDB9      ------------------------------------MVEKKTPAG--KPADDF-------
R7DY01          ------------------------------------MVEKKTPAG--KPADDF-------
A0A414LGK8      ------------------------------------MVEKKTPAG--KPADDF-------
A0A016E4F9      ------------------------------------MIEKKTIVG--KSTDDF-------
A0A413PP50      ------------------------------------MTEKKTTVG--KPADDF-------
A0A3A5TI83      ------------------------------------MTEKKTTAS--KPADDF-------
A0A415NEB6      ------------------------------------MTEKKTTAS--KPADDF-------
A7AJ60          ------------------------------------MTEKKTTAS--KPADDF-------
A0A015UXN7      ------------------------------------MTEKKTTAS--KPADDF-------
A0A395YYT3      ------------------------------------MTEKKTTAS--KPADDF-------
A0A415IPQ4      ------------------------------------MVEKKTPAG--KPADDF-------
A0A3E5BRW7      ------------------------------------MVEKK------KPADDF-------
K9DXS6          ------------------------------------MVEKK------KPADDF-------
A0A1M6KFV3      ------------------------------------MVEKK------KPADDF-------
A0A1Q6G7L3      ------------------------------------MVEKK------KPADDF-------
A0A413H235      ------------------------------------MVEKK------KPADDF-------
A0A1M5B2J8      -----------------------------------MATIQKKIQV--HNTQDF-------
A0A255RCT5      -----------------------------------MATIQKKTQV--QNTQDF-------
A0A1Y4GLF5      -----------------------------------MAINKDTTKN--KQTDDF-------
A0A1H3XSC0      -----------------------------------MSINQK--RP--TQTDDF-------
B3JI46          ----------------------------------MMTVNQKNIKP--GQQDDF-------
A0A174UR09      ----------------------------------MMTINQKNTKP--GQQDDF-------
A6LE40          ----------------------------------MMTINPKNTKP--GQQDDF-------
R6NN15          ----------------------------------MSETQQHTRPA--AKADDF-------
A0A358R8U0      -----------------------------------MEMTQNTSPA--EPMDDS-------
R6WSB6          -----------------------------------MEMTQNTSPA--EPMDDS-------
A0A401LPX7      -----------------------------------MATIQNKSTV--QNMQDF-------
A0A3A5Z900      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A3R6I893      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A3R6EGW5      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A285TGL6      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A3A5RFX4      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A1Q6IUW9      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A3R6NPG7      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A413XDP6      -----------------------------------MATIQNKSTV--QNTQDF-------
K6AP24          -----------------------------------MATIQNKSTV--QNTQDF-------
A0A076IQN8      -----------------------------------MATIQNKSTV--QNTQDF-------
A0A078RYI7      -----------------------------------MATIQNKSTV--QNTQDF-------
C7XEQ8          -----------------------------------MATIQNKSTV--QNTQDF-------
D7INX6          -----------------------------------MATIQNKSTV--QNTQDF-------
K5ZG55          -----------------------------------MATIQNKSTV--QNTQDF-------
A0A3N2N9B8      ------------------------MAELLDLSSAPASPSATTRKK--TAASNT-------
A0A3N2NMI0      ------------------------------MAENNATAPAQRRKK--TPESTP-------
A0A359I8H7      -----------------------------------MSDNINVTQE--SEAAEE-------
A0A3N2KA63      -----------------------------------MSDNINVTQE--SEAAEE-------
A0A3B9FAU3      -----------------------------MATNNSLESEKNYSAT--AENNELENGG---
A0A3C1E5L7      -----------------------------MATNNSLESEKNYSAT--AENNELENGG---
A0A354SN68      ------------------------------MYTNMDNNENTSLST--EKVEDE-------
A0A0A2DUD9      ------------------------------MIQNTTTVVEKPAAE--GQQENF-------
A0A3N2N595      --------------------------------MAEVNKIQSNKKS--GAAGA--------
R5FHS9          -------------------------------MPNNQIQSQQPQQN--QQSDDS-------
A0A3P1ZBJ5      -----------------------------------MVENEVNAPQ--NEQTTG-------
A0A413TW79      ------------------------------------MQNAPGRRP--QQAEDF-------
A0A3E5E9M7      ----------------------------MIQNNQATMQNVLVRRP--QQAEDF-------
A0A3E4SK73      ----------------------------MIQNNQATMQNVPGRRP--QQAEDF-------
A0A415GGC6      ----------------------------MIQNNQATMQNVPGRRP--QQAEDF-------
A0A413DBH9      ----------------------------MIQNNQATMQNVLVRRP--QQAEDF-------
G9S1S8          -----------------------------------MAAVQNNPKS--KQSEEF-------
A0A354M4S6      -----------------------------------MAAVQNNPKS--KQSEEF-------
R7DH52          -----------------------------------MAAVQNNPKS--KQSEEF-------
A0A396N3D5      -----------------------------------MAAVQNNPKS--KQSEEF-------
A0A415ZDP9      -----------------------------------MAAVQNNPKS--KQSEEF-------
A0A016CWA4      -----------------------------------MAVNQKNTRP--GQADDF-------
A0A1C6H117      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A415TAH7      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A0M1W0V2      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A139KA16      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A174VQ92      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A1Q6HCG0      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A1Y4JYM9      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A3A5QW67      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A3A5RQE6      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A3A6BP07      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A3E5E153      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A3Q9IP20      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A412WV15      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A413ICP6      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A414KYB9      -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A416X133      -----------------------------------MAVNQKNTKP--GQPDDF-------
E5WX00          -----------------------------------MAVNQKNTKP--GQPDDF-------
K0X3P3          -----------------------------------MAVNQKNTKP--GQPDDF-------
A0A3A5Z014      -----------------------------------MTINQKNIKP--GQQDDF-------
A0A1M4YZ07      -----------------------------------MSINQKNTKP--GQPDDF-------
A0A078S3Q8      -----------------------------------MAINQKNIKP--GQQDDF-------
A0A069SJV7      -----------------------------------MAINQKNIKP--GQQDDF-------
A0A3E5DXI5      -----------------------------------MAINQKNIKP--GQQDDF-------
A0A3E5EM98      -----------------------------------MAINQKNIKP--GQQDDF-------
A0A3E5F453      -----------------------------------MAINQKNIKP--GQQDDF-------
I9T3G6          -----------------------------------MAINQKNIKP--GQQDDF-------
A0A0P0FQW1      -----------------------------------MTVNQKNIKP--GQQDDF-------
C3RFN5          -----------------------------------MAINQKNIKP--GQQDDF-------
A0A3E4SYU0      -----------------------------------MAINQKNTKP--GQPDDF-------
A6LGY1          -----------------------------------MAINQKNIKP--GQQDDF-------
K5ZSH4          -----------------------------------MAINQKNIKP--GQQDDF-------
A0A078T2W6      -----------------------------------MAINQKNIKP--GQQDDF-------
A0A3R6D1V4      -----------------------------------MAINQKNIKP--GQQDDF-------
A0A3R6EAF7      -----------------------------------MAINQKNTKP--GQPDDF-------
A0A412MJT7      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3E4WKT5      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3A5YY33      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A078TAH2      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A1E9CFZ7      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A373FYU5      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3A5TZ72      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3A5XBP2      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3A6MEG9      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3E4JP35      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3E4KP40      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3E4NX82      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A3E4XFU8      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A412RG70      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A412TD37      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A413GAA4      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A414M7I4      -----------------------------------MTVNQKNIKP--GQQDDF-------
E5UZA2          -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A069SMG6      -----------------------------------MTVNQKNIKP--GQQDDF-------
A0A1Y4PQK7      ------------------------------------MTIQNNTKP--GQADDF-------
A0A1Y3ZDB3      ------------------------------------MAIQNNTKP--GQADDF-------
A0A3A6AAP4      ------------------------------------MAIQNNTKP--GQADDF-------
A0A1Y4IH41      ------------------------------------MAIQNNTKP--GEADDF-------
A0A1Y4DYA7      ------------------------------------MNENNTKSD--LFLQES-------
A0A1Y3X4I9      -----------------------------------MSTLSDKETE--LFLDELEKSSSSG
A0A1Y4FNK8      -----------------------------------MATQNNPARP--KQADDL-------
A0A355FD59      ----------------------------------MALSQNNNVKQ--KQPEDF-------
A0A359CEZ9      ----------------------------------MALSQNNNVKQ--KQPEDF-------
A0A353Q7B4      ----------------------------------MALSQNNNVKQ--KQPEDF-------
A0A1M3KVR9      ----------------------------------MTPVQHNKTEQ--KQTEDL-------
F8X3A5          ----------------------------------MTSVQHNKTER--KQTEDL-------
A0A3C1ITV0      --------------------------------MKEDYNSIGAAET--EDQKNE-------
R7HN19          --------------------------------MKEDYNSIGAAET--EDQKNE-------
A0A415EEZ4      -------------------------------------MNDSYKVN--DLQNGD-------
A0A060RD97      -------------------------------------MVENKINN--EQDPKS-------
A0A350IHV0      --------------------------MALENNNIDNRPALRNANG--EEDGDI-------
A0A077ENE7      ---------------------------------MNTINQKGYTIG--DKKEHS-------
T0NN57          ---------------------------------MNMASQKINMTK--ESKEQF-------
X5K347          -----------------------------------MASQKINMTK--ESKEQF-------
A0A1T5K9D4      ---------------------------------------MENGNN--QKNSGQ-------
R5RVP0          -----------------------------MPIDNNLDNRPSQVRN--EEENDL-------
A0A285T4L1      --------------------------------------MQNNTLS--NKNEQS-------
A0A3E5BU42      --------------------------------------MQNNTLS--NKNEQS-------
A0A414ZBF2      -----------------------------MRKDKFEDFDFIDFNE--SRSEES-------
R5KD55          -----------------------------------METNPVTQQT--EETTEE-------
A0A174QNT3      ---------------------------------METNKTTDLKRT--EN---V-------
R9I0H0          ---------------------------------METKKTTTSSPK--EN---V-------
K5BUT9          ---------------------------------MEYIQENERTLK--KDEG-G-------
A0A174FPA3      ---------------------------------MEYIQENERTPK--KDEG-G-------
R6S9Y6          ---------------------------------MEYIQENERTPK--KDEG-G-------
C9KX15          ---------------------------------MEYIQENERTPK--KDEG-G-------
A0A3L8AAP1      ---------------------------------MEYTQENNEKTV--KESGLN-------
R6DAG6          ---------------------------------MEYTQENNEKTV--KESGFN-------
A0A1G8BVM8      ------------------------------MSKNSEQFDFVDFND--GNSNDN-------
A0A416GGJ1      -----------------------------------------MQTN--KKVDSG-------
A0A3D1NQW3      -----------------------------MTPNNINPNSANSDTK--QEEHIT-------
B0MT10          -----------------------------MTPNNINPNSANSDTK--QEEHIT-------
R7JGW9          -----------------------------MTPNNINPNSANSDTK--QEEHIT-------
A0A0E2M2Y7      -------------------------MNLIEDSKNTLAESRSRIYT--KEETSF-------
A0A0K2J6Z0      -------------------------MNLIEDSKNTLAESRSRIYT--KEETSF-------
B2RKZ8          -------------------------MNLIEDSKNTLAESRSRIYT--KEETSF-------
A0A212GC82      -------------------------MNLIEDSKNTLAESRSRIYT--KEETSF-------
A0A254MU12      -------------------------MNLIEDSKNTLAESRSRIYT--KEETSF-------
R6CQ93          --------------------------------------MQNNNLS--GKNEQS-------
A0A3D2BF46      ------------------------------MEE-NRNVNNVPAEG--NEDSIN-------
A0A358R538      ------------------------------MTE-RTINPQ---PA--EETTGN-------
A0A1Y4AAB8      ------------------------------MIEQTPNTQHAPQNE--TSEAGM-------
A0A1Y3WWY9      ------------------------------MIEQQPNNIPQQAFN--DDQAGT-------
A0A1Y4U5L4      ------------------------------MIEQQPNNIPQQAFN--DDQAGA-------
A0A1Y3VCJ1      ------------------------------MAE-IQFNTQTRDKI--HDQTPA-------
A0A1Y3QTW7      ------------------------------MTEYNNQQQHLQNDE--NENGSG-------
R6XWY7          ------------------------------MTEYNNQQQHLQNDE--NENGSG-------
A0A174AVF1      ------------------------------MTEYNNQQQHLQNDE--NENGSG-------
A0A373HTL7      ------------------------------MTEYNNQQQHLQNDE--NENGSG-------
A0A1Q6EIY0      ------------------------------MTE-QNINPHLLNGE--SENTNG-------
E4M8L3          ------------------------------MTE-QNINPHLLNEE--SENTNG-------
I3YQ50          ------------------------------MTE-QNINPHLLNEE--SENTNG-------
R5UEY8          ------------------------------MTE-QNINPHLLNEE--SENTNG-------
A0A1H4D866      ------------------------------MTE-QQINSPQQQGN--DEMTGA-------
A0A374A9J5      ------------------------------MAE-QQINSQIQTNN--EELTNT-------
A0A1Q6E9S3      ------------------------------MAE-QQINSQIQTNN--EELTNT-------
D4IJ36          ------------------------------MAE-QQINSQIQTNN--EELTNT-------
A0A414Q925      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A415PUS9      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A108TCU0      -----------------------------MGKDRFEDLDFIDFND--NRRQEG-------
A0A413BA42      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
S3Y344          -----------------------------MRKDRFEDLDFIDFND--SRRQEG-------
A0A413MY74      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A412TGL3      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A413VJ33      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A414L0W6      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A412DP39      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A413ZSE8      -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
B0NP84          -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
R6AK43          -----------------------------MGKDRFEDLDFIDFND--SRRQEG-------
A0A412N2D9      -----------------------------MGKDRFEDLDFIDFND--SRQQES-------
R6LHA4          -----------------------------MGKDRFEDLDFIDFND--SRQQES-------
A0A1Q6FL18      -----------------------------MGKDRFEDLDFIDFND--SRQQES-------
A0A1Y4JYS9      -----------------------------MGKDRFEDLDFIDFND--SRQQES-------
A0A3E5HPT8      --------------------------------MALTEE------------EKS-------
C6IJ48          --------------------------------MALTEE------------EKS-------
Q8A3U2          --------------------------------MALTEE------------EKS-------
A0A3R6S1H6      --------------------------------MKNEEL----IED--G--TNA-------
A0A3R6SD81      --------------------------------MKNEEL----IED--G--TNA-------
A0A413VXJ7      --------------------------MSTEQNINKESK-TSKNSK--Q--EEE-------
I9RSN9          --------------------------MSTEQKINKESK-ASKSSE--K--EEE-------
U6RJK5          --------------------------MSTEQKINKESK-ASKSSE--K--EEE-------
A0A1Q6GA32      --------------------------MSTEQKINKESK-ASKSSE--K--EEE-------
I9RPU6          --------------------------------MNTEYK-NNDVRK--Q--EPE-------
I8Y597          --------------------------------MSIESQ-NSELRE--K--ESE-------
I8YFS5          --------------------------------MSIESQ-NSELRE--K--ESE-------
A0A1Q6GBF5      --------------------------------MNTEQK-NNNNPG--Q--ESE-------
I8YFZ3          --------------------------------MSAEYK-NNDIRK--Q--ESE-------
A0A1Q6GDH2      --------------------------------MNTEYK-NTDVRK--Q--EPE-------
U6RSB0          --------------------------------MNTEYK-NNDVRK--Q--EPE-------
I9SIK1          --------------------------------MNTEYK-NNDVRK--Q--ESE-------
I9GXM2          --------------------------------MNTEYK-NNDVRK--Q--ESE-------
I9TP59          --------------------------------MNTEYK-NNDARK--Q--ESE-------
A0A0J6CIR2      ----------------------------------------MNLRR--E--ENE-------
A0A3D8HG59      -------------------------------MEPNQEL-ENLQQQ--E--ENE-------
A0A3R6S408      -------------------------------MEPNQEL-ENLQQQ--E--ENE-------
A0A354WXN6      ------MVVCSIRLGGCSLLNCHIIQQITQSTVMEQQENNKNIEQ--E--EQE-------
R5IP14          -------------------------------MAKEQQEIYGQQVE--ESTDNG-------
A0A316SZX7      ---------------------------------MSEQNINQPQQN--APAEEE-------
A0A1Y4AIY1      --------------------------------MKVENP-SNGPRW--NEANSG-------
F3ZRU7          --------------------------------MEQQNL-DNKIQQ--EHTEQE-------
A0A1C5Q1F3      -----------------MDLRDFGFNFNCHLNIGCEMT-NRKNTQ--S--DHT-------
R7A239          -----------------MDLRDFGFNFNCHLNIGCEMT-NRKNTQ--S--DHT-------
A0A1M6K7I9      --------------------------------MNEEQKVQSNMTA--Q--EEQ-------
A0A3R6HIK7      ------------------------------MSTEYNPE-NNIRIE--E--ESV-------
K5ZVW7          ------------------------------MSTEYNPE-NNIRTE--E--EST-------
A0A1Y4D5Z0      -----------------------------MIDNRENTQ-RDYAQE--N--ENT-------
R5S343          -------------------------------MKNTEQD-LFEFEE--E--KSG-------
A0A3R5ZMK1      --------------------------------MNTEQE-TN-TRV--E--ESE-------
A0A3E4ZTK7      --------------------------------MNTEQE-TN-TRV--E--ENE-------
A0A1Y3ZIA4      --------------------------------MNTEQE-TN-TRV--E--ESE-------
K5Y1A4          --------------------------------MNTEQE-TN-TRV--E--ESE-------
A0A3R6K8X4      --------------------------------MNIEQE-TN-IRM--E--ENE-------
A0A1Q6I3T6      --------------------------------MNTEQE-TN-IRM--E--ENE-------
A0A414XX40      --------------------------------MNTEQE-TN-IRM--E--ENE-------
A0A412DM15      --------------------------------MNTEQE-TN-IRM--E--ENE-------
A7AEU7          --------------------------------MNTEQE-TN-IRM--E--ENE-------
A0A415BDM7      --------------------------------MNTEQE-TN-IRM--E--ENE-------
A0A3R5ZYK4      --------------------------------MNTEQE-TN-IRM--E--ENE-------
A0A414GI87      --------------------------------MNTEQE-TN-IRM--E--ENE-------
A0A3R6BKI7      --------------------------------MNTEQE-TN-TRV--E--ESE-------
A0A414LPI6      --------------------------------MNTEQE-TN-TRV--E--ESE-------
A0A412M2W1      --------------------------------MNTEQE-TN-TRV--E--ESE-------
K5ZX55          --------------------------------MNTEQE-TN-TRV--E--ESE-------
K5ZBN2          --------------------------------MNPEQE-TNMLRE--E--ENE-------
A0A0J6CKW3      --------------------------------MNPEQE-TNMLRE--E--ENE-------
A0A0F5IQM7      --------------------------------MNPEQE-TNMLRE--E--ENE-------
S0GLB0          --------------------------------MNPEQE-TNMLRE--E--ENE-------
A0A3R6NLC1      --------------------------------MNPEQE-TNMLRA--E--ENE-------
A0A416WYC9      --------------------------------MNPEQE-TNMLRA--E--ENE-------
A0A0F5IT40      --------------------------------MNSEQE-TINLRR--E--ENE-------
S0GSI7          --------------------------------MNSEQE-TINLRR--E--ENE-------
K5YB65          --------------------------------MNSEQE-TINLRR--E--ENE-------
A0A0F5IWP9      --------------------------------MNSEQE-TTYLRG--E--ENE-------
A0A0F5IZT8      --------------------------------MNSEQE-TTYLRG--E--ENE-------
A0A417LKQ2      --------------------------------MNSEQE-TTYLRE--E--ENE-------
A0A416TME1      --------------------------------MNSEQE-TTYLRE--K--ENE-------
A0A416XPE8      --------------------------------MNSEQE-TTYLRE--K--ENE-------
L8JI02          -------------------------------------------------MNDK-------
A6EBM4          -------------------------------------MTGESRKGQRGPSHRE-------
A0A2N3U785      -------------------------------------MNKKDIFLAEPENF---------
A0A0E3ZG78      -------------------------------------MMDKELFPLSSERAGE-------
A0A1I6BRK6      -------------------------------------MDSQELFSSDLSQAKA-------
A0A243WAB1      -------------------------------------MNTRELFPLNSEQVEE-------
A0A399SH26      -----------------------------------------MSSSINNAPNNE-------
A0A0E3ZGV6      --------------------------------------------MDKNKVNAE-------
A0A1I2N4S1      --------------------------------------------MDKNKTNSE-------
A0A2T5YE44      --------------------------------------------MDKNKTNSE-------
A0A1M4YED3      -----------------------------------------MSAPKHTQEPQE-------
A0A3P1Z8V4      ----------------------------------MIQSSSSHPDYPHLPSDSD-------
A0A2L2WX98      ----------------------------------------MENTNNATIEKEE-------
G5GD56          --------------------------------------MSGSVQN--KNKEED-------
R6A0L2          --------------------------------------METKSINPQEQQDEE-------
R7LG80          ---------------------------------------MNNVPDTFKRDEEE-------
A0A1M6XHU0      --------------------MAHYRHHSLIVARGG-QRGGLPPASSETRDEGR-------
D0MHQ9          --------------------MAHYRHHSLIVARGG-QRGGLPPASDEKRDEGR-------
G2SF81          --------------------MAHYRHHSLIVARGG-QRGGLPPASGETRDEGR-------
A0A2H3NSN0      --------------------MNTNDQNALDIRRKKVEQIGLSRSDNSDTESNA-------
A0A2P6C324      --------------------MNDTSQN-LTPYRKQAEKIGL-QSSNSGSDDNT-------
A0A126PFG0      ---------------------------------MEPFNGQVSTFYTAATASQP-------
A0A3M1N7Z3      -----------------------------------------------MPIQQE-------
R7PCR1          ----------------------------------MANNTVSSTVNQAELKEES-------
A0A2A8CVM9      -----MNDKNLSRFDSGDMTPAPLRNGHASNRMNGSAHHGGGSSGSSSEANAG-------
A0A3C0ZQC7      MNIGKGDIERIHRDGISQEP----------------------------------------
A0A2E3R1D0      MIDQPYPTAADRGA---------------------PGAPVRGEDPFYYGDRDG-------
A0A2T2USC0      --------------------------------------MNGQVGGMPAPQEDE-------
A0A2T2V0F3      MHDGSAPSGNGHSNRWNSMN---------------PVNGQSQPSGEHGARDDE-------
A0A2T2S682      -----MPRSSSFEYAGDGHPGNGRSAPDDEPSLY-DSAPDGPTGVD--------------
D5H561          --------MAHLQRRDPDQNGQG-----DIVRSW-EGGTNGAAGPSSGRQGIK-------
A0A2H3NWA9      -MASPSLPPNGQNGRHDAAPTPWPAQGQLYDEVY-HPEGNGVS-----------------
A0A2A8CVB6      MSPSSNMSSNGHRP--AGGPVNGIAGASLF---Y-DDNPQRGS-----------------
A0A2P6C1S6      -----MASTNGHPG-----SSQSVSVEDLL---YEDTTSRRSS-----------------
A0A2T2UTM4      -----MASTNGYPSGEEGPGSRSLAVEDLL---Y-DNSDRRSS-----------------
A0A1T5MMH4      ------------------------------------MELAKNNIHHQPLPSEG-------
A0A2W4R1L8      ---------------------------------------METGTFKSGNSIEG-------
A0A2E5CV79      ------------------------------------------------------------
A0A2A4G4B1      --------------------------------------MISSGSPLKHDDEME-------
A0A2D4ZVH1      ------------------------MHFNGNSSNGYNSGYSPLENETDSYIEKE-------
A0A0E3V905      -----------------------------------MSANTYTYTQHQLVESDG-------
A0A1M6GR99      ------------------------------------------MNQQKLPEQNI-------
A0A1M5BA90      -----------------------------------------MEPKRHATEKEK-------
A0A1V9F098      -------------------------------------------MQTNKKTGNE-------
A0A1V9FHD0      -------------------------------------------MQTHKKTGNE-------
A0A1T5CS78      ------------------------------------------MKYNSNTGKED-------
A0A0Q9Z8F1      ------------------------------------------MKYNSKTGKED-------
A0A2N0U0M7      ------------------------------------------MKYNSKTGKED-------
A0A1M6TTV4      --------------------------MNFSPEHNVLNQTNNQNADSSGSPLDD-------
A0A1Q6IT42      ----------------------------------------MEEKYTSERKNDN-------
K0X1U5          ----------------------------------------MEEKYTSERKNDN-------
A0A416XAH0      ----------------------------------------MEEKYTSERRNDN-------
R5EXK3          ----------------------------------------MEEKYTSERRNDN-------
A0A401UAP7      ------------------------------------------MDKGFTNESET-------
A0A1W2GF52      ---------------------------MNPRNVHIPQDIRSHHNPENDGAFEN-------
A0A2G5L7B8      -----------------------------MRPIHGGQN----HNQSEGDPLSN-------
A0A0D3LFR6      ----------------------------MKEDTTYVEYTDAPDEQPEGGPLQS-------
M7N6D4          ----------------------------MKEETTYVEYTEGQDTK-GWLPIHN-------
A0A364XUP5      ----------------------------------MMLESNKIGPPVALPNTEG-------
A0A1M5RLA9      -----------------------------------MLETPKNIQPQQSQANEA-------
A0A385SFR9      -----------------------------------MLEIPKNIPPQQSPANEP-------
L8JW09          -------------------------------------MENKNIYSDTEKPTEG-------
A0A1Q3ZMZ7      ------------------------------------------------------------
A0A2D8JJW3      ---------------------------------------------MATQSNKQ-------
A0A2W2AFF7      ---------------------------------MQDKNYTNHIVAAEQQEEGS-------
A0A2N5YXE2      ------------------------------------------MENKIPIFNQK-------
A0A2I0QZ80      ----------------------------------------MEVNKKKLFVNTT-------
A0A2U2XBJ3      ----------------------------------------MINQRGKIFVNTT-------
A0A3E1F1A3      ----------------------------------------MINQKGKIFVNTT-------
A0A1V9F383      -----------------------------------------MQPNIN--TKNE-------
G8TRZ6          -----------------------------------------MQTNINSKSKSE-------
A0A2W1NDY9      -----------------------------------MNNFHINNENAISSLNKD-------
A0A1G0CI31      ---------------------------------------MNGAQQPSLLINRE-------
F2IKD6          ----------------------------------------MNNSNTSIFINKD-------
A0A1I7BM74      ----------------------------------------MNSSKNRFFVNTE-------
A0A2G2FJ17      ----------------------------------------MEKRNNSIYVNTN-------
A0A416X8R7      -------------------------------------MELIQETKNDKKNEGG-------
K0XJ09          -------------------------------------MELIQETKNDKKNEGG-------
R5EUZ0          -------------------------------------MELIQETKNDKKNEGG-------
W0EQS0          -------------------------------------MELIQETKNEKKNEGG-------
A0A1Y3WE15      -------------------------------------MELIQETKNEKKNEGG-------
A0A1Y4GUK3      -------------------------------------MELIQENKNEKKNEGG-------
A0A2U1FKU2      --------------------------MPTEEKRITPYGGASRS--ESGEDISF-------
A0A0A2F954      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF-------
A0A0A2FW91      --------------------------MNLNEGSQNTFTRQGRSYISDTEDTAF-------
A0A2D2N2N1      --------------------------MNLNEDSKNTFTRQSRSYISDTEDTAF-------
Q7MWZ2          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
T2NDT6          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
W1R7P9          --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1R4AFZ0      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1R4DVZ7      --------------------------MNLNEDSKNTFTRQGRSYISDTEDTAF-------
A0A1G9E2A9      -------------MVEPTEIQHLGRP---------------IDNEEEESFLSV-------
A0A2T2YJE8      -----------MTNKESIVLEELENNYAA------------AVEVEEDSGGSD-------
A0A3M9N829      -----------MSVKAANDLDELDHRLGSD-----------EGEEEDG--GAS-------
A0A0P0CSF9      -----------MSVKTVNDLDELDHRLGSG-----------EDEDDDG--GTS-------
A0A3M9MNC3      -----------MSVRTVNDLDELDHRLGGV-----------EDEEDDG--GAN-------
A0A2M6GH67      ------------------------------------------------------------
A0A127B287      -----------MSVKTGNNLDELDYHTSNA-----------DIEEEDS--GSS-------
A0A369QP10      -----------MANKESIVLEELDNSNYAS-----------TIEVEEESRGSD-------
A0A418R9X5      -----------MAAKEDAELEELIRNAGG------------EPEEEEE--GGG-------
A0A428JSJ3      -----------MAAKEDAELEELIRSAGG------------EPEEEED--GGG-------
A0A428KI59      -----------MAAKEDAELEELIRNAGA------------EPEEEEE--GGG-------
W8F1I6          -----------MAAKEDAELEELIRNAGA------------EPEEEEE--GGS-------
A0A246FQC0      -----------MATKEDAELEELIRNAGG------------EEVEEDD--GGG-------
A0A372E5P8      -----------MAVKEDAELEELIRQAGG-------GE---PTEDEDD--GGG-------
A0A1H3EMW1      -----------MAAKEDAELEELIRNAGR------------ESEEQED--GGG-------
A0A1H9ZSN3      -----------MAAKEDAELEELIRNAGG------------EPEEEDD--GGG-------
A0A0M3RW20      ------------------------------------MN---TPEPESETEGSG-------
A0A1S9B3W0      -----------MAVNENAELEELIRNATSGGVNTPAPP---ASESDDDNVGGG-------
A0A1W1VRL3      -----------MAAKEETELEELIRNANG-------IE---TEDKEDE--GDG-------
A0A1M6R305      -----------MAVNENAELEELIRNATGSGGASTVSA---ESEVVEE--GGG-------
A0A2M9B9H9      -----------MAVNENAELEELIRSAGG-------AE---PNAVEDE--GGG-------
A0A126PDF2      -----------MAVNENAELEALIRNAIDGGTEPPTAATVGAAADDEA--DGG-------
A0A2Z3GKA1      -----------MAVNENAELEALIRNAIDGGTEPPTAATVGAAADEEA--DDG-------
A0A328BL48      -----------MAVNENAELEELIRNATSGGAAPTAPAA--ESEDDSV--GGG-------
A0A3S0QKV1      -----------MAVNENAELEELIRNATGGSGAAAPTAS--APEAEEA--GSG-------
A0A3R9P8H7      -----------MAANEDAELEEMIRNAGGN-----------ESDGEDD--GGG-------
A0A212UCJ7      -----------MAVNEDIELEELIRGAGGD-----------AE--EDQ--GGG-------
A0A238WIA7      -----------MAVNEEVELEDLVRNAGGE-----------AD--EDD--GGG-------
A0A0W8EDI5      -----------MAVNKEAELEELIRASG-------------EETDDVA--ESS-------
A0A3B7RBP8      -----------MAIDKEAELEELIRSAGST-----------EGQEEET--DTA-------
A0A1I5WSL8      -----------MAINENTELEELIRNATGGSAAPPETPASSGADPEDD--SAS-------
A0A0U3JVM7      -----------MAINENTELEELIRNATGGTASPPEAPSASGGDADDD--APG-------
A0A1G1SSV2      -----------MATNENRELEELIRNATGGTASLPEAPTVGASEPEDE--SAS-------
A0A1G1SXV7      -----------MATNENRELEELIRNATGGTAFPSEAPAVGTGETEEE--SAS-------
A0A243WHR7      -----------MAVNENAELEELIRNAGGN-----EAEV-----EDDE--GAG-------
A0A076HRT9      -----------MAVNENAELESLIRNATGG-----VSAVPVESEPADD--GGG-------
A0A1M6DHW8      -----------MAINENAELEELIRNAGGG-----DTEA-----EGEE--GSG-------
A0A3D1KEX9      ----------------------------------MAEQYIEGAQQLQQEENEE-------
A0A358Y7S2      ---------------------------------------MSTGPIKKRVLNKE-------
A0A1X7J248      --------------------------MSNQQTRYQRNLEGNNSHRPQNQETEV-------
E4TQD2          --------------------------MSNQQTRYQRNLEGNTSQKPQNQESEV-------
A0A2J6HHN3      ------------------------------------------MKQKIAKFNDE-------
A0A1Y3WMT8      ----------------------------------------MEENYTSERRNDS-------
A0A1Y4GQU1      ----------------------------------------MEENYTSERRNDS-------
A0A1V5W8T5      ------------------------------------------------MFNDS-------
A0A2T8HKA9      ---------------------------------------MLKDTNIAGAEDKS-------
A0A3B8INU3      --------------------MAETNQEDYRARIQGGYPGERLEPFGNSSVLDK-------
A0A098LL25      -------------------MSLLEDEDKRSLNGSGQRVSFADDSEEEDDVFGD-------
A0A1Q3Q573      ----------------------------MENKLDLTGSGGSAPKGQQTNFAEG-------
A0A357YNR3      -----------------------------------MSMYSEVEYEFNKLADKP-------
F4KK08          --------------------------------MEYQTASTQQEPIRSSEEVST-------
A0A3N2N6F7      -------------------------MQNNTQQPLSQQMPVYQAAPVVSEEEDS-------
A0A419VXB7      -----------------------------------MDRKEELLKLLLQKEEQP-------
A0A2V1ILM4      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A3N2L0E8      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
A0A3N2LFC5      -----------------MTQNSNPFPEGYPYNPASARPEAAPSPQAPETDDSS-------
C3J7R8          ---------------------------MEYRESETKSIEQELKRPSLVEAASF-------
A0A0B0BTJ4      ----------------------------------MTENNKDIIDGRKEEENKS-------
A0A3B9CNN6      ----------------------------------MTENNKDIIDGRKEEENKS-------
R5X290          ----------------------------------MTENNKDIIDGRKEEENKS-------
A0A1Q6E6I7      ----------------------------------MTENNQDIIDGRKEEENKS-------
A0A2G2F510      ------------------------------------------MSNKSFIINKN-------
A0A316JZ08      ------------------------------------------MAKQKLFINTS-------
A0A1I1FXP9      ---------------------------MLQNAEAINNALVELEEEEELRAEKG-------
A0A3B9FXJ0      --------------------------------MSNNAKFQAAPQQESTSGSSG-------
R5GSU5          -----------------------------------MANQNYINPPAVQQETED-------
A0A2P8EAX2      ---------------------------------------MNQNKARNKGAGEP-------
A0A3N4H5N3      -------------------------------------MYMKRVLGNKMGNEEP-------
A0A2A3UE91      ------------------------------MFNPQVESANNQLKDITEKFNSG-------
A0A0A2G557      ------------------------------MNNNLYTNPEEGFIENNLSEEQM-------
A0A2N2WFW8      -----------------------------------------MAEYKKSKLNDD-------
A0A1F3IU95      -----------------------------------------MTDSRKIKFNDE-------
A0A3D0VUF6      -----------------------------------------MTDSRKIKFNDE-------
A0A1T4PT95      ----------------------------MNSNPYSNSSDVIMEKHQEIPEENM-------
A0A3Q9FR88      --------------------------------MTDFDKEWDDLNNEGDNLSNN-------
A0A150ADJ9      --------------------------------MTDFDKEFDDFDREDGNIADS-------
A0A1B1FWQ4      --------------------------------MSDFEKEWEDLENNEESSAND-------
A0A1S1Z228      --------------------------------MSDFEKEWEDLDNNEESSAND-------
A0A1F3SJM1      -----------------------------------------MSNKKSLIINKS-------
A0A2G2EB96      ------------------------------------------MSSKGIIINTS-------
A0A2G6PRA9      ------------------------------------------MNNKGLIINKS-------
A1ZKR2          -------------------------------MTDQSNIPNINTPSEDDDFLNA-------
A0A1Q3GX01      -------------------------------MEEQNHILPNNNSSENDDFFSS-------
A0A349DQI4      -------------------------------MEERNHILPTNNDSENDDFLSN-------
A0A2N3IIZ0      ------------------------MAQYLTEEERFRRLLQTDDIDSGESPLEA-------
A0A2A4PYG9      ----------------------------MYNQTTSGTDNVNAYQDRMSNFSQE-------
A0A2A5FYT6      --------------------------------METSSFSNNNEHNAFAKQQSD-------
A0A2E6SYP1      -----------------------------------------MEKEKLSILNDE-------
A0A2E5RLE8      -----------------------------------------MEKEKLSILNDE-------
A0A2E7TQF6      -----------------------------------------MEKEKLSILNDE-------
A0A2E6GVY9      -----------------------------------------MEKEKLSILNDE-------
A0A350JJ90      -------------------------------------MTEETNTNNLGVHSSQ-------
A0A3M1CDV2      ------------------------------MLVANTDNEYHSYKQRLENFSNN-------
A0A2E2TFD1      ---------------------------MIQDAREEQNESLDLYKERLTKFSQD-------
A0A2E4ELE6      ---------------------------MIHEDTSRNNENLDKYKERLTNFSQE-------
A0A2E3XZI5      ---------------------------MKQENFVQTEENINRYKENITSLTQD-------
A0A2M7NLQ9      --------------------------MSDFDENPFINPAQAADASNEENFLAD-------
I4AFR0          --------------------------MSDFDENPFINTVPTAETSNEENMLAD-------
A0A2N2Y3E5      -----------------------------------------MEERRIPILNET-------
A0A2D9D7T6      ---------------------------------------MSSLNQRKLIVNKD-------
A0A1F3PPL5      ------------------------------------------MQKKIPLINET-------
A0A357QK06      ------------------------------------------MQKKIPLINET-------
A0A2A5B3B0      -----------------------------MEENNSSNNINEEKTRKRSNLNTE-------
A0A0F2NS19      -----------------------------MQEDQFAH-----KKEVVSNFNTE-------
A0A2A5H8X6      -----------------------------MQEDQFAH-----KKEVVSNFNTE-------
A0A2H0GAU8      -----------------------------MEEEQFSN-----KREPISNFNTE-------
A0A2M8FTK1      -----------------------------MEEEQFSN-----KREPISNFNTE-------
A0A0S2HYK8      -----------------------------------------MQNRKIPIINDT-------
A0A2N5ZWN6      -----------------------------------------MQKNKIPIINDT-------
A0A2E0FJ09      ---------------------------MIEEEISKRNDSFERYRERLTNFSSE-------
A0A1F3FZ62      ------------------------------------------MAAKISQINTE-------
A0A1F3K211      ------------------------------------------MAAKISQINTE-------
A0A1F3KLL5      ---------------------------------------MKQQQRLIPVINDK-------
A0A359D1M1      ---------------------------------------MKQQQRLIPVINDK-------
A0A2E7CT70      ---------------------------MIPEEIKNTEDNLLRYRERIANFSKD-------
A0A2D5V560      ---------------------------MESENFKXVEXNFQRYKENVADLTQE-------
A0A2D7K5A8      -----------------MVNHYSNQSIMGAEEFKGAEENIQRYKENVSDLTQE-------
A0A2E1XQ82      -----------------MVNHYSNKSIMGVEDFKGTEDSIQRYKENVADLTQE-------
A0A1V6I2U9      -----------------------------------------MDENKTSLFNQK-------
A0A1F3C1M2      -----------------------------------------MSEKKIPLINEK-------
A0A1F3DS87      -----------------------------------------MTEKKIPLINEK-------
A0A2H0B957      -----------------------------------------MEQKNIPILNEK-------
A0A1F3CFW6      -----------------------------------------MEQKRIPILNEK-------
A0A2M7E2T8      -----------------------------------------MEQKRIPILNEK-------
A0A2M7NC69      -----------------------------------------MEQKRIPILNEK-------
A0A1F3K695      -----------------------------------------MEEKKIPLINEK-------
A0A353KZR1      -----------------------------------------MEEKKIPLINEK-------
A0A2N2WYB5      -----------------------------------------MYQGKIPLINDK-------
A0A1F3K4G0      -----------------------------------------MYQGKIPIINDK-------
A0A356H8Y3      -----------------------------------------MYQGKIPIINDK-------
A0A351HSA6      -----------------------------------------MYQGKIPIINDK-------
A0A1F3Q014      ---------------------------MLQEDISKTNDNFERYKERISNFSGE-------
A0A2A4YXP3      -----------------------------MEENTSSNNLNEERARKRSNLNTE-------
A0A2D5KD44      ---------------------------MQEQLSPHELEKLKQSQSSLSSFNTD-------
A0A1F3R158      ---------------------------------MSEEYRDKQNNEAISNFNTE-------
A0A2M8ADX2      ---------------------------------MNDEFNNKENKETVSNFNTE-------
A0A1J5B2H0      -----------------------------------------MQPKKFSIINEE-------
A0A1V5N756      -----------------------------------------MANIKISYLNDE-------
                                                                            

A0A1I3J6V0      MELQDYLR----I----LRAHWLAIVLLTVLGGSVAFGW-SA-LQP-RVYTASASGYVAA
A0A1H4ADG3      FDFTKIFH--------RIRANWYYCVICAIVMVGLAGIY-LY-VAN-PTYKAMATVLIKD
A0A3D5KRY6      -----FIK----A---TLLKNWYWLAAFSFAGMVGGYAY-NK-VVL-PYYRISTTVLVHD
A0A1V5IPN7      IKISDYLR--------ILLQYRYLIILIFVVVLAGTIIY-TL-RQP-RIYSASGRILMEN
A0A1V3WH52      IDIGRLVG--------TVIEAKWWVLGITAIFAVAAIVY-TL-FAT-PIYSADALVQIEQ
A0A2K8Z965      LNLRNLIS--------RYIKRWPWFVVSIGLMLAGAYIY-LL-DKQ-PVYKIQASLLVQD
A0A418M8U8      LRVSDLLP--------KFTRNWPWILFSVCVFLVAAYTY-LA-YKQ-PVYKIQASLLIQD
I2GTA4          LRVSDLLP--------KFTRNWPWILFSVCVFLVAAYTY-LA-YKQ-PIYKTQASLLIQD
A0A2K8ZAJ2      KYNLGTLL----I---RYVRNWPWFMLSILLAQAAAYIY-LL-YQP-LVYNVQASVLIKD
A0A368JPA3      SDGQGTLK--------DYLKHWKWFLISLITLIVAGFVY-IW-FTE-PIYRVQASLLVKD
A0A3P1BT12      SDVPGTLK--------DYLKHWKWFLISLITMIVAGFVY-IW-FTE-PIYRIQASLLVKD
A0A3P1CI15      SDGKGTLK--------DYLKHWKWILISLIAMLVAGFVY-IW-FTE-PIYRIQASLLVKE
A0A1Q3PII2      WTANPLWK--------TVRYHWYWFAISPLLSLLLAWAF-LR-YQT-PHYTIKASLLVRD
A0A351BXT2      DNFKIYLN--------ILRMNLIPMTIITLLCILLTIVY-VM-YAK-DIYKSSATIKIN-
A0A3D0MYJ7      NDIRFYFF--------SILKYKYIILITTIVGFLVAFFF-AR-SLP-NIYQSKVQINVE-
A0A3D3LS70      DNLHLFLN--------LVKSNWILILIVFIISAVFTGLY-VF-RAK-DIYKSSTSLLIQ-
A0A1G7ZF38      WTKNPFWK--------AVRYRWYWFLISPLLSVLLGFTF-LR-YKT-PHYTITASLLVRD
C6VS52          WANHPLWK--------AIQFRWYWLVVSPIVSLLLGTAF-LR-YKT-PRYQVTASLMVRD
A0A1G1TM36      -------------------------MVGVALALLAAYAY-NQ-LAQ-PTYEVQASILVEE
A0A1V3WH27      VDLVRLLV--------EMIDHCTMILCVTFLFILCAGLY-AW-IAP-PVYQADAMVQIEN
A0A0D3L8Q3      INFKEIIL----K----YLRYWYLFLLGTIICFGLAYLY-LR-YTT-PQYLITTSILIKS
A0A0K8QSK7      SMIKPFLL----K----LLGKWYWFVLSVVLFLAAAWLL-TR-YSM-PVYQSSSSLLILE
A0A1V6CN82      FNYKRLVS----E----LISHWYLFVLFMGIGLAGAWLY-NR-YTT-TMYSARASIMILE
A0A1M4XZ45      IDLKKIIF----K----LLHNWYWFVLSIIVALSLAFLY-NR-YTT-PVYEIKASMLVEE
A0A399D319      IDLKKIIF----R----FLRNWYWFAFVVAITLGMAFLY-NR-YTT-PIYEISSSLLVEE
A0A0P7X1V8      IDLLQIFG----L-----LWHNKWIIITLTLLGGVSAYI-YAQSQI-PIFESNGSLQITE
A0A3B0C2S4      VNLWEVAQ----K----YLRYWPWFVLGILICLGGAYAY-MR-YAP-IVYESSAKIKIID
A0A416GA42      LNPMDLLH----V----ALKKWYYYVGAVVCCLLFAYIY-LH-RTA-PMYQRMATVLIKD
A0A3N2M1H3      FSIKDYIQ----A----CKSRWQWILLSLIICVGAGVLY-IL-CQQ-PEYQRTEEVLIKD
A0A1T3IYP5      INVLDLLK----Y----LLHHWKWFTLSILIFGGFFYYQ-YS-KTP-FIYNQSEVVMIKT
A0A212K7W5      IQIQDLWK----M----SVEKWHWFAISLTICLIFAFLY-IA-ITS-PVYTRMAAVLIKD
F5IU11          IRIQDLWK----M----SVEKWHWFVISLGICLISASLY-IA-ITP-PVYTRMAAVLIKD
A0A352Z1R7      AHIYDYLS----V----ILRRRKLFTLAFCAVFFSVVLY-TY-LMK-PIYEASSTLHIKK
A0A0A2F501      LSLRDLWA----M----CWARKFWFVLSLGLFLGGAILY-IL-ITP-PVYKRTATLLIKD
R5B7P0          VQIGQLVR----R----CLSRWYWFALSLAVCLALGALY-IL-RST-PTYNTSADIQIKS
R5B0L5          VKISDVIF----I----TLKRWPWILLSLAICVGCAVLY-VL-RTP-SMYTRSASIVIKS
A0A374THP7      IRLQDLFY----L----CLAKWRWFILSLAVTLGIATYY-IL-TTP-NVYQRTASLMIKD
A0A3R5XWG1      LRLQDLFY----L----CLARWKWFVLSLFVTMGAAGYY-LL-STP-NVYQRTASLLIKD
A0A414YFM3      LRLQDLFY----L----CLARWKWFVLSLFVTMGAAGYY-LL-STP-NVYQRTASLLIKD
A0A0A2EVS5      FSLKEIFR----L----CLIRWKWILLSLLITVGAATAY-LM-ITP-VEYKRSASILIKE
A0A1T4NAJ7      FSLKEIFR----L----CLIRWKWILLSLLITVGAATAY-LM-ITP-VEYKRSASILIKE
A0A2V1IJY1      VPLTDILY----R----TLHHWPWVLLSLVVCVGAAVVY-LL-CTP-KVYTTTASIMIKD
A0A3N2KCL3      VPLTDILY----R----TLHHWPWVLLSLVVCVGAAVVY-LL-CTP-KVYTTTASIMIKD
A0A255T941      LRLQDLWG----L----CLPRWRWFVLSVLICASAAVLY-LL-RTP-NIYTRTASILIKE
A0A1Y4CHN5      ISIQDFLY----M----CLSKWYWFAISLVVLIALALIY-IM-RTP-PEYTRSASMLIKE
A0A1Y3V692      IRIQDLWG----M----FVPRWHWFALSLFAALAVAAFY-LL-STP-NIYTRTAAILVKD
A0A174TYU6      IRIQDLWG----M----FVPRWHWFALSLFAALAVAAFY-LL-STP-NIYTRTAAILVKD
A0A1M6I2S6      IRIQDLWG----M----FVPRWHWFALSLFAALAIAAFY-LL-STP-NIYTRTAAILVKD
F3PXM2          IRIQDLGS----M----FVPRWRWFALSLAVALSAAALY-LL-RTP-AIYTRHAAILVKD
A0A3E4ZNL4      IRIQDLWG----I----FVPKWYWFAISLFITLVCASLY-LL-STP-NIYTRTAAVLIKD
A0A174AHH7      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A174JCE8      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A3E4JMC4      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A412SND6      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A414IEQ9      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A415UKN5      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A0M1W8D8      IRIQDLWG----M----FIPKWYWFALSLFVALATASLY-LL-STP-NIYTRTAVILIKD
A0A3R6GKX5      IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A7V4S1          IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
B0NU19          IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
D4V601          IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A0A397WLT5      IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A0A3R6GM96      IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A0A015XH67      IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A0A078RZN2      IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A6L0K5          IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A7ACT5          IRIQDLWG----M----FIPKWYWFATSLFVALATASLY-LL-STP-NVYTRTAAILIKD
A6KY94          IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
A0A173UQR8      IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
A0A3R6HK75      IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
A0A412B7D1      IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
A0A412VNY9      IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
A0A414LTU9      IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
I9Q4U4          IRLQDLWG----M----FFQKWYWFALSLFVALATASLY-LL-STP-NVYTRTAAILVKD
A0A373ISF0      IRIQDLWG----L----FVPKWHWFVLSLFVTMSVAVLR-LM-STP-SIYTRSAAILVKD
U6RF62          IRIQDLWG----L----FVPKWRWFVLSLFVTMSVAVLR-LM-STP-SIYTRSAAILVKD
A0A073I794      IRIQDLWE----M----FVPRWRWFALSLFVTLVVAVLY-LL-STP-NIYTRTAAILVKD
A0A108TH71      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
I8VXH0          IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A412S0N6      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A412IIJ0      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A0P0FM97      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
R6KTP3          IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A139LU87      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A1C6B3Y5      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
E2NMQ4          IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A412YDB9      IRIQDLWS----M----FVPKWYWFAVCLFITLAIAVLY-LL-STP-PIYTRTAAILVKD
R7DY01          IRIQDLWS----M----FVPKWYWFAVCLFITLAIAVLY-LL-STP-PIYTRTAAILVKD
A0A414LGK8      IRIQDLWS----M----FVPKWYWFAVCLFITLAIAVLY-LL-STP-PIYTRTAAILVKD
A0A016E4F9      IRIQDLWG----M----FVPRWHWFVLSLFAALAVATFY-LL-STP-NIYTRTAAILVKD
A0A413PP50      IRIQDLWG----M----FVPRWHWFALSLFVALSVAALY-LL-STP-NIYTRTAAILVKD
A0A3A5TI83      IRIQDLWG----I----FMPRWHWFALSLFVTLATAALY-LL-GTP-NIYTRTAAILVKD
A0A415NEB6      IRIQDLWG----I----FMPRWHWFALSLFVTLATAALY-LL-GTP-NIYTRTAAILVKD
A7AJ60          IRIQDLWG----I----FMPRWHWFALSLFVTLATAALY-LL-GTP-NIYTRTAAILVKD
A0A015UXN7      IRIQDLWG----I----FMPRWHWFALSLFVTLATAALY-LL-GTP-NIYTRTAAILVKD
A0A395YYT3      IRIQDLWG----I----FMPRWHWFALSLFVTLATAALY-LL-GTP-NIYTRTAAILVKD
A0A415IPQ4      IRIQDLWS----M----FVPKWYWFAISLFITLTIAVLY-LL-STP-PIYTRTAAILVKD
A0A3E5BRW7      IRIQDLWG----M----FVPKWHWFAGSLLITLAIAVLY-LL-STP-PIYTRTAAILVKD
K9DXS6          IRIQDLWG----M----FVPKWHWFAGSLLITLAIAVLY-LL-STP-PIYTRTAAILVKD
A0A1M6KFV3      IRIQDLWG----M----FVPKWYWFAGSLFVTLTIAALY-LL-STP-PIYTRTAAILVKD
A0A1Q6G7L3      IRIQDLWG----M----FVPKWYWFAGSLFVTLTIAALY-LL-STP-PIYTRTAAILVKD
A0A413H235      IRIQDLWG----M----FVPKWYWFAGSLFVTLTIAALY-LL-STP-PIYTRTAAILVKD
A0A1M5B2J8      IRIQDLLY----L----CLAKWHWFVLSLAVCLGVAIAY-LL-RTP-PVYTRSASILIKD
A0A255RCT5      IRIQDLLY----M----CLAKWYWFVLSLAVCLGVAIAY-LL-RTP-PVYTRSASILIKD
A0A1Y4GLF5      LRIQDLFY----L----CLAKWKWFVISLVVTCGIAVLY-LL-RTP-SVYTRTASVLIKE
A0A1H3XSC0      IRVQDLLY----L----CLSKWKWFVLSLAVTVGIAVFY-LL-RTP-PVYTQTASVLIKD
B3JI46          LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A174UR09      LRIQDLLF----L----CLAKWQWFVLSLVVTVGAATVY-LL-RTP-AVYTCTASVLIKE
A6LE40          LRIQDLLF----L----CLAKWQWFVLSLVVTVGAATVH-LL-RTP-AVYTRTASVLIKE
R6NN15          IRIQDLYY----L----CLAKWRWFVLSLVICLGIAFIY-LL-KTP-PVYTRTASLLIKE
A0A358R8U0      IQIKDLLY----L----CLAKWKWFILSLLVTLSLAFLY-LL-KTP-SVYTRSATLLIKE
R6WSB6          IQIKDLLY----L----CLAKWKWFILSLLVTLSLAFLY-LL-KTP-SVYTRSATLLIKE
A0A401LPX7      ITIQDLFY----L----CLNKWHWFVISLVLCLGGATFY-LL-RTP-SVYVRTASILIKD
A0A3A5Z900      ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A3R6I893      ITIQDLFY----L----CLDKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A3R6EGW5      ITIQDLFY----L----CLDKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A285TGL6      ITIQDLFY----L----CLDKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A3A5RFX4      ITIQDLFY----L----CLDKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A1Q6IUW9      ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A3R6NPG7      ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A413XDP6      ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
K6AP24          ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A076IQN8      ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A078RYI7      ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
C7XEQ8          ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
D7INX6          ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
K5ZG55          ITIQDLFY----L----CLNKWHWFAISLALCLGVATFY-LL-RTP-SVYVRTASILIKD
A0A3N2N9B8      LPISDILF----L----TLRKWPWIILSLTICVGAALTY-IL-RTP-TVYTRAAQIMIKD
A0A3N2NMI0      VPIVDIIF----L----TLRKWPWILLSLIVCVGAAMIY-IL-RTP-DVYTRATEIMIKE
A0A359I8H7      FSLKDFLA----R----CLSKWRWFAVSIVLFCCLGVLY-VL-RQQ-PVYSRSMELLIKD
A0A3N2KA63      FSLKDFLA----R----CLSKWRWFAVSIVLFCCLGVLY-VL-RQQ-PVYSRSMELLIKD
A0A3B9FAU3      FNLRMLLD----I----VLGNWFWILQSVILFGAAGWYY-LK-ITP-NTYQRTALVVIKE
A0A3C1E5L7      FNLRMLLD----I----VLGNWFWILLSVILFGAAGWYY-LK-ITP-NTYQRTALVVIKE
A0A354SN68      FVLKDFLF----A----CLAQWKLFALSVAVCVGATMLY-LS-SKS-PVYMRRASVLMKE
A0A0A2DUD9      FSLQDLWR----L----VCIRWYVIAISILLALGVAVLY-IL-RTP-PVYKRTASVMIKA
A0A3N2N595      VPLSDIIY----R----TLHYWPLVLLSLFICVGAAVMY-LL-CTP-KIYTTSASILIKD
R5FHS9          VVITDFLY----L----CLRKWWWFAIALIIAFGVAIAY-IL-RTP-PVYTRTESVVISN
A0A3P1ZBJ5      VDIQDILY----L----CLSKWYWFLLSLILSLALGVLI-IL-RTT-PVYNRYTTIMIKE
A0A413TW79      IRLQDLMY----L----CLVRWRWFVISLVVTLGIATYY-LL-STP-GVYQRTASILIKE
A0A3E5E9M7      IRLQDLMY----L----CLVRWRWFVISLVVTLGIATYY-LL-STP-SVYQRTASILIKE
A0A3E4SK73      IRLQDLMY----L----CLVRWRWFVISLVVTLGIATYY-LL-STP-SVYQRTAFILIKE
A0A415GGC6      IRLQDLMY----L----CLVRWRWFVISLVVTLGIATYY-LL-STP-SVYQRTASILIKE
A0A413DBH9      IRLQDLMY----L----CLVRWRWFVISLVVTLGIATYY-LL-STP-SVYQRTASILIKE
G9S1S8          MRIQDLLY----L----CASNWYWFALSLMITLGAAFLY-IK-VTP-PVYTRSASILIKE
A0A354M4S6      MRIQDLLY----L----CASNWYWFALSLMITLGAAFLY-IK-VTP-PVYTRSASILIKE
R7DH52          MRIQDLLY----L----CASNWYWFALSLMITLGAAFLY-IK-VTP-PVYTRSASILIKE
A0A396N3D5      MRIQDLLY----L----CASNWYWFALSLMITLGAAVLY-IK-VTP-PVYTRSASILIKE
A0A415ZDP9      MRIQDLLY----L----CASNWYWFALSLMITLGAAVLY-IK-VTP-PVYTRSASILIKE
A0A016CWA4      LRIQDLLY----L----CLAKWKWFVLSLVVTTGVAAVY-LL-RTP-AVYTRTASVLIKE
A0A1C6H117      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A415TAH7      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A0M1W0V2      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A139KA16      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A174VQ92      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A1Q6HCG0      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A1Y4JYM9      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A3A5QW67      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A3A5RQE6      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A3A6BP07      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A3E5E153      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A3Q9IP20      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A412WV15      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A413ICP6      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A414KYB9      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A416X133      LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
E5WX00          LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
K0X3P3          LRIQDLLY----L----CLARWKWFVLSLAITTGVAAVY-LL-CTP-AVYTRTASVLIKE
A0A3A5Z014      LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLIKE
A0A1M4YZ07      LRIQDLLY----L----CLARWQWFVLSLVVTVGAATVH-LL-RTP-AVYTRTASVLVKE
A0A078S3Q8      LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLVKE
A0A069SJV7      LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLVKE
A0A3E5DXI5      LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLVKE
A0A3E5EM98      LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLVKE
A0A3E5F453      LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLVKE
I9T3G6          LRIQDLLY----L----CLARWKWFVLSLAITVGAATVH-LL-RTP-AVYTRTASVLVKE
A0A0P0FQW1      LRIQDLLY----L----CLARWQWFVLSLAVTIGAATAY-LL-RTP-TIYTRTASVLIKE
C3RFN5          LRIQDLLY----L----CLARWKWFVLSLVVTIGVATVY-LL-RTP-AVYTRTASVLIKE
A0A3E4SYU0      LRIQDLLY----L----CLARWKWFVLSLVVTIGVATVY-LL-RTP-AVYTRTASVLIKE
A6LGY1          LRIQDLLY----L----CLARWKWFVLSLVVTIGVATVY-LL-RTP-AVYTRTASVLIKE
K5ZSH4          LRIQDLLY----L----CLARWKWFVLSLVATIGVATVY-LL-RTP-AVYTRTASVLIKE
A0A078T2W6      LRIQDLLY----L----CLARWKWFVLSLMVTIGVATVY-LL-RTP-AVYTRTASVLIKE
A0A3R6D1V4      LRIQDLLY----L----CLARWKWFVLSLMVTIGVATVY-LL-RTP-AVYTRTASVLIKE
A0A3R6EAF7      LRIQDLLY----L----CLARWKWFVLSLVVTIGVATVY-LL-RTP-AVYTRTASVLIKE
A0A412MJT7      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3E4WKT5      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3A5YY33      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A078TAH2      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A1E9CFZ7      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A373FYU5      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3A5TZ72      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3A5XBP2      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3A6MEG9      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3E4JP35      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3E4KP40      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3E4NX82      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A3E4XFU8      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A412RG70      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A412TD37      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A413GAA4      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A414M7I4      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
E5UZA2          LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RTP-AVYTRTASVLIKE
A0A069SMG6      LRIQDLLY----L----CLARWKWFVLSLAVTIGAATAY-LL-RPP-AVYTRTASVLIKE
A0A1Y4PQK7      LRIQDLFY----L----CAAKWKWFVLSLLVAFGIGYYY-LL-KTP-PVYTRTAELLVKR
A0A1Y3ZDB3      LRIQDLFY----L----CAAKWQWFVLSLLVAFGIGYYY-LL-KTP-PVYTRTAELLVKR
A0A3A6AAP4      LRIQDLFY----L----CAAKWQWFVLSLLVAFGIGYYY-LL-KTP-PVYTRTAELLVKR
A0A1Y4IH41      LSIQDLFY----L----CAAKWQWFVLSLLVAFGIGYYY-LL-KTP-PVYTRTAELLVKR
A0A1Y4DYA7      LNLKDLLF----S----LLKKWYWFVISILISITIAIFY-IM-CTP-PIYTRSASLLIKE
A0A1Y3X4I9      INFKDLMY----L----CLAKWYWFVISLVVLLGFTALH-LL-TTP-PVYTRSASLLIKE
A0A1Y4FNK8      IRIQDLFY----L----CLNKWYWFVISLAVTIGVAVVY-LL-TTP-PVYTRSASLLIKE
A0A355FD59      IRIQDLFY----L----CLAKWRWFVLSLFVTLGIAVLY-LL-TTP-AVYTRSASLLIKE
A0A359CEZ9      IRIQDLFY----L----CLAKWRWFVLSLFVTLGIAVLY-LL-TTP-AVYTRSASLLIKE
A0A353Q7B4      IRIQDLFY----L----CLAKWRWFVLSLFVTLGIAVLY-LL-TTP-AVYTRSASLLIKE
A0A1M3KVR9      IRLQDLLY----L----CLFRWRWFVISLFITISIATFY-IL-TTP-PIYIRSASILIKE
F8X3A5          IRLQDLLY----L----CLFRWRWFVISLFITLSIATFY-IL-TTP-PIYIRSASILIKE
A0A3C1ITV0      FQLSDMIS----W----TLCHKKFFAISIVICVALGLIY-AQ-RAQ-RIYQRSASVMLRS
R7HN19          FQLSDMIS----W----TLCHKKFFAISIVICVALGLIY-AQ-RAQ-RIYQRSASVMLRS
A0A415EEZ4      FNIRAIVD----I----LKAKWYWFAFSIFVCLGVAWFY-YQ-ISP-EVGEQKAIVLIKD
A0A060RD97      LTARQVVE----L----VLANWYWFAVSLLVALLLGGYL-YV-KSP-LVFKRQASIMLKD
A0A350IHV0      LSLTEIWA----M----IWNNKWWYVLSLVVCIFMAGFV-IY-RTA-PKYTRTAKVIVDD
A0A077ENE7      INLLDILK----Y----LLHHWKWFVLSILIFGGYYYYQ-YS-KTP-FVYNSSEIVMVKT
T0NN57          INVLDLLK----Y----LLHHWKWFALSILIFGGYFYYQ-YS-KSP-FVYSRSEVVMIKT
X5K347          INVLDLLK----Y----LLHHWKWFALSILIFGGYFYYQ-YS-KSP-FVYSRSEVVMIKT
A0A1T5K9D4      INLVDIFF----Y----LLNHWYWFVLCIGLAVAFTSYR-YA-KTP-FSYRSNATIIIKN
R5RVP0          LNLADLWS----M----IWDNKWWYVLSVAICLCFSVFY-LY-RTA-SSYTRTAKVMIDD
A0A285T4L1      INLVDLFV----Y----LLSKWKWFVLSVLLFGGLAWYH-YA-TSP-LVFFRNVTVIIKD
A0A3E5BU42      INLVDLFV----Y----LLSKWKWFVLSVLLFGGLAWYH-YA-TLP-LVFFRNVTVIIKD
A0A414ZBF2      TVMADMIG----V----LAHHRKWFILSVAVCLLVGFIY-VR-STP-KTFSRTATILVKD
R5KD55          ISIRDILI----S----CASHWRWYVATVVVALAVAVLY-IK-KTQ-PVYKRDASIMVLE
A0A174QNT3      VTLRDLLE----L----FLNNWYWFIASILFCVGGAWLY-LS-AVS-PVYQRTAVMLVKS
R9I0H0          ITLRDIVE----L----FLNNWYWFAASAVACVAMAWIY-LS-ATP-PLYQRTAVMLVKG
K5BUT9          INLRDVVE----L----IIANWYWFVLSVLVCVGSAYFY-VL-TIQ-PVYQRQAVMLVKD
A0A174FPA3      INLRDVVE----L----IIANWYWFVLSVLVCVGSAYFY-VL-TIQ-PVYQRQAVMLVKD
R6S9Y6          INLRDVVE----L----IIANWYWFVLSVLVCVGSAYFY-VL-TIQ-PVYQRQAVMLVKD
C9KX15          INLRDVVE----L----IIANWYWFVLSVLVCVGSAYFY-VL-TIQ-PVYQRQAVMLVKD
A0A3L8AAP1      INLRDIVE----L----LIAKWYWFALSVFICVSAAYLY-TR-TLV-PVYQRQAVMLVKT
R6DAG6          INLRDIVE----L----IIAKWYWFALSVFICVSAAYLY-TR-TLV-PVYQRQAVMLVKT
A0A1G8BVM8      TAIADLLG----I----LWRNRFWFALSIIIAVSIAVFY-VR-STP-KTYSRTATILIKD
A0A416GGJ1      LNLIDVFS----F----LASKWKWFLLSVLVFGSAAWLY-YA-RKP-FVYFRSATVIIKD
A0A3D1NQW3      FSVHDLIQ----T----VIANWYWFVISVFVCVGCGYIY-IL-RTP-KIYSRTANILVKD
B0MT10          FSVHDLIQ----T----VIANWYWFVISVFVCVGCGYIY-IL-RTP-KIYSRTANILVKD
R7JGW9          FSVHDLIQ----T----VIANWYWFVISVFVCVGCGYIY-IL-RTP-KIYSRTANILVKD
A0A0E2M2Y7      FSIEEYLL----G----LLSSWKWIVGSIIVCLLVAYIY-TQ-RQS-PAYIAQAAVLIKS
A0A0K2J6Z0      FSIEEYLL----G----LLSSWKWIVGSIIVCLLVAYIY-TQ-RQS-PAYIAQAAVLIKS
B2RKZ8          FSIEEYLL----G----LLSSWKWIVGSIIVCLLVAYIY-TQ-RQS-PAYIAQAAVLIKS
A0A212GC82      FSIEEYLL----G----LLSSWKWIVGSIIVCLLVAYIY-TQ-RQS-PAYIAQAAVLIKS
A0A254MU12      FSIEEYLL----G----LLSSWKWIVGSIIVCLLVAYIY-TQ-RQS-PAYIAQAAVLIKS
R6CQ93          INLVDLFV----Y----LLSKWKWFVLSILFFGGLAWYY-YA-QSP-LVFFRSVTVIIKD
A0A3D2BF46      FSIHDLIQ----M----VIGNWFWFLLSTVVCLSCALFY-IY-TAP-KVYNRTATILIKD
A0A358R538      VTLHDILR----M----VAANWYWFVISAAVCLGAAYYY-LA-STP-RIYSRTATILVKD
A0A1Y4AAB8      FSLHDLIQ----M----ILANWYWFAISVIVCLGAGYLY-LA-RTP-KVYSRKATILVKD
A0A1Y3WWY9      INLHDIIR----M----ILMNWYWFVLSVLVCLGVAYYY-LA-KTP-KIYSRTATILVKD
A0A1Y4U5L4      INLHDIIR----M----ILMNWYWFVLSVLVCLGVAYYY-LA-KTP-KIYSRTATILVKD
A0A1Y3VCJ1      IDLHDIIR----M----VIANWYWFILSILVCVGAAYYY-LA-KTP-KIYTRSATILIKD
A0A1Y3QTW7      LTLHDLLQ----M----VLANWYWFALSVLICLGMAYYY-LA-STP-KIYSRTATILVKD
R6XWY7          LTLHDLLQ----M----VLANWYWFALSVLICLGMAYYY-LA-STP-KIYSRTATILVKD
A0A174AVF1      LTLHDLLQ----M----VLANWYWFALSVLICLGVAYYY-LA-STP-KIYSRTATILVKD
A0A373HTL7      LTLHDLLQ----M----VLANWYWFALSVLICLGVAYYY-LA-STP-KIYSRTATILVKD
A0A1Q6EIY0      ITLHDLIQ----M----VLANWYWFALSAIICLGTAYYY-LA-STP-KIYSRTATILVKD
E4M8L3          ITLHDLIQ----M----VLANWYWFALSAIICLGTAYYY-LA-STP-KIYSRTATILVKD
I3YQ50          ITLHDLIQ----M----VLANWYWFALSAIICLGTAYYY-LA-STP-KIYSRTATILVKD
R5UEY8          ITLHDLIQ----M----VLANWYWFALSAIICLGTAYYY-LA-STP-KIYSRTATILVKD
A0A1H4D866      VTLHDIIR----M----VIANWYWFVLSALVCLSLAYYY-LA-STP-KIYSRTATILVKD
A0A374A9J5      ITLHDIIR----M----VIANWYWFVLSTVCCLCAAYYY-LA-STP-KIYSRTATILVKD
A0A1Q6E9S3      ITLHDIIR----M----VIANWYWFVLSTVCCLCAAYYY-LA-STP-KIYSRTATILVKD
D4IJ36          ITLHDIIR----M----VIANWYWFVLSTVCCLCAAYYY-LA-STP-KIYSRTATILVKD
A0A414Q925      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A415PUS9      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A108TCU0      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A413BA42      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
S3Y344          TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A413MY74      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A412TGL3      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A413VJ33      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A414L0W6      TMIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A412DP39      TVIADVLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A413ZSE8      TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
B0NP84          TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
R6AK43          TVIADMLS----A----VYRNRKWFILSVAVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A412N2D9      TVIADMLS----A----VYRNRKWFILSVVVCVLIGFLY-LK-SSP-EIFLRTATVLVKD
R6LHA4          TVIADMLS----A----VYRNRKWFILSVVVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A1Q6FL18      TVIADMLS----A----VYRNRKWFILSVVVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A1Y4JYS9      TVIADMLS----A----VYRNRKWFILSVVVCVLIGFLY-LK-SSP-KIFLRTATVLVKD
A0A3E5HPT8      INIVDLFI----Y----LIAHWKWFVLSILLFGGYFWYS-YC-ETP-FVYSRTAIVMIKT
C6IJ48          INIVDLFI----Y----LIAHWKWFVLSILLFGGYFWYS-YC-ETP-FVYSRTAIVMIKT
Q8A3U2          INIVDLFI----Y----LIAHWKWFVLSILLFGGYFWYS-YC-ETP-FVYSRTAIVMIKT
A0A3R6S1H6      LNLIDLWY----M----FKRYWYWFVLSVMVFLGGAVYY-VK-STA-KIYTCVASVLIKN
A0A3R6SD81      LNLIDLWY----M----FKRYWYWFVLSVMVFLGGAVYY-VK-STA-KIYTCVASVLIKN
A0A413VXJ7      ISIADILQ----L----IWSNRYWFALSIILCIGIAFFY-IQ-STS-KVYSRKATVLIRD
I9RSN9          INIADILQ----L----IWSNRYWFILSIFLCVGIAFFY-LQ-SSS-KIYSRKASVLIRD
U6RJK5          INIADILQ----L----IWSNRYWFILSIFLCVGIAFFY-LQ-SSS-KIYSRKASVLIRD
A0A1Q6GA32      INIADILQ----L----IWSNRYWFILSIFLCVGIAFFY-LQ-SSS-KIYSRKASVLIRD
I9RPU6          INITDILH----L----IWVNWYWFVLSVLVCGGIAFFY-LK-SSS-KVYSRKASVLIRD
I8Y597          ISIVDIFH----L----VIANWYWFVLSILICAGIAFFY-LK-SSS-KVYSRKASVLIRD
I8YFS5          ISIVDIFH----L----VIANWYWFVLSILICAGIAFFY-LK-SSS-KVYSRKASVLIRD
A0A1Q6GBF5      INITDIFR----F----VLANWYWFVLSVLVCTGIAYFY-VK-SSS-KIYSRKASVLIRD
I8YFZ3          INITDIFH----L----ILVNWYWFVLSVLVCGGVAFFY-LK-SSS-KVYSRKASVLIRD
A0A1Q6GDH2      INITDILH----L----IWVNWYWFVLSVLVCGGIAFFY-LK-SSS-KVYSRKASVLIRD
U6RSB0          INITDILH----L----IWVNWYWFVLSVLVCGGIAFFY-LK-SSS-KVYSRKASVLIRD
I9SIK1          INISDIFH----L----ILANWYWFVLSVLVCGGVAFFY-LK-SSS-KIYSRKASVLIRD
I9GXM2          INISDIFY----L----VLANWYWFILSVLVCGGVAFFY-LK-SSS-KVYSRKASVLIRD
I9TP59          INISDIFH----L----VLANWYWFVLSVLVCGGVAFFY-LK-SSS-KVYSRMASVLIRD
A0A0J6CIR2      LNLSDLFH----I----VLANWYWFVLSVLVCAGVAVLY-LK-WAP-KVYTRTASVLIKD
A0A3D8HG59      LNLGDIIQ----I----VRANWYWFALSVVVCMSAAFVY-LQ-WAP-KQYTRTASVLIKD
A0A3R6S408      LNLGDIIQ----I----VRANWYWFALSVVVCMSAAFVY-LQ-WAP-KQYTRTASVLIKD
A0A354WXN6      LNILDLVK----I----AWANWYWFVISIVLCLSIAFVY-LK-WAP-KVYTRTASVLIKD
R5IP14          LSLRDILE----I----GLANWKWFALSVIVCLSIAYVY-VQ-TLP-YIYTRSASVIIKD
A0A316SZX7      INLRDILD----L----LISQWKWFALSICICLGIAFLY-LK-QAT-PIYTRTASVMIKD
A0A1Y4AIY1      VTLGDIFQ----I----VKAKWYWFALSIGICLGIAYIY-LL-QAP-KVYTRSASVLIKE
F3ZRU7          IDLVEIGT----M----LMRHWLWYIVAVALALVLGFLY-IK-STP-KTYERHASVLIKD
A0A1C5Q1F3      LHVGDWLH----I----ALANWKWFVLSLVVCMGASFWY-IK-RSP-DIYSRSASVLIKD
R7A239          LHVGDWLH----I----ALANWKWFVLSLVVCMGASFWY-IK-RSP-DIYSRSASVLIKD
A0A1M6K7I9      INIADLLL----I----LRNNWKWFAASIFVCMALAFVY-LK-STP-KTYSRKATVLIRD
A0A3R6HIK7      LNLWDLFQ----I----FKANWYWFVLSVILCVGAGYLY-LL-QAP-RVYTRTASVLVKE
K5ZVW7          LNLWDLFQ----I----FKANWYWFVLSVILCVGAGYLY-LL-QAP-RVYTRTASVLVKE
A0A1Y4D5Z0      LNLWDLLQ----I----LKANWYWFVLSVVACLGLAYLY-LK-QAP-LVYTRSASVLIKE
R5S343          LTLRDMIG----I----VWMHKWWFTASLVVCIILASGY-LM-WMP-NVYTRTASVLIKD
A0A3R5ZMK1      LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A3E4ZTK7      LNLEDILQ----V----VLANWHWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A1Y3ZIA4      LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
K5Y1A4          LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A3R6K8X4      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A1Q6I3T6      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A414XX40      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A412DM15      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A7AEU7          LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A415BDM7      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A3R5ZYK4      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A414GI87      LNLGDILQ----T----VLANWYWFVLSVVVCAGTAFLY-LK-WAP-KVYTRTASVLIKD
A0A3R6BKI7      LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A414LPI6      LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A412M2W1      LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
K5ZX55          LNLGDILQ----T----VLANWYWFVLSVVVCAGAAFLY-LK-WAP-KVYTRTASVLIKD
K5ZBN2          LNLIDMYR----V----VRANWYWFLLSVAVCCAVAALY-LG-WAP-KIYQRTATVLIKD
A0A0J6CKW3      LNLIDMYR----V----VRANWYWFLLSVAVCCAVAVLY-LG-WAP-KIYQRTATVLIKD
A0A0F5IQM7      LNLIDMYR----V----VRANWYWFLLSVAVCCAVAVLY-LG-WAP-KIYQRTATVLIKD
S0GLB0          LNLIDMYR----V----VRANWYWFLLSVAVCCAVAVLY-LG-WAP-KIYQRTATVLIKD
A0A3R6NLC1      LNLIDIYR----V----VRANWYWYLLSVVVCCAIAVLY-LG-WAP-KIYQRTATVLIKD
A0A416WYC9      LNLIDIYR----V----VRANWYWYLLSVVVCCAIAVLY-LG-WAP-KIYQRTATVLIKD
A0A0F5IT40      LNLSDLFH----I----VLANWYWFVLSVLVCAGVAVLY-LK-WAP-KVYTRTASVLIKD
S0GSI7          LNLSDLFH----I----VLANWYWFVLSVLVCAGVAVLY-LK-WAP-KVYTRTASVLIKD
K5YB65          LNLSDLFH----I----VLANWYWFVLSVLVCAGVAVLY-LK-WAP-KVYTRTASVLIKD
A0A0F5IWP9      LNLKDLFH----I----VLANWYWFLLSVLICCGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A0F5IZT8      LNLKDLFH----I----VLANWYWFLLSVLICCGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A417LKQ2      LNLRDLFN----I----VRANWYWFLLSVLLCSGAAFLY-LK-WAP-KVYTRTASVLIKD
A0A416TME1      LNLNDLFH----I----VLANWYWFLLSTLFCCGVAFLY-LK-WAP-KVYTRTASVLIKD
A0A416XPE8      LNLNDLFH----I----VLANWYWFLLSTLFCCGVAFLY-LK-WAP-KVYTRTASVLIKD
L8JI02          INIKGIVL----Y----LLSKWHYFVFAAIFLLPGAYLY-TK-YAT-KVYLVKASILLKS
A6EBM4          VDLLKITM----V----LFSRWYIIASTTLICLIAAYAY-LW-YTP-KTYATTAILKFEE
A0A2N3U785      -DLRGVLT----K----YLRYWYLFAATLLLSLAGAYTY-LR-YAT-PQYLISSTLLIQD
A0A0E3ZG78      KDIRRILL----N----YLRYWYLFLIGAALGLCGAFLY-LRYYTI-PKYSVYSTVLIKD
A0A1I6BRK6      GDLKNIVL----Q----YTRYWYLFLLGAVLSISVAFFY-LRYYAV-PQYIVSGTMLIKD
A0A243WAB1      KDIKRMVG----Q----YIRYWYLFLLGGMIGLGITYFY-LRYYAV-PQYHVYSTLLVKD
A0A399SH26      ENLLTVLL----R---KFLPYWPVFIGLAILSMALAWVY-LR-YAT-PVYEIAATLIIKD
A0A0E3ZGV6      DNLVASLV----Y---KFLPFWPLFVVLFILSVAGAWAY-LKFYAT-PTYAITASLIIRD
A0A1I2N4S1      DNLAVALL----Y---KFLPFWPLFLVLLLLGMAGAWAY-IKYYTI-PSYAVTASLLIKD
A0A2T5YE44      DNLAVALL----Y---KFLPFWPLFLVLLVLGMAGAWAY-IKYYTI-PSYAVSASLLIKD
A0A1M4YED3      ENILSILQ----F---RFAPYWPLFIILAIISGVASYLY-LK-YTP-PVYSAYSTMMIKD
A0A3P1Z8V4      TNILPVLL----KCWGIFRRYWYWFALSTVLSLIAGYVY-QQ-MQD-RVYSGEAVILIDS
A0A2L2WX98      AQLIPLLR----LCLGQLKAHWVWFLFSVIACAALGFLY-LQ-CQP-RIYQRQAVILLED
G5GD56          IQLIPLFK----MCWALFLANLKWFVLSVILCLVLGYLY-QA-RQS-RVYQRQAVILFED
R6A0L2          MQLIPLLK----LCYHQFINHWAWFALSAVVCGCIGWYY-QQ-CQP-RVYQRQAVMLIED
R7LG80          MQIIPLLK----LCINQLLRNWYWFLLSIVICLGLGWIY-RQ-SQP-SVFKQQSVILIEE
A0A1M6XHU0      INFAEIWH----T---IRRGKWI-ILLTTLVVAGVIGAY-TY-TLP-PVYESSAIVFVDT
D0MHQ9          INFAEIWH----T---IRRGKWI-ILLTMLVVAGAIGAY-TY-TLP-PVYESSAIVFVDT
G2SF81          INFAEIWH----T---IRRGKWI-ILLTTLVVAGIIGAY-TY-TLP-PVYESSAIVFVDT
A0A2H3NSN0      VDLNTIWH----T---IKRGKWI-ILGTCLAMIAAFAGY-TF-MVA-PEYEAAATVQVEK
A0A2P6C324      LDLGALWE----A---VKRSKWV-ILGTCVFVTALTAAV-TM-MMP-QVYEAGAVVSVER
A0A126PFG0      LNLRAVLA----R----YRYHWSLFVAGVALALLGAYLY-TQ-LVQ-PAYEVRASLLVEG
A0A3M1N7Z3      WDLRRVLI----V----LSREWWWPTLSVLFAAFTAWAY-LR-YTE-ATYQTTAVVQVNL
R7PCR1          INFQQIIG----ICIVILQKHWMWFLTSVVLFVVLAFVY-SR-TQP-QVYQRTAVLEIED
A0A2A8CVM9      IDVAEILD----M---LRRGKWI-IAATTIVVVALVGAY-TY-TVD-PVYEAKSIVKIDL
A0A3C0ZQC7      -TFQDYVQ----I---VLRGKWM-ILASFLLVLAGTAVF-TF-TTS-PVYESTATVLVDT
A0A2E3R1D0      IDLRALLD----I---LLRGKWI-ILGAVLALTIPVMVY-SM-LSP-SKYRSYAILLVDK
A0A2T2USC0      ITLQEIIG----M---LWGGKWV-ILATFVVVVALGAAY-TF-TQT-PIYESSNLVLVEK
A0A2T2V0F3      ITLQELVG----M---LWGGKWV-ILATFAVVLALGAAY-TF-SQT-PIYETSSLVLVEK
A0A2T2S682      -RLRALLS----T---LWGGKWI-LLTVFVLVVGTVAVY-TY-TRT-PQYKTSTLLLVDL
D5H561          GQIEELLD----L---LRRRKWL-IVLVCLATVAGAALY-TY-TQV-PVYRTSSLVLVEK
A0A2H3NWA9      -QLREMAG----L---LWAHKWI-ILGVFVVVMAAAGVY-TY-TLP-NQYQTSSLLLIKP
A0A2A8CVB6      -QLHELLG----T---LWRGKWI-ILGVLIVVLAAGTAY-TL-SIP-TTYRTSSLLLVDK
A0A2P6C1S6      -QLHDLIQ----T---LWEGKWI-ILGVVTAVVLAAAAY-MY-TIP-TTYRTSSLLLVDR
A0A2T2UTM4      -QLHDLIQ----M---LWDRKWI-ILGIVAVAVLSAAVY-TY-TIP-ATYRTSSLLLVDR
A0A1T5MMH4      IDFNKLKV----I----VRNNLVWIALIFLVINLTAYLI-IR-YTQ-DRYESFSE--IKL
A0A2W4R1L8      IDFSKLRT----I----IRNNRLWILAIFVVINLLTYLLFIR-YSP-DLYESHSE--IKL
A0A2E5CV79      ----MELM----G----ILRFHYKLILTITLFGIMIFTY-RT-YTIHPVYRSTSS--III
A0A2A4G4B1      IDLQELLG----F----VLSQWKKMVLGGLIGALLAFGY-LK-TVN-PKFRVETS--VLL
A0A2D4ZVH1      IDLIKVFN----I----LLLHKWALIGITVLFTVVAIIF-AQ-LQT-PIFQSTGTL-IVS
A0A0E3V905      LNIRALLS----K----YSKLWPWFILSTVLMLAIGHIY-IS-NKQ-PIYKIQAS--LLV
A0A1M6GR99      LNIQDIFK----L----FFKNIWIVISCIIVALGIAYFY-NW-YSI-PTFKVSAT--LLL
A0A1M5BA90      NAVEAFMY----R----YLPYWPLFALLLILAGTAAYMY-LH-YIAKPVYQISAN--ILI
A0A1V9F098      MNIISVVT---NW----YLPYWPMFLVLLILGLAGAWAY-LK-FYSIPVYETYAT--IMV
A0A1V9FHD0      MNIISLAL---NW----YLPYWPLFLILIVLGSAGALVY-LN-FFATPVYETYAT--VMV
A0A1T5CS78      NLFRYIIK----T----FFPFWPLFLVLVVVCVLGAWGY-LK-YVT-PIYEASAS--IMI
A0A0Q9Z8F1      NLFRYIIK----T----FFPFWPLFLVLVVVCILAAWGY-LK-YAT-PIYEASAS--IMI
A0A2N0U0M7      NLFRYIIK----T----FFPFWPLFLVLIVVCILAAWGY-LK-YAT-PIYEASAS--IMI
A0A1M6TTV4      LDFDKIKQ----V----FVKNVIWMLLILLLINASTVLY-VR-YTK-PIYSSESI--LKL
A0A1Q6IT42      IDIVALWR----A----ACRKWYLFAGSVVVCVALVVCY-LK-IAK-PVYEVSADI-LVN
K0X1U5          IDIVALWR----A----ACRKWYLFAGSVVVCVALVVCY-LK-IAK-PVYEVSADI-LVN
A0A416XAH0      IDIVALWR----A----ACRKWYLFVGSIVVCVALVVCY-LK-IAK-PVYEVSADI-LVN
R5EXK3          IDIVALWR----A----ACRKWYLFVGSIVVCVALVVCY-LK-IAK-PVYEVSADI-LVN
A0A401UAP7      IDFSKLKS----I----LLKNTVWILLLFILCNLSAYLY-IR-YTK-NVYEAEAE--IKL
A0A1W2GF52      FDFEKFRQ----V----FASGWPWVLGILITTMSLSFLY-MR-YTK-PIYSAESI--LKL
A0A2G5L7B8      IDFDKLNQ----V----FIKNLPWIILILILFNAGTFLY-LR-YTK-PIYSSESI--LKL
A0A0D3LFR6      IDFDKLFS----V----LKKSLPIIVVIFLVCNMGAYLY-IR-YTK-PLFQSNSE--LQL
M7N6D4          IDFDKLYN----V----MKKSLPIIIVIFLVCNLSAYLY-LR-YTK-PLYRSDSE--LQL
A0A364XUP5      IDINKLRV----T----IWDNILWILLIFVVTNTAAYLV-IR-YSK-DIYQSVSE--LKL
A0A1M5RLA9      LDLNKLKT----T----LKRNWLWLIILFLVINSVAYLK-VR-YTK-NLYESSSE--LKL
A0A385SFR9      LDLNKLKI----I----FKRNWLWLVVLFLVINSIAYLK-VR-YTK-NVYESSSE--LKL
L8JW09          IDLDKALT----V----LRKSIPWILLIFIVTNLSAYLY-IR-WTK-PLYESESE--LKL
A0A1Q3ZMZ7      ----------------------------------MGYIY-LR-YTK-SVYESSAI--IQI
A0A2D8JJW3      FSIYDFLY----F----LKRNYIYILIITLFCFLVGCFL-TL-RIK-PIYSSYAE--IEI
A0A2W2AFF7      LNVHKLIG----I----VMSHWVWFAVSLFLTLILSFVL-LR-YST-PAYKINAT--VLI
A0A2N5YXE2      FDPRTFFT----I----FKKNFWLILIIFVVSLAAGYAY-FR-YTR-PVYKTTTV--LQI
A0A2I0QZ80      FDTNILKI----V----IKRNWYWCVLIFSLFIVLGFLY-LR-YTK-PVYESRML--IQI
A0A2U2XBJ3      FDLKVLKI----V----IKRNWYWCALISILLVVSAFIY-VR-YTK-PVYESSML--IQL
A0A3E1F1A3      LDFKVLKI----V----IKRNWYWCVLISLILGILAFSY-VR-YTK-PIYESKML--IQI
A0A1V9F383      KNIGSLIV---NW----YLPYWPLFLILIIVGVGSAWAY-LH-FIAVPVYETNAT--VMV
G8TRZ6          KNIGSLII---NW----YLPYWPLFLILTVVGLAAAWAY-IN-FVAVKQYESYAT--VMV
A0A2W1NDY9      IDIDILKT----V----FKKNWIWLLLCVIIGVSIAFVY-LR-YTK-PIYESRAI--IQR
A0A1G0CI31      YNPLIAAT----I----VKRYWWWTLLFVTCFTAIAFVY-LR-YTK-PIYDSSMV--IQL
F2IKD6          YNPIIAQV----I----LRRYWWWVLLLIIFFMSVAFFY-LR-YTK-PVYDSTTL--IQL
A0A1I7BM74      FDLDIIRN----V----LKKNFLFALLIIAFFGALSFLY-LR-YTK-PVYQSQMV--IQI
A0A2G2FJ17      FDTDILRI----V----IRKNWIWLMLIATILLSSAFLY-LR-YTK-PVYESKML--IQI
A0A416X8R7      VTLRDIVE----L----VFDNWYWIVLSVVICMSVAWFY-LA-MQT-PLYKRSAV--MLV
K0XJ09          VTLRDIVE----L----VFDNWYWIVLSVVICMSVAWFY-LA-MQT-PLYKRSAV--MLV
R5EUZ0          VTLRDIVE----L----VFDNWYWIVLSVVICMSVAWFY-LA-MQT-PLYKRSAV--MLV
W0EQS0          ITLRDIVE----L----IFDNWYWIVLSIAVCVSVAWLY-LA-MQT-PLYKRTAV--MLV
A0A1Y3WE15      ITLRDIVE----L----IFDNWYWIVLSVAVCVLVAWLY-LA-KQT-PLYKRSAV--MLV
A0A1Y4GUK3      ITLRDIVE----L----IFDNWYWIVLSVAVCVSVAWFY-LA-MQT-PLYKRSAV--MLV
A0A2U1FKU2      FSVEEFLF----S----LLSSWKWIVGSVVACALIAYIY-VQ-NQS-PVYHAQATVLIKS
A0A0A2F954      FSLEEFFL----G----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
A0A0A2FW91      FSLEEFFL----G----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
A0A2D2N2N1      FSLEEFFL----S----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
Q7MWZ2          FSLEEFFL----S----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
T2NDT6          FSLEEFFL----S----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
W1R7P9          FSLEEFFL----S----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
A0A1R4AFZ0      FSLEEFFL----S----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
A0A1R4DVZ7      FSLEEFFL----S----LLTSWKWIVASVLACLLIAYIY-IQ-RQS-PIYHAQATVLIKS
A0A1G9E2A9      IDWPKLLS----I----VNRSIVWVLLFVALGVLAAWIS-LR-YIK-PVYESASL--LKL
A0A2T2YJE8      IDFIMLLS----I----IRKSLIWVSLLIVLGLIGAFLF-LR-YTK-PLFKSSST--LKI
A0A3M9N829      IDFVTLLD----V----VKRSILWVVLLILLGGAGAYLY-LR-YTK-KVYESSST--IKL
A0A0P0CSF9      IDFVTLLH----V----AKRSIPWIILLVLLGIGGSYLY-LR-YTK-KVYESSST--IKL
A0A3M9MNC3      IDFVTLLH----V----VRRSIPWVLLLVLLGVSASYVY-LR-YTK-KVYESSST--IKL
A0A2M6GH67      --FITLLV----V----TRKSLIWIVFLIMLGLGASYLF-LR-YTK-PVYRSSST--LKI
A0A127B287      IDLVTLWH----V----VRRSIPWVILLVLLGLTGSYLF-LR-YTK-KVYESSSV--IKL
A0A369QP10      IDFIMLLS----L----VRKSLIWVALLIVLGLIGSFLF-LR-YTK-PLYKSSST--LKI
A0A418R9X5      LDLTTLLM----V----ARRSLPWMVLLIMIGLTASWLF-LR-YTP-PVYRASST--LKI
A0A428JSJ3      LDLSTLLM----V----ARKSLPWMLLLIALGVTASWLF-LR-YTP-PLYKASST--LKI
A0A428KI59      LDLTTLLM----V----ARKSLPWMLLLIALGVTASWLF-LR-YTP-PLYKASST--LKI
W8F1I6          LDLTTLLM----V----ARKSLPWMLLLIVLGVTASWLF-LR-YTP-PLYKAAST--LKI
A0A246FQC0      LDLTTLLM----V----VRKSLPWMVLLIALGLTASWLF-LR-YTP-PLYKSTSA--LKI
A0A372E5P8      LDLTTLLT----V----ARRSLPWIILLVALGLTAAWLF-LR-YTP-PLYKSSST--LKI
A0A1H3EMW1      LDLTTLLA----V----ARKSLPWMVLLIGLGLTAAWLF-LR-YTP-PLYKSTST--LKI
A0A1H9ZSN3      LDLTTLLT----V----ARRSLPWMVLLVVLGLTASWLF-LR-YTP-PLYKSTST--LKI
A0A0M3RW20      LDLSTLVM----V----VRKSLPWMLLFILLGLLTSWTY-LR-YTK-PVYKSSSI--LKI
A0A1S9B3W0      LDLPLLLS----V----TRRSLPWMILLILLGLGASWTY-LR-YTK-PIYQSSST--IKI
A0A1W1VRL3      LDITTLLQ----V----ARKSLPWIALLIALGLTSSWLF-LR-YTK-PVYQSSSV--LKI
A0A1M6R305      LDFDTLLM----V----VRRSLIWLLLLIGLGITGSWLF-LR-YTK-PVYKSSSL--LKI
A0A2M9B9H9      LDLTTLLL----V----ARRSILWIILLIALGLSASWLL-LR-YTK-PVYKSSSL--LKI
A0A126PDF2      LDLSTLAL----V----ARRSLLWLLLLLALGGSAAWLY-LR-YTK-PVYKSTSL--LKI
A0A2Z3GKA1      LDLSTLAL----V----ARRSLLWLLLLLALGGSAAWLY-LR-YTK-PVYKSTSL--LKI
A0A328BL48      LDLPLLLS----V----ARRSLPWMILLVLIGLAASWSY-LR-YTK-PLYRSSST--IKI
A0A3S0QKV1      LDLPLLLS----V----TRRSLPWMLLLLLLGLAASWTY-LR-YTK-PVYQSSST--IKI
A0A3R9P8H7      IDFTTLLT----V----ARKSLPWMLLLIALGLTAAWLF-LR-YTP-PLYQSSST--LKI
A0A212UCJ7      LDLTTLLM----V----ARKSLPWVLLLISLGLLASWLF-LR-YTS-PVYQSSST--LKI
A0A238WIA7      LDLTTLIM----V----ARKSLPWVLLLVMLGLLTSWLF-LR-YTR-PVYQSSSV--LKI
A0A0W8EDI5      FDVATLLM----V----TRRSLPWMVLLIALGLTAAWLY-LR-YTQ-PVYQSAST--LKI
A0A3B7RBP8      FDISTLLM----V----VRRSLPWMILLVLLGVTAAWLY-LR-YTQ-PIYQSSST--LKI
A0A1I5WSL8      LDISTLVL----V----ARRSLLWLILLIALGLTASWLY-LR-YTK-PVYKSQSL--LKI
A0A0U3JVM7      LDIATLVL----V----ARRSLLWMLLLVGLGVTASWLY-LR-YTK-PVYKSASL--LKI
A0A1G1SSV2      LDITTLVL----V----ARRSLLWMLLLIMLGTTASWLY-LR-YTK-PVYKSASL--LKI
A0A1G1SXV7      LDITTLVL----V----ARRSLLWMLLLITLGLTASWLY-LR-YTK-PVYKSASL--LKI
A0A243WHR7      LDLVTLLL----V----ARRSLIWVVLLIVLGLTGSWLY-LR-YTK-PVYQSLSI--LKI
A0A076HRT9      LDFDTLLM----V----VRRSLLWLLLLIGLGLTGSWLF-LR-YTK-PVYKSSSL--LKI
A0A1M6DHW8      LDIATLLL----V----ARRSLIWIVLLIALGLTASWLF-LR-YTK-PIYKSTSL--LKI
A0A3D1KEX9      MDIFSILRICVAV----FLRNWKWFLLSVVACLLFALLF-VK-KQP-RVYSRQSTLLIEN
A0A358Y7S2      FNPLILEE----I----LKRHWRAPIFYSTIFLIFAYLY-IR-YSV-PIYQTKAL--VQV
A0A1X7J248      VDFFKLKT----I----LKKNLPWAILLIIIAVFVAFLY-VR-YTN-VKFQSYAE--LKL
E4TQD2          VDFYKLKT----I----LKKNLPWAILLIAIAVFVAFIY-VR-YTN-VKFQSYAE--LKL
A0A2J6HHN3      FDFKLFLY----I----AKRNLKRIILFFIVLFLFLFLY-LR-YTQ-PIYESSTI--VQL
A0A1Y3WMT8      VDVLALWR----A----ARKRWYLFAGSVFICVVLVACY-LK-IAK-PQYAISADILVNE
A0A1Y4GQU1      VDVVALWR----A----ICRKWYLFVGSVVVCVALVACY-LK-IAK-PQYEVLADILVNE
A0A1V5W8T5      FDVSKLIH----I----LRQNFIFYIIFGLIAGISAFTY-LR-YTP-PIFDAYTV--IQI
A0A2T8HKA9      INVLDLLK----Y----LFVHWKWFLLSVLFFGGYYYYQ-YS-KTP-FVYSKAAILMIKT
A0A3B8INU3      IDTEKIAS----V----LRRSIVWVVLIIVGAVASAYLV-VR-YTK-PLYESVSD--IKL
A0A098LL25      FDFAKLLV----I----ANKSLVWVILLVVLSITGAFLY-VR-YTK-PVYESSSI--LKL
A0A1Q3Q573      FNLGLLIY----I----LNKSILWIILIVAITVFASFIY-LR-YTP-RIYEATTKMILQL
A0A357YNR3      VDVLSILM----K----YLIHWKWFLVSIFICIFLAVVY-VY-FTL-PKYMIQTS--ILF
F4KK08          FSLRDILM----I----LKANWLFILLSFLVCLALGFLY-IK-SSS-HQYSRSAS--LLI
A0A3N2N6F7      INISDFLS----L----CVRCWKWFAFSVAACLIIGALY-VL-TSP-KIYTRTAQ--VVV
A0A419VXB7      QNIKDFLF----K----LLYHWKWFVLTVVVGVGIAFVF-NR-YTP-ATYRVKSL--LFI
A0A2V1ILM4      FNLHDFFI----L----CLNKWKWFVISIIIFLGLGVLY-IM-STP-ETYTRTAS--VMI
A0A3N2L0E8      FNLHDFFI----L----CLNKWKWFVISIIIFLGLGVLY-IM-STP-ETYTRTAS--VMI
A0A3N2LFC5      FNLHDFFI----L----CLNKWKWFVISIIIFLGLGVLY-IM-STP-ETYTRTAS--VMI
C3J7R8          ITLSDIGL----I----LRSNWYWFAITLCVAIGGASAY-LL-HTP-NVYKREAS--ILV
A0A0B0BTJ4      ITLRDIFD----F----IVFNWYWFALSAIAFAGIGIVY-AL-SRP-DVYRSSAM--VLI
A0A3B9CNN6      ITLRDIFD----F----IVFNWYWFALSAIAFAGIGIVY-AL-SRP-DVYRSSAM--VLI
R5X290          ITLRDIFD----F----IVFNWYWFALSAIAFAGIGIVY-AL-SRP-DVYRSSAM--VLI
A0A1Q6E6I7      ITLRDIFD----F----IVFNWYWFALSAIAFAGIGIVY-AL-SRP-DVYRSSAM--VLI
A0A2G2F510      YDPLILRT----I----LKRYWWWPLTFILLFSALAFTY-LR-YTK-PVYESAMI--LQL
A0A316JZ08      YDPLILRT----I----VRRYWLWVLGFVGIFVVLAYFY-LR-YTK-PVYESSLM--LQI
A0A1I1FXP9      INSDKLLS----I----LNKSLWWIIMFVVVATLGAYTY-VR-YTR-PTYEAYSV--LKL
A0A3B9FXJ0      VDLQLLLL----F----TWKNRYIILLIMMLSLLAGYMV-NK-YSV-PRYSAKSV--VQF
R5GSU5          IDWLSIVRACTGT----LRRQWRWFVFSIIVCGCLAFLY-ER-KQP-RVYQRQAVIEIEG
A0A2P8EAX2      IDLFKSVR----L----LLPYWPYIIASILLFVGLSFLY-LK-SAT-PFYEITSS--VLI
A0A3N4H5N3      IDLSVVFK----S----LVKHWYLFIICVIIFLGLAFLY-LR-IAT-PVYEISGS--VII
A0A2A3UE91      FDIGVIAF----L----FMKSRIYIVLFFVISFSLAFLY-LR-YSQ-PIYESRAI--IQI
A0A0A2G557      ISLSDIFY----L----LRQNWYYFIACLLIALICGYVY-IK-STP-NSYERTAS--VLV
A0A2N2WFW8      FDFKLFLF----I----ARRNLKFILVFFALLFALIFMY-LR-YTL-PVYEASSV--VQI
A0A1F3IU95      FDFKLFLN----I----TRKSLIYIIVFSALLFTAVYVY-LR-YTQ-PVYESACI--VQI
A0A3D0VUF6      FDFKLFLN----I----TRKSLIYIIVFSALLFTAVYVY-LR-YTQ-PVYESACI--VQI
A0A1T4PT95      ISLSDIFY----L----LQQNWYYFIFWLIIALAGGYIY-IK-STP-NSYEKTAS--VLI
A0A3Q9FR88      IDFDKLEF----V----IKKKFIWVILILMMAGICAFLY-IR-WTP-RIYEASTLNQIKL
A0A150ADJ9      IDFDKLEY----V----VKKNIVWVLLLISLTTICAYLY-IR-WSP-RIYEATTLNQIKL
A0A1B1FWQ4      IDFDKLEF----V----VKKNIIWVILLLILSGVAAYLY-IR-WTP-EIYQANTLNQVKL
A0A1S1Z228      IDFDKLEY----V----VKKNIIWVILLLMLSGIAAYLY-IR-WTP-EIYQAHTLNQVKL
A0A1F3SJM1      YDPLILRT----I----LRRYWWWPLTFVFIFGLLAFSY-LR-YTK-PIYESSMI--LQL
A0A2G2EB96      YDPLILRT----V----LKRYWWWAALLVMAFASFAYIY-LR-YTK-PTFESSMV--LQL
A0A2G6PRA9      YDPLILRT----V----LRRYWWWAALLVLTFAACAWVY-LR-YTK-PTYESSMV--LQL
A1ZKR2          LDLEKVWE----I----FRKSIIWMLLLPLFTISIGHLW-LR-YTK-PVYKSSST--LKL
A0A1Q3GX01      IDLEKIWE----I----LKKSILWMLLLPLLTLSVAHIW-LR-YTK-PIYESSSN--LKL
A0A349DQI4      IDLEKIWE----I----LKKSILWMLILPLLTLSVAHIW-LR-YTK-PVYESSSS--LKL
A0A2N3IIZ0      IDFAKILY----I----LRKNWYWLIVFPLLSVSLAYLY-LR-YTK-PIFQSTAN--LKM
A0A2A4PYG9      FDLGVFIG----I----LKKQFKWIVLFFLLAGIGAFLY-LR-YTP-LLFEASAL--LQM
A0A2A5FYT6      FDFGLLLY----I----TQRNIFWIIAILIVAGTAAYFY-IR-YTP-PIYESIGI--IQV
A0A2E6SYP1      FDLGLALL----I----IRRNLFLTILLILMGAGFAFFV-NR-YTT-PTYYASSV--VKI
A0A2E5RLE8      FDLGLAIL----I----IRKNLISILFSISIGFCVAFFI-NR-YTT-PQYSASSI--VKI
A0A2E7TQF6      FDLGLAIL----I----IRKNLISILFSISIGFCVAFFI-NR-YTT-PQYSASSI--VKI
A0A2E6GVY9      FDLSLAIL----I----IRKNLLFIVLSIFLGFCIAFFI-NR-YTT-PQYYSSSI--VKI
A0A350JJ90      FDLGLLLM----I----TSKSLIWIVSIILLLGGLAFTY-VY-YTQ-PKYESTSI--IQI
A0A3M1CDV2      LDIGLLID----I----TLKSKWWYVLFFSIAGISVFLY-LR-YSE-RIYSSQSI--IQI
A0A2E2TFD1      FEIGLFIH----L----IQKSFIWILLFVSLAFGGAYLY-LR-YYQ-PMYQSTSI--LQL
A0A2E4ELE6      FEIGLFVH----L----AQKSLLFVLAFFVIAFISSSLY-LR-YTQ-PIYSSSSI--LQL
A0A2E3XZI5      FELGLFLY----L----INKIKWVLITILIIFLLGSRIY-LR-YKP-EIYKTETR--LQL
A0A2M7NLQ9      FDVSKLIR----V----VKKKLIYVIFLLIICVVASWIV-LR-YTK-RVYSSSST--LKL
I4AFR0          FDVSKLIR----V----VKKNIIYVILLLIICVAASWVV-LR-YTH-RIYNSSST--LKL
A0A2N2Y3E5      FDIPLFLL----V----FRKSLLYFTIIAVLCGAGAYAY-LR-YTQ-PLFQASAI--IQL
A0A2D9D7T6      YNPLILGE----I----LRKHWFAPILFIVFFSTVAFFY-LR-YTK-PIFQSKAV--IQI
A0A1F3PPL5      FDVRIFTY----I----IKKSMFLVAIIMGISIVGAFLY-LR-YTP-PLYQSITV--LQI
A0A357QK06      FDVRIFTY----I----IKKSMFLVAIIMGISIVGAFLY-LR-YTP-PLYQSITV--LQI
A0A2A5B3B0      SDPILFFH----L----LKQNLLSFAIIIAVCLMGAFIY-LR-YTT-PIYESVLV--YQV
A0A0F2NS19      LDIILLLK----V----FKKTFIYFVGIIAICVTLSLIY-LR-YTV-PIYQSKLV--LQV
A0A2A5H8X6      LDIILLLK----V----FKKTFIYFVGIIAICVTLSLIY-LR-YTV-PIYQSKLV--LQV
A0A2H0GAU8      LDIILLLK----I----FKRNLFLFIAIITICVVVSFVY-LR-YTI-PIYQSQLV--LQV
A0A2M8FTK1      LDIILLLK----I----FKRNLFLFIAIITICVVVSFVY-LR-YTI-PIYQSQLV--LQV
A0A0S2HYK8      FDIITFKR----I----LYRSVWIGLFIILLALGAGFLK-IR-YTA-PLYEAKSV--IQI
A0A2N5ZWN6      FDITTFKR----I----FIRSFWMGIIIMMLVIGGAFLK-IR-YTS-PVFEAKSV--LQI
A0A2E0FJ09      FEIGLFLY----L----TRQIWVWMLLIVIVCFGLGFLY-IR-YTP-PQYKAKAL--IQR
A0A1F3FZ62      FDLGLLFK----I----IQKTILPIFILFIISSTIAFLY-LR-YTH-PVFEASSV--IQL
A0A1F3K211      FDLGLLFK----I----IQKTILPIFILFIISSTIAFLY-LR-YTH-PVFEASSV--IQL
A0A1F3KLL5      FDLPIFLM----I----IRKSIWWIVIIFILALFSAFAF-LR-YTP-PIYQSNSI--LQI
A0A359D1M1      FDLPIFLM----I----IRKSIWWIVIIFILALFSAFAF-LR-YTP-PIYQSNSI--LQI
A0A2E7CT70      FEIGLFLY----L----LKKSRFTIILILLSAFSLGFLY-LR-YTP-KTYQTSAT--LQI
A0A2D5V560      FELGLFLY----L----LNKIKWYAITLIILCITSAFIY-IR-YTP-KTYQTSSI--IQV
A0A2D7K5A8      FELGLFLY----L----LNKIKWYSIIIIIISISLAFLY-LR-YTP-KTYQTGAL--IQV
A0A2E1XQ82      FELGLFLY----L----LNKIKWYAIIILIISISLAFLY-LR-YTP-KTYETGAL--IQV
A0A1V6I2U9      FDARTFLI----I----FKKNVWVVILLILISLGAGFAY-HR-YST-PRYKTSTI--IQV
A0A1F3C1M2      FDIGLFVY----I----VKKSLILIGLLIGIAAVSVFAY-LR-YTL-PTYKSSSI--IQI
A0A1F3DS87      FDFALFIY----I----IKKSAILIGLLIGIAIFSVFAY-LR-YTL-PTYKSSSI--IQI
A0A2H0B957      FDFNISLQ----V----FKKSIILSVLVFILAAVGAFVY-LR-YTQ-LIYKSVSI--IQL
A0A1F3CFW6      FDVNIFLQ----V----FKRSIILSIIIFFAAIVGVYVY-LR-YTL-PIYKSSSI--IQL
A0A2M7E2T8      FDVNIFLQ----V----FKRSIILSIIIFFAAIVGVYVY-LR-YTL-PIYKSSSI--IQL
A0A2M7NC69      FDVNIFLQ----V----FKRSIILSIIIFFAAIVGVYVY-LR-YTL-PIYKSSSI--IQL
A0A1F3K695      FDLGLFLF----V----FRKSILLIGIFLFLIVAVMYAY-LR-YTP-PLYRASSV--IQI
A0A353KZR1      FDLGLFLF----V----FRKSILLIGIFLFLIVAVMYAY-LR-YTP-PLYRASSV--IQI
A0A2N2WYB5      FDFAIFMQ----I----LKKSLWVSIVLILLSFFAAFLY-LR-YTQ-PLYSTQTI--IQI
A0A1F3K4G0      FDLAIFLQ----I----VRKNYWAPILFVAVSFVASFLY-LR-YTQ-PVYQTQSI--IQI
A0A356H8Y3      FDLAIFLQ----I----VRKNYWAPILFVAVSFVASFLY-LR-YTQ-PVYQTQSI--IQI
A0A351HSA6      FDLAIFLQ----I----VRKNYWAPILFVAVSFVASFLY-LR-YTQ-PVYQTQSI--IQI
A0A1F3Q014      FELGLFIF----I----ARKSFFWIILFFILAFLGASAY-LR-YTT-PIFESSSV--LQI
A0A2A4YXP3      SDPILFFH----L----LKRNLLLFAVIIICCLLVSLVY-LR-YTA-PVYEAKLV--YQV
A0A2D5KD44      FDLGLFLY----I----IKKNLLWVMLTIGMSILGSFLY-IR-YTA-PVYRASAD--IQI
A0A1F3R158      LDIILLLQ----I----FKKNLLLFIAIIITTSIVAFIY-LR-YTV-PLYQSQLV--LQV
A0A2M8ADX2      LDIILLLQ----I----FKRNLFLFAAIILACAVISFIY-LR-YTI-PLYQSQLV--LQV
A0A1J5B2H0      IDPKLFLF----L----VKRNLLLFAILFIMAIAGSYIY-LR-YTP-PIYETHSI--IQL
A0A1V5N756      FDLKLLLS----I----VKKNIPYVLIIFAFFFTLAFLY-LR-YTY-PKYETSGT--IQI
                                                                            

A0A1I3J6V0      ANTGSDT--------------GSSLVGDQLARGKVTSYVDIGGWRAVAEYAISDL-----
A0A1H4ADG3      NTGQN-----NSPQSNGISSLQSLGLFPGAS--NVDNERDILVSYPLIHQVVSDL-----
A0A3D5KRY6      E--SK-----TTDLNN---IYRQLSTIQGGP--AIQDEVGVLQSYNLSLQTVKYF-----
A0A1V5IPN7      Q----------SSGAD---ILLLTNQGGGKN--SINNQIELMRSKPILNAAYEIM-----
A0A1V3WH52      N-----------TGNS---LVQDIGSALANKPPASEAEIQLIQSRLVLGKTVHDL-----
A0A2K8Z965      Q--QK-----GSEQNN---TLKELGVFTPKQ--VVENEIEVLRSFTLMNRVVEKL-----
A0A418M8U8      E--KK-----GNERDQ---PLKELDAYVPKK--VVENETEILRSYTLMNRVVDKL-----
I2GTA4          E--KK-----GNERDQ---PLKELDAYVPKK--VVENETEILRSYTLMNRVVDKL-----
A0A2K8ZAJ2      E--RK-----GISEQS---AMKETNIFTQTK--LVENEIEILRSYSLMDRVVTNL-----
A0A368JPA3      EPPKS-----GVSSDG---ILKDLTTYSPGK--VIENEIEILKSSSLMKKVVDSL-----
A0A3P1BT12      D--QK-----SPSDNG---VLKELNIYSPSK--VVENEIEILKSNSLMKKVVDSL-----
A0A3P1CI15      G--KD-----NVADEG---LLKQLHIYSPNK--VVENEIEILKSNSLMKKVVDSL-----
A0A1Q3PII2      DSRGS-----DFNESA---LLEELGLPNATS--SVENEIEILRSRTLLSQVVADL-----
A0A351BXT2      -RPQG-----SVLSSS---LIPEFQDFITDR--YISNEIEVLKSYKIREMVAENL-----
A0A3D0MYJ7      -KKQQ-----SILTGL---SVPE---GSAGS--DIQSQIAIMKGYYVREIVAKSI-----
A0A3D3LS70      -KPQG-----SLLTSN---MIPGFSDYASDR--SISNEIEILKSQTIRSLTATAL-----
A0A1G7ZF38      DSRGS-----DFHETA---LLEELGLPDATS--SVENEIEILKSRTLLSQIISDL-----
C6VS52          DSRGS-----DLHETA---LLEELGLPDAAG--SVENEIEILKSRTLLGQVVDDL-----
A0A1G1TM36      GNKQP-----GERSA-----LQELDFANGNN--VLESEMEILRSRRLMQQVVQTL-----
A0A1V3WH27      -KHDN-----NLLKG-----LSQLGTDVSPD--V-APEILLLKSRMILGETVDKL-----
A0A0D3L8Q3      DQQSGG----LTESAVFNDIPG----FKSHT--NIDNEIRLLKSQSLMHRVFNEL-----
A0A0K8QSK7      R--SGGSPFSQTESAISSQAFEGFGIMGQNN--NIYNQIEVLKSWPIIEEAVQEL-----
A0A1V6CN82      E---GSTTFWRQAGGFSGEALRGFG--TSYQ--GIQNQMIIMKSQPVVAKAIREL-----
A0A1M4XZ45      G--KASSPLSGAMGGAQQSIFQGLGGMNSMQ--NIYNQMVVLSSTPIISRTLNEL-----
A0A399D319      E--KAGSPLASGAGGSSEGIFQGLGMMNSMR--NIYNQMVILNSTPIVSRTLNEL-----
A0A0P7X1V8      A-----GNRYSMAGSDLSNLMVSNFGIGMGS--SIENEIHVLQSRTFTGELAQRI-----
A0A3B0C2S4      E-AKEMDIT-VDPMALLSGNPG--------I--NLDNEIQVLKSYRILGQVVEAL-----
A0A416GA42      K-ESGTRT--PSEAEIFKEV-G---FMNLSG--NVENEILIFKSLHLAEQVVRRL-----
A0A3N2M1H3      Q-EGGSGV--PDMAGVFSSF-G---LVSSNT--SVYNELISLKSPAVMYEVARRL-----
A0A1T3IYP5      P-SNTPTTA-RITRSSVANV----------V--SVKDEIIQLKSKELMRLVVDKV-----
A0A212K7W5      N-SAKGGML-SDNINTFSDM-G---LFKSNT--NINNEILTFKSPLLMQEVVQRM-----
F5IU11          N-SAKGGML-SDNINTFSDM-G---LFKSNT--NINNEILTFKSPLLMREVVQRM-----
A0A352Z1R7      E-RGQGVLV---------DM-----TFDQSN--SIDAELEIIKSRTNIEQVAKRL-----
A0A0A2F501      D-SKGKGLS-LNDQFSFGDM-G---LLQSNT--NVNNELISIQSPTLTLEVVRRL-----
R5B7P0          N-TKGASMP-GDI-GEFGNM-G---LFAVKS--NVNNELHAFESPDIMSEVVARL-----
R5B0L5          S-SQGASIS-----DTFAEM-G---LVQTNS--NVNDEISKLQSPDIMLEVAKRL-----
A0A374THP7      D-SKSQGIS-SDVSSMFADM-G---LGNAKS--NVNNELIAIQSPAVLLETGKRL-----
A0A3R5XWG1      E-SKGSSIN-NDVESMFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-----
A0A414YFM3      E-SKGSSIN-NDVESMFSDM-G---LGGTKS--NVNNELIAIKSPSVLLEVGKQL-----
A0A0A2EVS5      S-DKPGASL-AQDIGGFADM-G---LFSKST--NVHNELVSLRSPATLLEVIKRL-----
A0A1T4NAJ7      S-DKPGASL-AQDIGGFADM-G---LFSKST--NVHNELVSLRSPATLLEVIKRL-----
A0A2V1IJY1      E-AAGKSAG-A---EDFGDF-G---LFQNKT--NIQNEITTLKSADLMEEVVRRL-----
A0A3N2KCL3      E-AAGKSAG-A---EDFGDF-G---LFQNKT--NIQNEITTLKSADLMEEVVRRL-----
A0A255T941      D-AKGKSSN-LI--SDFADMGG---LFKSNT--NIKNELSTIKSPNLMTEVVKRL-----
A0A1Y4CHN5      E-GKGQSIS-SDVSSAFASM-G---LVQSNT--NVNNEVIALQSPAIMTDVVKRL-----
A0A1Y3V692      D-TKSGSST-TM--SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVRRL-----
A0A174TYU6      D-TKSGSST-TM--SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVRRL-----
A0A1M6I2S6      D-TKSGSST-TM--SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVRRL-----
F3PXM2          D-SKGGATS-GSM-GEFADF-G---LFKSNT--NINNELLTLASPTLMTEVVKRL-----
A0A3E4ZNL4      D-SKNGSST-SAM-NEFADM-G---LFKSNT--NINNELLTMKSPTLMTEVVRRL-----
A0A174AHH7      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A174JCE8      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A3E4JMC4      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A412SND6      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A414IEQ9      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A415UKN5      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A0M1W8D8      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A3R6GKX5      D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A7V4S1          D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
B0NU19          D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
D4V601          D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A397WLT5      D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A3R6GM96      D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A015XH67      D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A078RZN2      D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A6L0K5          D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A7ACT5          D-SKNNSPA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A6KY94          D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A173UQR8      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A3R6HK75      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A412B7D1      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A412VNY9      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A414LTU9      D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
I9Q4U4          D-SKNNSSA-SAM-NEFADM-G---IFKSNT--NINNELLTLKSPTLMTEVVKRL-----
A0A373ISF0      D-SNSGSSG-GAM-SEFSDM-G---IFRSNT--NINNELFTLKSPALMTEVVRRL-----
U6RF62          D-SKSGSSG-GAM-SEFSDM-G---IFRSNT--NINNELFTLKSPALMTEVVRRL-----
A0A073I794      D-SKGGTST-NAS-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A108TH71      N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
I8VXH0          N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A412S0N6      N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A412IIJ0      N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A0P0FM97      N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
R6KTP3          N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A139LU87      N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A1C6B3Y5      N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
E2NMQ4          N-SKSSSST-SAM-NDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A412YDB9      N-SKSSSST-SSM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-----
R7DY01          N-SKSSSST-SSM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-----
A0A414LGK8      N-SKSNSST-SSM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-----
A0A016E4F9      D-SKSGSST-NAM-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A413PP50      D-SKSGSST-GAM-NEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A3A5TI83      D-SKGGTST-NVV-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A415NEB6      D-SKGGTST-NAV-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A7AJ60          D-SKGGTST-NVV-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A015UXN7      D-SKGGTST-NVV-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A395YYT3      D-SKGGTST-NVV-SEFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVQRL-----
A0A415IPQ4      N-SKSSSST-SAM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A3E5BRW7      N-SKSSSST-SAM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
K9DXS6          N-SKSSSST-SAM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVNRL-----
A0A1M6KFV3      N-SKSNSST-NAM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-----
A0A1Q6G7L3      N-SKSNSST-NAM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-----
A0A413H235      N-SKSNSST-NAM-SDFSDL-G---IFKSNT--NINNELLTLKSPTLMTEVVSRL-----
A0A1M5B2J8      D-SKGKSAS-TDM-ESFADF-G---IFTTNT--NVNNEMGTLQSPDLMREVVTRL-----
A0A255RCT5      D-SKGKSAS-TDM-ESFVDF-G---IFTTNT--NVNNEMGTLQSPDLMREVVRRL-----
A0A1Y4GLF5      D-SKGNSIS-SGM-ETFSEF-G---LFQSST--NVNNELLAFQSPAVMTEVVKRL-----
A0A1H3XSC0      D-SKGKSVS-SDL-ESFSEF-G---LFQSST--NVNNELVALQSPAVMTEVVRRL-----
B3JI46          D-SKGKSVS-SDL-ESFSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A174UR09      D-SKGKSVS-SDL-ESFSEF-G---LFQSST--NVNNELIAFRSPALMTEMVKRL-----
A6LE40          D-SKGKSVS-SDL-ESFSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-----
R6NN15          E-SKGQSLS-GDVGASFSDL-G---LFQPNT--NVNNELVSLQSPAVMYDVVKRL-----
A0A358R8U0      N-TKGQSLA-SDV-ESFGDL-G---LFQTTT--NVNNELLVLQSPSIMLEVVKRL-----
R6WSB6          N-TKGQSLA-SDV-ESFGDL-G---LFQTTT--NVNNELLVLQSPSIMLEVVKRL-----
A0A401LPX7      D-SKGKSSS-ADM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A3A5Z900      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A3R6I893      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A3R6EGW5      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A285TGL6      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A3A5RFX4      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A1Q6IUW9      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A3R6NPG7      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A413XDP6      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
K6AP24          D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A076IQN8      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A078RYI7      D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
C7XEQ8          D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
D7INX6          D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
K5ZG55          D-SKGKSSS-TDM-ESFSDL-G---LFTTNT--NVYNEMGTLKSPDIMREVVSRL-----
A0A3N2N9B8      T-SKGKS---AGMEE-FSDF-G---LISTKT--DVENEIINLRSGELMEEVVSRL-----
A0A3N2NMI0      P-SKGKS---AGMEE-FADL-G---LISSST--SVANEITNLRSGDLMEEVVRRL-----
A0A359I8H7      Q-DGGGGVA--DISNAFSSL-G---LVSSNT--NVNNELISLSSPAVMYEVVKNL-----
A0A3N2KA63      Q-DGGGGVA--DISNAFSSL-G---LVSSNT--NVNNELISLSSPAVMYEVVKNL-----
A0A3B9FAU3      D-SPQRG---KDLNAMFANL-G---QNPDQS--NVNNEMAAIQAPSNVLETVKRL-----
A0A3C1E5L7      D-SPQRG---KDLNAMFANL-G---QNPDQS--NVNNEMAAIQAPSNVLETVKRL-----
A0A354SN68      D-NRRSASI-GNTSGIFNNL-G---IGKSYM--NTNDEVAIINSQTIALEVVQSL-----
A0A0A2DUD9      D-DKGKSLS-NDMSSAFSEL-G---LFQSNT--NVNNELLSMKSPMLMEEVVRRL-----
A0A3N2N595      N-AKSNTPSMSVGGDEFANM-G---LFQNKT--NIQNEMTTFMSSDLMTEVVKRL-----
R5FHS9          S-DDSRSVSIDDIFSSASSG-G---ISTNSN--YVNNELIALQSPSIMLEVVKRL-----
A0A3P1ZBJ5      N-TKGGGRS-VEQQ--LSQL-G---LFE-NT--SVSNEILSFQSPALMEDVVKRL-----
A0A413TW79      D-GKSQSIN-SDVASMFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-----
A0A3E5E9M7      D-GKSQSIN-SDVTSMFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-----
A0A3E4SK73      D-GKSQSIN-SDVASMFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-----
A0A415GGC6      D-GKSQSIN-SDVASMFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-----
A0A413DBH9      D-GKSQSIN-SDVTSMFSDM-G---LSGGKS--NVNNELIAIQSPAVLLEAGKQL-----
G9S1S8          D-SKGKSLS-ADAGS-FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-----
A0A354M4S6      D-SKGKSLS-ADAGS-FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-----
R7DH52          D-SKGKSLS-ADAGS-FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-----
A0A396N3D5      D-SNGKSFS-TDAGS-FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-----
A0A415ZDP9      D-SKGKSLS-ADAGS-FADL-G---LIQANT--NVNNEIISLQSPAIMTDVVKRL-----
A0A016CWA4      D-SKGKSVS-SDLES-FSEF-G---LFQSNT--NVNNELIAFQSPALMTEVVKRL-----
A0A1C6H117      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A415TAH7      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A0M1W0V2      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A139KA16      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A174VQ92      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A1Q6HCG0      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A1Y4JYM9      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A3A5QW67      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A3A5RQE6      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A3A6BP07      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A3E5E153      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A3Q9IP20      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A412WV15      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A413ICP6      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A414KYB9      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A416X133      D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
E5WX00          D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
K0X3P3          D-SKGKSVS-PDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRF-----
A0A3A5Z014      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A1M4YZ07      D-SKGKSVS-SDLKS-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A078S3Q8      D-SKGKSFS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A069SJV7      D-SKGKSFS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A3E5DXI5      D-SKGKSFS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A3E5EM98      D-SKGKSFS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A3E5F453      D-SKGKSFS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
I9T3G6          D-SKGKSFS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPSLMTEVVKRL-----
A0A0P0FQW1      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-----
C3RFN5          D-SKGKSVS-SDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-----
A0A3E4SYU0      D-SKGKSVS-SDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-----
A6LGY1          D-SKGKSVS-SDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-----
K5ZSH4          D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-----
A0A078T2W6      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-----
A0A3R6D1V4      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFQSPALMTEVVKRL-----
A0A3R6EAF7      D-SKGKSVS-SDLES-FSEF-G---LFQSST--NVNNELITFQSPALMTEVVKRL-----
A0A412MJT7      D-SKDKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3E4WKT5      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3A5YY33      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A078TAH2      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A1E9CFZ7      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A373FYU5      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3A5TZ72      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3A5XBP2      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3A6MEG9      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3E4JP35      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3E4KP40      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3E4NX82      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A3E4XFU8      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A412RG70      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A412TD37      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A413GAA4      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A414M7I4      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
E5UZA2          D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A069SMG6      D-SKGKSVS-SDLES-FSEF-G---LFQSGT--NVNNELITFRSPSLMTEVVKRL-----
A0A1Y4PQK7      E-YRGRSIA-SDIEG-FDNF-G---LFRSAT--NVNNELIALQSPSVMTEVVKRL-----
A0A1Y3ZDB3      E-YRGRSIS-SDIEG-FDNF-G---LFRSAT--NVNNELVALQSPSVMTEVVKRL-----
A0A3A6AAP4      E-YRGRSIS-SDIEG-FDNF-G---LFRSAT--NVNNELVALQSPSVMTEVVKRL-----
A0A1Y4IH41      E-YRGRSIS-SDIEG-FDNF-G---LFRSAT--NVNNELVALQSPAVMTEVVKRL-----
A0A1Y4DYA7      D-NKSNSPS-GN-AGVLYDL-D---LFQTGT--NVNNEIQSLQSPAVMYDVVKRL-----
A0A1Y3X4I9      D-SKGNSLS-NS-AGVLGDL-D---LFQTNT--NVNNEMQSLQSPAVMYDVVKRL-----
A0A1Y4FNK8      D-SKGNSMS-DA-AGVLGDM-N---LFQTST--NVNNEIQSLQSPSVMLDVVKRL-----
A0A355FD59      D-SKGKSMA-GDVSSLFSDL-G---LSQANV--NVNNELIAIQSPAVILETIKRL-----
A0A359CEZ9      D-SKGKSMA-GDVSSLFSDL-G---LSQANV--NVNNELIAIQSPAVILETIKRL-----
A0A353Q7B4      D-SKGKSMA-GDVSSLFSDL-G---LSQANV--NVNNELIAIQSPAVILETIKRL-----
A0A1M3KVR9      D-SKSQSIS-SDVASMFADF-G---LSQPNT--NVNNELIAIQSPSIILETVKRL-----
F8X3A5          D-SKSQSIS-SDVASMFADF-G---LSQPNT--NVNNELIAIQSPAIILETVKRL-----
A0A3C1ITV0      D-NKG-QAQ-ISELAAFADL-G---IGSTGI--DVYNELQAFQSPLLMQDVVNQL-----
R7HN19          D-NKG-QAQ-ISELAAFADL-G---IGSTGI--DVYNELQAFQSPLLMQDVVNQL-----
A0A415EEZ4      K-EKT-------DAAFLEKQ-----LFQANS--NLANEQIMLKSRFLMSKVINRL-----
A0A060RD97      KSGSG-----QGEAAIFADLGL---LSSTSS--LVDNEIFILRSASLMRTVVQKL-----
A0A350IHV0      S-NEN-SA--MKELASFTNAMS--LRRNSGA--NVYNEMESFTSPDIMSVVVDRL-----
A0A077ENE7      PSNTPTTAR-ITRSFGANTI-------------SVKDEILQLKSKELMRLVVDKV-----
T0NN57          ASNTPTTAR-ITRSSVASSV-------------SVKDEILQLKSKELLRQAIDRT-----
X5K347          ASNTPTTAR-ITRSSVASSV-------------SVKDEILQLKSKELLRQAIDRT-----
A0A1T5K9D4      P-SNT-RA--TTKLDNYSNLIN-------SV--SMSNEMLQLKSKTLMAEVVKDL-----
R5RVP0          T-NEN-SA--LRDLASFTG--GVRYRSMNGS--NVYNEIEAISSPDIMQTVVKRL-----
A0A285T4L1      P-----SN--KTSTAGLDRYDN----YINKV--NVANEILQFRSKRLMREVVQRL-----
A0A3E5BU42      P-----SN--KTSTAGLDRYDN----YINKV--NVANEILQFRSKRLMREVVQRL-----
A0A414ZBF2      E-QGG-GN--MGESAAFRDV-----FSLGNS--KVDNEMGFFKSKRLMMEVTRQL-----
R5KD55          RNDKP-TVL-NQLLNDYVDF-G---FFADNT--NVNNVIAAIKSPDVMSEVVDRL-----
A0A174QNT3      DNQNS-----QNDLSAMLELSG----IPGGS--SVENEVYILRSYQLLNDVVQRL-----
R9I0H0          DSQNS-----QNDISAMWEVSG----GLGGS--GVENEVYILRSYQILNDVVQRL-----
K5BUT9          KEKSA------SDMSAMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-----
A0A174FPA3      KEKSA------SDMSAMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-----
R6S9Y6          KEKSA------SDMSAMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-----
C9KX15          KEKSA------SDMSAMLEVSG----GITGT--SVDNEIYILRSHQLLREVVNRL-----
A0A3L8AAP1      GGKTA-----NSDISAMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-----
R6DAG6          GGKNA-----NSDISAMLELQG----GITGS--GVENEMFILRSHQLVREVVNRL-----
A0A1G8BVM8      D-KKG-GGG-ISEAAAFQDM-----FSMGSN--SVYNEMGILKSRQLMLQVVEQL-----
A0A416GGJ1      P-----SN--KTTTAGFDRYDN----YINKV--NVANEILQFRSKRLMREVVQRM-----
A0A3D1NQW3      S-RKG-GD---TDLATLSDLAG----LSQRR--NVDNEIYILQSRRLMTEVVKQL-----
B0MT10          S-RKG-GD---TDLATLSDLAG----LSQRR--NVDNEIYILQSRRLMTEVVKQL-----
R7JGW9          S-RKG-GD---TDLATLSDLAG----LSQRR--NVDNEIYILQSRRLMTEVVKQL-----
A0A0E2M2Y7      A-EKS-GA--PRSMKQFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-----
A0A0K2J6Z0      A-EKS-GA--PRSMKQFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-----
B2RKZ8          A-EKS-GA--PRSMKQFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-----
A0A212GC82      A-EKS-GA--PRSMKQFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-----
A0A254MU12      A-EKS-GA--PRSMKQFEEI-G---LFMDNS--EVENEILVLKSKRLTAIVVDKL-----
R6CQ93          Q-----SN--KTSTAGLDRYDN----YINKV--NVANEILQFRSKRLMREVVQRL-----
A0A3D2BF46      G-KKG-SE---TDIAAFGDLLG----ATARR--NVDNEIIVLKSRNLMTEVVRRL-----
A0A358R538      S-RKG-GD---TDLAAFSDLAG----FQNRR--SVDNEVFILQSRRLMAEVVRRL-----
A0A1Y4AAB8      D-RKG-AN---MDISAFSDISG----FQSRN--SVDNEIYILQSRRLMQEVVRTL-----
A0A1Y3WWY9      S-RKG-GA---PELSAFSDLAS----FQTQR--SVDNEIYILQSRRLMSEVVRRL-----
A0A1Y4U5L4      S-RKG-GA---PELSAFSDLAS----FQTQR--SVDNEIYILQSRRLMSEVVRRL-----
A0A1Y3VCJ1      S-RKG-GD---VELSAFSDLSG----YQSRK--SIDNELFILQSRKLMTEVVRRL-----
A0A1Y3QTW7      S-RKG-GD---MELGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
R6XWY7          S-RKG-GD---MELGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
A0A174AVF1      S-RKG-GD---MELGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
A0A373HTL7      S-RKG-GD---MELGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
A0A1Q6EIY0      S-RKG-GD---TDLGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
E4M8L3          S-RKG-GD---TDLGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
I3YQ50          S-RKG-GD---TDLGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
R5UEY8          S-RKG-GD---TDLGAFSDLVG----FQNRR--NVDNEVYILQSHRLMSEVVKRL-----
A0A1H4D866      S-RKG-GD---LELTAFSDLAG----FQNRR--SVDNEVFILQSRRLMTEVVKRL-----
A0A374A9J5      S-RKG-GD---VDLTAFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-----
A0A1Q6E9S3      S-RKG-GD---VDLTAFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-----
D4IJ36          S-RKG-GD---VDLTAFSDLAG----FQNRR--NVDNEVFILQSRRLMTNVVKQL-----
A0A414Q925      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A415PUS9      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
A0A108TCU0      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A413BA42      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
S3Y344          E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
A0A413MY74      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
A0A412TGL3      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A413VJ33      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
A0A414L0W6      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A412DP39      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A413ZSE8      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
B0NP84          E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
R6AK43          E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVEIL-----
A0A412N2D9      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
R6LHA4          E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A1Q6FL18      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A1Y4JYS9      E-QKG-GG--VNGAAAFQDL-----FSLGGS--TVDNEVGIFKSKRLMRTVVETL-----
A0A3E5HPT8      P-----AN--SRSAMQLNNA-----DFIGQV--NVASEILQFKSKELMRKVIDRL-----
C6IJ48          P-----AN--SRSAMQLNNA-----DFIGQV--NVASEILQFKSKELMRKVIDRL-----
Q8A3U2          P-----AN--SRSAMQLNNA-----DFIGQV--NVASEILQFKSKELMRKVIDRL-----
A0A3R6S1H6      D-SKG-TSL-ASEAAAFEDL-N---VLNTKS--SVDNEVLVFQSRNLMIEVVRRL-----
A0A3R6SD81      D-SKG-TSL-ASEAAAFEDL-N---VLNTKS--SVDNEVLVFQSRNLMIEVVRRL-----
A0A413VXJ7      D-SKG-GG--ISESSAFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-----
I9RSN9          D-SKG-GG--ISESSAFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-----
U6RJK5          D-SKG-GG--ISESSAFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-----
A0A1Q6GA32      D-SKG-GG--ISESSAFADL-G---LFGGKR--NVDNEVLIFQSRHLMEEVARRL-----
I9RPU6          D-SKG-GG--MSESAAFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-----
I8Y597          D-SKG-GS--ISESTAFADI-S---FLGGKR--NVDNEVLVFQSRHLMEKVARRL-----
I8YFS5          D-SKG-GS--ISESTAFADI-S---FLGGKR--NVDNEVLVFQSRHLMEKVARRL-----
A0A1Q6GBF5      D-SKG-GA--VSESSAFADL-S---LFGGKR--NVDNEVLVFQSRHLIEEVARRL-----
I8YFZ3          D-SKG-GG--MSESAAFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVAHRL-----
A0A1Q6GDH2      D-SKG-GG--MSESAAFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-----
U6RSB0          D-SKG-GG--MSESAAFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-----
I9SIK1          D-SKG-GG--MSESAAFSDL-S---LLGGKR--NVDNEVLVFQSRHLMEEVARRL-----
I9GXM2          D-SKG-GG--MSESAAFSDL-S---LFGGKR--NVDNEVLVFQSRHLMEEVARRL-----
I9TP59          D-SKG-GG--MSESAAFSDL-S---LLGGKR--NVDNEVLVFQSRHLMEEVARRL-----
A0A0J6CIR2      N-SKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-----
A0A3D8HG59      D-TKGSGA--MSEASAFSDL-G---MFSMKS--SVDNEVLVFQSRQLMQNVVKRL-----
A0A3R6S408      D-TKGSGA--MSEASAFSDL-G---MFSMKS--SVDNEVLVFQSRQLMQNVVKRL-----
A0A354WXN6      D-KKG-GG--FSEANAFGDL-G---ITMGSR--NVDNEVLVFKANRLMEMVVKRL-----
R5IP14          N-KSG-G---FSESAMFKDL-GSMDMINVRS--SAETEMLIFQSYRLMQDVVSQL-----
A0A316SZX7      D-RRG-GA--ITESAAFQEL-G---AFNIKS--NVDNEILLFESKRLMEEVVRLL-----
A0A1Y4AIY1      D-RRS-SR--SMSAYGFSDLNN---MLGIQR--NVDNEVIVFKTYRLMEKVARRL-----
F3ZRU7          DKASG-GAN-MQGVAALTDL-A---DFGLKS--SVDNEILIFQSNSLLREVSTRL-----
A0A1C5Q1F3      E-TRG-AQL-PNAASAFSEM-D---LLNIQS--TVDNEVLIFKSKRLMIEVARKL-----
R7A239          E-TRG-AQL-PNAASAFSEM-D---LLNIQS--TVDNEVLIFKSKRLMIEVARKL-----
A0A1M6K7I9      D-KKG-GG--MGESALFADL-N---LFGGAR--SVDNELLVFQSRSIMENVVRRL-----
A0A3R6HIK7      E-QRK-SR--AATTYGFTDL-D---MFGLQR--NVDNEVIVFKAYRLMEMVARRL-----
K5ZVW7          E-QRK-SR--AATTYGFTDL-D---MFGLQR--NVDNEVIVFKAYRLMEMVARRL-----
A0A1Y4D5Z0      E-NRW-GR--SRSLYGFSDL-D---MLSLQR--NVDNEVIVFKTYRLMETVARRL-----
R5S343          S-NKG-GA--AGEGRVFEEL-N---LFNVKS--NVDNEVQVFKSTRLMSSVVRKL-----
A0A3R5ZMK1      D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A3E4ZTK7      D-AKG-GA--LSESAAFEDL-G---IFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A1Y3ZIA4      D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
K5Y1A4          D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A3R6K8X4      D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A1Q6I3T6      D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A414XX40      D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A412DM15      D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A7AEU7          D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A415BDM7      D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A3R5ZYK4      D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A414GI87      D-AKG-GA--MSESAAFEDL-G---LFGSKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A3R6BKI7      D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A414LPI6      D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
A0A412M2W1      D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
K5ZX55          D-AKG-GA--MSESAAFEDL-G---LFGTKR--NVDNEVLVFKSRRLMTEVARNL-----
K5ZBN2          D-TKG-GGA-ASEAAVFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-----
A0A0J6CKW3      D-TKG-GGA-ASEAAVFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-----
A0A0F5IQM7      D-TKG-GGA-ASEAAVFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-----
S0GLB0          D-TKG-GGA-ASEAAVFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-----
A0A3R6NLC1      D-TKG-GGA-ASEAAVFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-----
A0A416WYC9      D-TKG-GGA-ASEAAVFEDL-N---MFNMKR--SVDNELLVFKSKQLMKSVVKRL-----
A0A0F5IT40      N-SKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-----
S0GSI7          N-SKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-----
K5YB65          N-SKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSVVAERL-----
A0A0F5IWP9      N-TKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSIVAERL-----
A0A0F5IZT8      N-TKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMSIVAERL-----
A0A417LKQ2      N-AKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMNIVAERL-----
A0A416TME1      N-TKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMNIVSERL-----
A0A416XPE8      N-TKG-GG--LSESAAFEEL-N---MFNVKS--NVDNEVLVFKSKRLMNIVSERL-----
L8JI02          ERKNDL---------GGKEFLRGMGLFTSDT--ELEDEIGILKSYGMVSNAIRS------
A6EBM4          QK-------------TALSDIADALNTNTAT--NMQSESFAIESRHLLLNAIKR------
A0A2N3U785      NNKGASV--------YENSFFSELGIFQTNQ--SINDEIELLKSISLMQRVVKDL-----
A0A0E3ZG78      DKSDSHL--------SNESAFSDLEIFQATK--NINNEIEVLQSESLMKRVASEL-----
A0A1I6BRK6      DKSGQSL--------SNADALSDLNTFKATR--NVDNEIEVLKSKGLMERVIREL-----
A0A243WAB1      DKSGQSV--------SNAEALSDLTMLKSAR--NIDNEIEVLRSESLMEKVVSEL-----
A0A399SH26      EKKGV----------DDARMTESINAFASKK--IVENEIEVIQSRALMKKVALG------
A0A0E3ZGV6      EEKGV----------NASKITESIDAFSSNK--IVENELNVLRSNALMNQVVNE------
A0A1I2N4S1      EEKGV----------NASKIMESIDAFSTNK--TVENELNVLRSSALMSQVVHK------
A0A2T5YE44      EEKGM----------NASKIMESIDAFNTNK--TVENELNVLRSSALMSQVVHK------
A0A1M4YED3      EKRGV----------NESKMEESLDFYQSNK--VVENEIVVLSSKGLMEKVISN------
A0A3P1Z8V4      SSDSSHGGMRSRSK-NSLNTLMQLNGINVGD--NLENELFILSSLRLMKQVVATL-----
A0A2L2WX98      TDGRSAMGRKAS---SSMNTLLELNGISVGD--NLKNEVFILSSQRIMERVVDSL-----
G5GD56          NESGSGGGMSRSARNNGLNTLMQLNGISVGD--NLKNEMFILTSERLMTRVVDSL-----
R6A0L2          SNGSSTGGLRRTSKNSGMNTLLELNGVSVGD--NLKNEIFIISSKRLMSRVVDKL-----
R7LG80          ADSDPRSRMVK----GNMSGLLELNGISVGD--NLKNEIFILSSKRLMTRVVDKL-----
A0A1M6XHU0      RGSGNAPVSVA----AFTPI--------ERR--ALSNELGILKNSAELATRVAK------
D0MHQ9          RGGGNAPVSVA----AFTPI--------ERR--ALSNELGILRNSAELATRVAE------
G2SF81          RGSGNAPVSVA----AFTPI--------ERR--ALSNELGILRNSAELATRVAE------
A0A2H3NSN0      PNQAQ--TVRF----D------------IQP--ELSSEIGILTNSGSLAMRVIT------
A0A2P6C324      EAAPARMMVGL----N------------EQR--DLSSEIGLLKNSGELARRVVS------
A0A126PFG0      EKKTPAEKSAL----QE------LDLVTTPK--VVESEMEILKSRKLMLSVVRDLQLSTL
A0A3M1N7Z3      AQAVGGFQTQN----TA------GSFFPPEV--LTEAYLELWSRYDLIAQVVQQLRLNYE
R7PCR1          NNDSGSMGRAG----RGANMLLELNGVSVGN--SLQDETFILQSYRLMERVVSRLGLDVS
A0A2A8CVM9      GAQS-----------GPGGM----GAFGQQR--DLASEVGVLQYSAELASRVVA------
A0A3C0ZQC7      KGQQ-SQMPLF----DVTGI-------GAVK--NIKNELEILK-SRSLAEAVAV------
A0A2E3R1D0      TDTDLADVLPE----AMP-----SGFWRQER--NLSNELLVLDQSMPLAEAVAA------
A0A2T2USC0      QQRQVSSILGE----QGSSF---SPFGSQ-N--NLANEVLVANQSEAITRNVAT------
A0A2T2V0F3      QGEGVSSILSE----SG-SM---NPFGSR-R--NLANEVLVANQSEAITRNVAV------
A0A2T2S682      GQSR-SAVPSL----TGGRSSGASALGGQRR--SLSNQILVINQSEALAQEVAV------
D5H561          GQQS-GTESAI----GAQAQAQGSGLLPSSS--SLRNELMFLRNSQALRERVAE------
A0A2H3NWA9      DSPS-TLVS------TRGRM---VPGLAGNR--SLSNQLFVLRQSRELAQRVAD------
A0A2A8CVB6      QSQSGGVVAQL----SSRGL---SPYSAESR--TLQNELFVLQQSMTIPNRVAD------
A0A2P6C1S6      NQQS-SVLSGL----GRGRT---SPFLQQDQ--TLQNELLILRQSRTIANRVAR------
A0A2T2UTM4      EGQT-SVLSGL----GRGRR---SPFGQRDQ--TLQNELLILRQSRTIARRVAK------
A0A1T5MMH4      DVKDEASELGISI--------LAGKDQQNTD--LISGEIEMIRSRLFLDQVLDSL-----
A0A2W4R1L8      DIRNEATELGINR--------LV--EDQNLN--IMSGEIEIIQSKLFLARVLDSL-----
A0A2E5CV79      KEKPGT-SMIMQY--------GSRDRSD------MSNEIEVLRSRRLAKDVVKLF-----
A0A2A4G4B1      KSVTNSIPDELSVFDDLGMVSGSAST--------LEDEIQLFRSRPLIKQMVEKH-----
A0A2D4ZVH1      ESKNRYSYAGAGIENLLTSTYGIGVGST------IANELQIMKSRKLSYDLAERI-----
A0A0E3V905      QDQQKGSEQSSSL--------KELGVFAHKQ--VVENEIEILRSFTLMNRVADKL-----
A0A1M6GR99      KDNSGSSSSSGESRYINSELLSRSQN--------IQNELEIIKSFPNISQTVRNL-----
A0A1M5BA90      KDEKKGADESKIL-----EALNITSNKT------VDNEVEVIQSGELLNEVIDSL-----
A0A1V9F098      KDEKKGVDESGVL--------EALQIYPTKN--IVENEMEVIHSRKLMEKVVEQL-----
A0A1V9FHD0      KDEKKGVDESGMG--------EALQIFPTKN--IVENEMEVIHSRKLITDVINQL-----
A0A1T5CS78      KDEEKGVDNSRIM--------ESINPFDSKK--IVENEIEVLKSRDLMKSVVRDL-----
A0A0Q9Z8F1      KDEEKGVDDSKIM--------ESINPFDSKK--IVENEIEVLKSRDLMKAVVRDL-----
A0A2N0U0M7      KDEEKGVDDSKIM--------ESINPFDSKK--IVENEIEVLKSRDLMKSVVRDL-----
A0A1M6TTV4      DIKSEAGILGIQN-----------PMDQDIK--GLSGEIEILKSRLFASQVVNAV-----
A0A1Q6IT42      EDEKKGGGGLSSLMGGISGGGFSLDGMIGGG--SVNDEILVISSHSLIREMVQRL-----
K0X1U5          EDEKKGGGGLSSLMGGISGGGFSLDGMIGGG--SVNDEILVISSHSLIREMVQRL-----
A0A416XAH0      EDEKKGGGGLSSLMGDIAGGGFSLDGMIGGG--SVNDEILVISSHSLIREMVQRL-----
R5EXK3          EDEKKGGGGLSSLMGDIAGGGFSLDGMIGGG--SVNDEILVISSHSLIREMVQRL-----
A0A401UAP7      EVNNEANEFGITK----------IMEDQNLN--LISGEIELIQSNLFLSRVIDSL-----
A0A1W2GF52      DIKNDANLLGLQN-----------PLEQDIK--GIAGEIEILRSRLFFSKVVDAI-----
A0A2G5L7B8      DIKSDAGILGIQN-----------PMEQDIK--GLSGEIEILKSRLFASQVVDAV-----
A0A0D3LFR6      TENKPAASFGFVD--------SD---KATME--GMSSEIELIKSKLFLNKVLSAL-----
M7N6D4          GVNKQADFLGYRS--------LDSDPNQNMN--GMSEEIELIKSKLFLTRVLKAV-----
A0A364XUP5      DIKNEATELGIAT--------ITSDEPQNAD--LISGEIEIIRSKLFLNIVLDSI-----
A0A1M5RLA9      DIKNEATEFGIKP--------TVED--PNFN--LLSGEIELIESRLFLGRVLDSS-----
A0A385SFR9      DIKKEATEFGIKP--------TVED--PNLN--LLSGEIELIESRLFLGRVLDSS-----
L8JW09          DVKSDASELGLLG----------LSENKNLN--IISGEIELIKSKLFFSKVIETV-----
A0A1Q3ZMZ7      QDNDQG-KEVLEL-------ENINSKKS------LSSNIELLKSPVLFENAIKKL-----
A0A2D8JJW3      VKDDNSGIAKMPG------FEAFSDDKK------LEDKIRNIGLRPIAQATIDKLSE---
A0A2W2AFF7      NDDQKAGN--MDGKQLLEDLGFLSGKGN------VDNEVEIFKSRSLMESVVRDM-----
A0A2N5YXE2      KNENKT-NQILGI-----------NAGVMET--DLAPVIELVRSNEFLKTVVASL-----
A0A2I0QZ80      NSENQG-ADLLDL-------SDVRTEGS------IAKEIELLRSQLLFKKAIKQL-----
A0A2U2XBJ3      NSENQG-ADVLDF-------KDIRKEGT------IAKEIELLRSQLLFEKAVADL-----
A0A3E1F1A3      NSENQG-ADVLGF-------AEARSDGS------IAKEIELLRSQMLFEKAVQNL-----
A0A1V9F383      KDEKKGVDESGSM--------EALQIYPTKN--IAENEIEVIHSRKLMEQVIVQL-----
G8TRZ6          KDNKKGVDESGAM--------EALQVYPMQN--IAENEIEVLQSKTLMTDVVNQL-----
A0A2W1NDY9      SLKDEG-QRILEF-------KDFNTENN------LSADVELLRSPFLMEKVLMNL-----
A0A1G0CI31      GEKDQG-KEIVEI-------ENINTKDN------IASEIELLRSELLFGMAVERL-----
F2IKD6          VEKDQG-KQLLEI-------DNINKRID------ISTEIELLRSQLLFDMTIARM-----
A0A1I7BM74      DNEDQG-ANVLDL-------KNVNNDGN------ISKEIELLRSQFLFEEALKRL-----
A0A2G2FJ17      SNEDQG-ADVLDF-------KNIKEDAS------ISREIELLRSEYLFEKALDRL-----
A0A416X8R7      KSENKSGNDMSAV--------LELNGGISGS--GVENEIYILQSHQLMREVVGRL-----
K0XJ09          KSENKSGNDMSAV--------LELNGGISGS--GVENEIYILQSHQLMREVVGRL-----
R5EUZ0          KSENKSGNDMSAV--------LELNGGISGS--GVENEIYILQSHQLMREVVGRL-----
W0EQS0          KSENKSSNDMSAI--------LEMNGGVSVG--SVDNEIYILQSHQLMREVVERL-----
A0A1Y3WE15      KAENKSNNDMSAI--------MELNGGISGS--GVDNEIYILQSRQLMREVVERL-----
A0A1Y4GUK3      KAENKSNNDMSAL--------LELNGGISGS--GVENEIYILQSRQLMREVVERL-----
A0A2U1FKU2      AEKNGVSGGLSQF----QDLGLLMGNSE------VENELLVFKAKRLTAIVVDKL-----
A0A0A2F954      AEKSGATSGLQQF----QELGLMTGNSE------VENEILLLKSKRLTAVVVDKL-----
A0A0A2FW91      AEKSGATSGLQQF----QELGLMTGNSE------VENEILLLKSKRLTAVVVDKL-----
A0A2D2N2N1      AEKSGATSGLQQF----QELGLMIGNSE------VENEILMLKSKRLTAIVVDKL-----
Q7MWZ2          AEKSGATSGLQQF----QELGLMIGNSE------VENEILMLKSKRLTAIVVDKL-----
T2NDT6          AEKSGATSGLQQF----QELGLMIGNSE------VENEILMLKSKRLTAIVVDKL-----
W1R7P9          AEKSGATSGLQQF----QELGLMIGNSE------VENEILMLKSKRLTAIVVDKL-----
A0A1R4AFZ0      AEKSGATSGLQQF----QELGLMIGNSE------VENEILMLKSKRLTAIVVDKL-----
A0A1R4DVZ7      AEKSGATSGLQQF----QELGLMIGNSE------VENEILMLKSKRLTAIVVDKL-----
A0A1G9E2A9      EVKRNANVL------FGRNSDLGSQVEN------ITGEIEFIKSRLVYNRVIDSM-----
A0A2T2YJE8      DEQSEAGRLGLGG-----TIENQQTLSN------LSGEIEIIKSNFTFERLQQKL-----
A0A3M9N829      DEQSEAGVLGLES----NGLPIEAGAGK------LQGEVDLIKSDIVYERLKKTM-----
A0A0P0CSF9      DEQSQAGVLGLQN----SGLKVESGIGQ------LQGEVDLIKSNIVFERLKKTM-----
A0A3M9MNC3      DEQSEAGVLGLEN----NGLKVESGIGK------LQGEVDLIKSNIVYERLKKTM-----
A0A2M6GH67      DERSQAGALGLGG--PLGNAAAEQNMVS------LSGEVELINSDIIYRDLKENL-----
A0A127B287      EEQTEAKVLELPG------AGMESDLGK------LQGEVDLIKSDLVYDRLKKSM-----
A0A369QP10      DEQSEAGRLGLDG-----TIENQQNLSN------LSGEIEIIKSNLTYERLQQKL-----
A0A418R9X5      DEKSEAGVL-LGG--IGQAAEQKQTLNK------LSGEVELIKSDIIYRRLKDSL-----
A0A428JSJ3      DEKSEAGLL-LGD--VGQAAEQKQNLNK------LSGEVELIKSDIIYRRLKDSL-----
A0A428KI59      DEKSEAGVL-LGD--IGQAAEQKQTLNK------LSGEIELIKSDIIYRRLKDSL-----
W8F1I6          DEKSEAGVL-LGD--IGQAAEQKQTLNK------LSGEIELIKSDIIYRRLKDSL-----
A0A246FQC0      DEKSEAGVLGLGA--LGGAIDQKKNLNS------LSGEIEVIKSDIIYQRLKDSL-----
A0A372E5P8      DEKTEAGVLGLGG--LGGAVEQKQSLTK------LSGEVELIKSDIIYSRLNDSL-----
A0A1H3EMW1      DEKTEAGVLGLGG--LGAAVEQKQSLNK------LSGEIELIKSDIIYRRLNDSL-----
A0A1H9ZSN3      DEKTEAGVLGLGS--LGGAVEQKQSLTK------LSGEIELIKSDIIYSRLNDSL-----
A0A0M3RW20      DEKQEAGTLGLGGG-LAGPE-GPLSMNN------LSGEVELIKSNLIYRQLRDSL-----
A0A1S9B3W0      DEKTEAGQLGLLP---PGAADPRQSMSQ------LAGEVELIKSDLIYTRLRDSL-----
A0A1W1VRL3      DEKTEAGLLGLGA---GGSVEKRRPGAN------LEGEVELIKSNLIYRRLKDSL-----
A0A1M6R305      DEKTEAGALGLGGA-LGEGVAGRQSISK------LSGEVELIKSNIIYRRLKDSL-----
A0A2M9B9H9      DEKTEAGILGLDGP-VGQAV-GSSNVNK------LSGEVELIKSNIIYQRLKDSL-----
A0A126PDF2      DQRSEAGVVGLGGQ---LAAADPRASSK------LAGEVQLIKSEIIYKELRDSL-----
A0A2Z3GKA1      DQRSEAGVVGLGGQ---LAAADPRASSK------LAGEVQLIKSEIIYKELRDSL-----
A0A328BL48      DEKQQAGDLGLLAA---GAQAGQQGMSK------LSGEVELIQSDLIYTRLRDSL-----
A0A3S0QKV1      DEKRQDAELNLPGL---VANP-QQNVNK------LAGEVELIKSDLIYSRLRDSL-----
A0A3R9P8H7      DEKTEAGVLGLGG--LGGAVEQKQNLNK------LSGEIELIKSDIIYRRLKDSL-----
A0A212UCJ7      DEKTEAGVLGLEG--LGKMVEQKQTMTQ------LSGEIELIKSDLIYRRLRDSL-----
A0A238WIA7      DEKTEAGVLGLEG--LGKMVEQKQTVTQ------LSGEMELINSDLIYRRLRDSL-----
A0A0W8EDI5      DQKTQSAVLGLGG--VGGSAEAQQNAKN------LAGEVELIKSNLIYRKLQDSL-----
A0A3B7RBP8      DQKTQTAVLGLGA--VGGAAEAQQNSKN------LAGEVELIKSNIIYRKLQDSL-----
A0A1I5WSL8      DERNEGSALGLAGQ-MAPAAADKGRGGK------LAGEVEVIKSNIIYRRLKDSL-----
A0A0U3JVM7      DERNEGSALGLAGQAAAPAVMDKGR-TK------LAGEVELIKSNIIYRRLKDSL-----
A0A1G1SSV2      DERNEGSALGLGGQ-GAPAVVPNGR-TK------LAGEVELIKSNIIYQRLKDSL-----
A0A1G1SXV7      DERNEGSALGLGGQ-GASAALPNGR-AK------LAGEVELIKSNIIYQRLKDSL-----
A0A243WHR7      DEKTEAGALGLGGA-LTGDI--RQSGNK------LSGEIELIKSNIIYEHLKDSL-----
A0A076HRT9      DEKTEAGTLGLGGA-M-KEAEGRQSLNK------LSGEVELIKSNIIYRRLRDSL-----
A0A1M6DHW8      DEKTEAGALGLSGT-MGKGIEERQSINK------LSGEVELIKSNIIYRRLKDSL-----
A0A3D1KEX9      NDNNGKYANNSAL-----NALKQLNGVQVTD--NLKNEIFILQSRRLMEMVVERM-----
A0A358Y7S2      VEENKT-RDILGK-----DALNVEKALN------LNQEVELLRSELLINKVIEKL-----
A0A1X7J248      NKRSEA--SVFGF-------NPLSEESSNLN--TLSGEVELIRSKLFLKQVINKL-----
E4TQD2          NKRSEA--SVFGF-------NPLKEENSNLN--TLSGEVELIRSKLFLKQVIDKL-----
A0A2J6HHN3      NSDDKG-QMLFETKNLYDED--------------IYRKIEVMRSPVFIRRVVSRL-----
A0A1Y3WMT8      DDKQGGGGALSSLVGDVTGGGFSLDGMIGGG--SVNDEILVISSHTIIREMVQRL-----
A0A1Y4GQU1      DEKKGSSGSLSSLMSGVSGGGFSLDGMIGGG--SVNDEILVISSHTIIREMVQRL-----
A0A1V5W8T5      NEEQN--EDLLKI-------DNIYGQTS------ITNLIELIRSREFLKRTLHKL-----
A0A2T8HKA9      PQNTNVTARFTRS--------SMMNTVS------VASEILQLKSKELMRHTIATI-----
A0A3B8INU3      NFKSEA--TLFGF--------SNFNENPNLN--YLSGEIELLKSRLFFSQVISAL-----
A0A098LL25      DLKSEA--GVLGLNKFNDENMPGNKLST------ISGEIEFLKSRYLYEKIVDRM-----
A0A1Q3Q573      EKS----TQILGI-----DNLVFEKDPTE-----INREMQVLKSTMLLGKIADKL-----
A0A357YNR3      NDDQKGGASEVTT---FREMGIVSRRNN------ADNEVEILKKTMIVEKVVRDL-----
F4KK08          KSETSINSAIERLAQFTGDKHSYSDD--------VSNQIIILGTERVVSETVRRL-----
A0A3N2N6F7      QDDEAG-SSSQSITSALSDMGLFTTSTN------VANELLAFQSPALIGDVIERL-----
A0A419VXB7      KDKESSGVDLQNI--------FSSSPLKSDV--KLSNHIEILKSFSLNYEVLENL-----
A0A2V1ILM4      NEDTESGSQGVAS--ALSDIGLFQSSAN------VNNEMLAFQSPAIIADVIQRL-----
A0A3N2L0E8      NEDTESGSQGVAS--ALSDIGLFQSSAN------VNNEMLAFQSPAIIADVIQRL-----
A0A3N2LFC5      NEDTESGSQGVAS--ALSDIGLFQSSAN------VNNEMLAFQSPAIIADVIQRL-----
C3J7R8          KDKMDASNVLSEL-----FESSALTSLGGRS--AVENELFILKTDFLIDQVIERL-----
A0A0B0BTJ4      DEQYNR-SSNSDLTGFMPGRMMYRTNSG------VEDELLIMGSRSIMERVVAEL-----
A0A3B9CNN6      DEQYNR-SSNSDLTGFMPGRMMYRTNSG------VEDELLIMGSRSIMERVVAEL-----
R5X290          DEQYNR-SSNSDLTGFMPGRMMYRTNSG------VEDELLIMGSRSIMERVVAEL-----
A0A1Q6E6I7      DEQYNR-SSNSDLTGFMPGRMMYRTNSG------VEDELLIMGSRSIMERVVAEL-----
A0A2G2F510      SEKDTA-KEVLDF-----QN-LGSRDNQ------LSGVVELLRSELLFKRAVKSL-----
A0A316JZ08      SNQDKA-ADVIDF-----EN-INTLDDD------ISAVVELLRSELLFERAVDKL-----
A0A1I1FXP9      DIKQQASGLLSRVYSATGEE---MQSSN------LSGEIELITSFMLYNKVIDKMGE---
A0A3B9FXJ0      KEFDP--SSSLDF--------ADILRPGNVD--RLNEEMTVITSKSYKYNALQEL-----
R5GSU5          ADGSSGSRRMPSNMNALLELNGITAGDQ------LQNEIFILQSHRLIERVVTRL-----
A0A2P8EAX2      REGERA-GNLTESPILSDLE-NIKTTVK------LDNEIEKLRSKSLLNEAVISK-----
A0A3N4H5N3      KEGDRP-TTVAESSVLNELD-NLKTSIK------LENEIEKLKSKSLMNEAVISN-----
A0A2A3UE91      NDANQA-DDILKL------NSLSNNGNV------LAEAIEQIRSKVFLKRVVEKL-----
A0A0A2G557      NTKSDISGPLADIMKISGTDIGGIKGNDK-----IENEIIIFRTERLLSRVIDEL-----
A0A2N2WFW8      NSDDKA-QKLFES--------KNFYDED------IYRKIEIMRSPVFMERVIEKL-----
A0A1F3IU95      NTDDKA-EKLFDN--------KTYYEDD------IYRKIEIMRSPVFMQRVVSNL-----
A0A3D0VUF6      NTDDKA-EKLFDN--------KTYYEDD------IYRKIEIMRSPVFMQRVVSNL-----
A0A1T4PT95      NTESNMSGPLADIMKISGAELGFKGTDK------IENEIIIFRTHNMLSQVVNRL-----
A0A3Q9FR88      TSSSQDFAEKFGI-----MN-NSLNDGK------LESEMALITSGVTYNRVIDSL-I---
A0A150ADJ9      TSSSQEFAEKLGL-----MS-NSLNDGK------LESEMALITSGVTYNRILDSL-I---
A0A1B1FWQ4      TSSSQEFAEKFGI-----TN-SSLEEGK------LESEMALITSGVMYERIVDSL-I---
A0A1S1Z228      TSSSQEFAEKFGI-----AN-SSLEEGK------LESEMALITSGVMYERITDSL-I---
A0A1F3SJM1      SDKDEA-KDVLNI-----DN-LNVRGDQ------LSSVVELLRSELLFERAIAHL-----
A0A2G2EB96      GDQDSA-KDVLDI-----EN-INSRDNE------ISSVVELLRSELLFERALNKL-----
A0A2G6PRA9      GDKDNA-KDVLNI-----EN-INSREND------MSGVVELLRSELLFEKALNKL-----
A1ZKR2          AIKDEG-VGMLGI-----KG-LIPGGSYSGG--NLVGEIEFIRSQIIFNDVINAM-----
A0A1Q3GX01      AIKDEG-VQMLGI-----KQ-LITNNN-SNG--NLIGEIEFIRSQIIFNAVINTM-----
A0A349DQI4      AIKDEG-VQMLGI-----KQ-LITSNS-ING--NLIGEVEFIRSQIIFNSVIDAM-----
A0A2N3IIZ0      EFKDESAGLDLRI-----GLNQENPIDN------IAGELEVIRSPLIYEEVLKNI-----
A0A2A4PYG9      TSQNTA-QKVLNV-----EN-IYEQD--------VAGEIELIRSRAFLSNALSRI-----
A0A2A5FYT6      RTDNTA-SQILEA-----TP-AYLRQD-------ISGDIEFLRSKEFFKNILNTL-----
A0A2E6SYP1      SEKNDV-NQMMNF-----EN-IYETN--------LVAEMSRLKSKKMLSEALADL-----
A0A2E5RLE8      SEKNDV-NQMMNF-----EN-IYETN--------LVAELSRLKSKKMLSEALNTL-----
A0A2E7TQF6      SEKNDV-NQMMNF-----EN-IYETN--------LVAELSRLKSKKMLSEALNTL-----
A0A2E6GVY9      SEKNDV-NQMMNF-----EN-IYETN--------LVAELSRLKSKKMLSEALKTL-----
A0A350JJ90      INENQA-NRILNV------G-DIYEDAD------ISKDIELLRSPEFFKRVIANL-----
A0A3M1CDV2      VNSDA--HQILQL-----NP-ANTEGNNK-----VAEAIEQIRSKTFLERIINNL-----
A0A2E2TFD1      KESNQA-SQLLEI-----DF-GKNQNED------MMSDLEVIRSKEFLKTIFKKL-----
A0A2E4ELE6      KEQNRA-TQVLDL-----E--RMNEKAD------ISADIEIIRSKEFLKTIFAKL-----
A0A2E3XZI5      AVKDEP-LEFMQM-----NP-LSSNSTN------LKSELAIIKSQKSILRLIKKL-----
A0A2M7NLQ9      EMKGT--SELLGR------G-IFSSDENVTN--FLVGEIELILSRSVYEEAVKRL-----
I4AFR0          EMKGT--SELLGK------G-IFASDENAIN--FLSGEIELILSRSVYEEAVKKL-----
A0A2N2Y3E5      KDEADKTNKILNI------Q-NIYDEFN------PNQTIELIRSKEFIKRVIKSL-----
A0A2D9D7T6      VEEDRV-KEVLGK------D-AFTDRESADG--GLSKYIELLKSEFIFEKAVERL-----
A0A1F3PPL5      SNNNNA-DKVLEI------E-NLREENT------IAQTIELLRSQEFLKRVFSKL-----
A0A357QK06      SNNNNA-DKVLEI------E-NLREENT------IAQTIELLRSQEFLKRVFSKL-----
A0A2A5B3B0      SSLNTA-SKVLEV------R-EFQETNS------LSKDVEILKSKLLFKRALKRI-----
A0A0F2NS19      GSENTA-NKVLQV------D-NFSKTED------VAKDVELLRSKLLLKRALSKL-----
A0A2A5H8X6      GSENTA-NKVLQV------D-NFSKTED------VAKDVELLRSKLLLKRALSKL-----
A0A2H0GAU8      GSENTA-NKVLQV------D-NFSQKED------IAKDVELLKSKLLFKRALSKL-----
A0A2M8FTK1      GSENTA-NKVLQV------D-NFSQKED------IAKDVELLKSKLLFKRALSKL-----
A0A0S2HYK8      QEDKKT-SQVFQL-----DD-LYEDNKK------LNKTIALIRSKEFLKRTFAKL-----
A0A2N5ZWN6      QEDNKN-TQVFQL-----DN-LYEDNKK------LSKTIALIRSKEFLKRTFSKL-----
A0A2E0FJ09      TSQDNA-RRILNV-----KN-PLQEDET------LTGDVELLRSPLLMEKTVASL-----
A0A1F3FZ62      SSSNSA-NKVLQT-----AN-IYDGEND------ISKTVELLKSKVFLKRVFSKL-----
A0A1F3K211      SSSNSA-NKVLQT-----AN-IYDGEND------ISKTVELLKSKVFLKRVFSKL-----
A0A1F3KLL5      NEQNQT-AEILGF-----KN-NFIKPSE------LPAVMELIRSNEFLKRVFVKL-----
A0A359D1M1      NEQNQT-AEILGF-----KN-NFIKPSE------LPAVMELIRSNEFLKRVFVKL-----
A0A2E7CT70      NIKDKA-DELLEI------Y-SFQQKTN------INSEVELLKSQIIIDKAIKKL-----
A0A2D5V560      AVKEQP-NGFSDL------Y-SYNINTN------LNSEIALMNSEKAIEKVIRDI-----
A0A2D7K5A8      AVKEQP-NGFSDL------Y-TYNINTN------LNSEIALMKSQKAIDRVIEDL-----
A0A2E1XQ82      AVKEQP-NGFSDL------Y-TYNINTN------LKSEIALMKSQKAIDRLVEDL-----
A0A1V6I2U9      KNENKT-NQILGI------S-SNLMEKD------LAPVIELIRSNEFLKTVVEVL-----
A0A1F3C1M2      NTKNQT-NQLLNI------E-NVSDNNE------LAQIIELIRSTEFLKRTFNKL-----
A0A1F3DS87      NTKNQT-NQLLNI------E-NVSDNNE------LAQIIELIRSTEFLKRTFNKL-----
A0A2H0B957      KNENTNANKILNL------T-NAVEEIN------SIQTIELIRSKEFLKKTFNKL-----
A0A1F3CFW6      KNEGTTANKVLNL------T-TAVEEIN------SMQVIELIRSKEFLKRTFNKL-----
A0A2M7E2T8      KNEGTTANKVLNL------T-TAVEEIN------SMQIIELIRSKEFLKRTFNKL-----
A0A2M7NC69      KNEGTTANKVLNL------T-TAVEEIN------SMQIIELIRSKEFLKRTFNKL-----
A0A1F3K695      NDQNQA-DKLLNL-----ES--VYENTN------LAHVVELIRSKEFLKRAFEKL-----
A0A353KZR1      NDQNQA-DKLLNL-----ES--VYENTN------LAHVVELIRSKEFLKRAFEKL-----
A0A2N2WYB5      NENDRT-TRLLNI-----ED--VYQNDD------ISKVIELLRSKEFLKRAFSNL-----
A0A1F3K4G0      NETNNT-TKVLKI-----ED--VYQDND------ILKVIELLRSKEFLKRTFLKL-----
A0A356H8Y3      NETNNT-TKVLKI-----ED--VYQDND------ILKVIELLRSKEFLKRTFLKL-----
A0A351HSA6      NETNNT-TKVLKI-----ED--VYQDND------ILKVIELLRSKEFLKRTFLKL-----
A0A1F3Q014      ETTNQA-SKLLNV-----GN-ITEPDNG------LAEGIELLKSKVFLKRVLSQL-----
A0A2A4YXP3      NSLNTA-SSVLNV-----GG-GFKESNS------LAKDVEILRSKLLFKRALRKI-----
A0A2D5KD44      EKSNQA-NRLLDV-----ED--YYESND------ISSEIELLKSPLLMEATLEKL-----
A0A1F3R158      GSKNTA-DQVLKV-----DN--FEEKED------VEKDVELLKSKFLLKRALSKL-----
A0A2M8ADX2      GSKNTA-DQVLKV-----DN--FQEQED------VAKDVELLKSKFLLKRSLLKL-----
A0A1J5B2H0      SSDNEA-QKIFQT-----NNINVEEDNN------LAKQIELMRSSLFLNRVISKL-----
A0A1V5N756      YTEEEV-RQVFGK-----KT-----QVD------LAKKVELLNSSMFLSRVFSKL-----
                                                                            

A0A1I3J6V0      ------------------------------------------GLAESP------------
A0A1H4ADG3      ------------------------------------------QLYLNF-----STY----
A0A3D5KRY6      ------------------------------------------NWRYSW-----YQK----
A0A1V5IPN7      ------------------------------------------KKNPDW-----ESYPISG
A0A1V3WH52      ------------------------------------------GLDIAV-----TKNTFPV
A0A2K8Z965      ------------------------------------------HLNVRY-----YEA----
A0A418M8U8      ------------------------------------------HLDVRY-----FEK----
I2GTA4          ------------------------------------------HLDVRY-----FEK----
A0A2K8ZAJ2      ------------------------------------------GLDVQY-----YRP----
A0A368JPA3      ------------------------------------------GLNIRY-----FRS----
A0A3P1BT12      ------------------------------------------GLNIRY-----FRS----
A0A3P1CI15      ------------------------------------------GLNVRF-----FRS----
A0A1Q3PII2      ------------------------------------------HLTTQY-----FAS----
A0A351BXT2      ------------------------------------------------------------
A0A3D0MYJ7      ------------------------------------------L-----------------
A0A3D3LS70      ------------------------------------------------------------
A0A1G7ZF38      ------------------------------------------HLTTQY-----FAA----
C6VS52          ------------------------------------------HLTIQY-----FAS----
A0A1G1TM36      ------------------------------------------GLSTVY-----QRP----
A0A1V3WH27      ------------------------------------------ALTQQA-----KQRVLPV
A0A0D3L8Q3      ------------------------------------------DLDVTY-----YGD----
A0A0K8QSK7      ------------------------------------------GFEVSV-----YSV----
A0A1V6CN82      ------------------------------------------GFEVSY-----HNE----
A0A1M4XZ45      ------------------------------------------DFEVSY-----YAL----
A0A399D319      ------------------------------------------DFEVSY-----YAV----
A0A0P7X1V8      -------------------------------------------YDERY-----QPD----
A0A3B0C2S4      ------------------------------------------NLDVSY-----FQK----
A0A416GA42      ------------------------------------------DLDVCY-----QVK----
A0A3N2M1H3      ------------------------------------------HLDMNY-----DRL----
A0A1T3IYP5      ------------------------------------------GADKSY-----KIH----
A0A212K7W5      ------------------------------------------KLDEDY-----STK----
F5IU11          ------------------------------------------KLDEDY-----SIK----
A0A352Z1R7      ------------------------------------------HLDWQV-----TKK----
A0A0A2F501      ------------------------------------------GLNVEY-----YAD----
R5B7P0          ------------------------------------------RLYMSY-----TVD----
R5B0L5          ------------------------------------------SLDETY-----NID----
A0A374THP7      ------------------------------------------KLDVDY-----AID----
A0A3R5XWG1      ------------------------------------------KLNVDY-----AVD----
A0A414YFM3      ------------------------------------------KLNVDY-----AVD----
A0A0A2EVS5      ------------------------------------------NLDIDY-----KVD----
A0A1T4NAJ7      ------------------------------------------NLDIDY-----KVD----
A0A2V1IJY1      ------------------------------------------NLDMNY-----YIP----
A0A3N2KCL3      ------------------------------------------NLDMNY-----YIP----
A0A255T941      ------------------------------------------RLNEVY-----SVR----
A0A1Y4CHN5      ------------------------------------------HLDVNY-----KVD----
A0A1Y3V692      ------------------------------------------GLNETY-----TVR----
A0A174TYU6      ------------------------------------------GLNETY-----TVR----
A0A1M6I2S6      ------------------------------------------GLNETY-----TVR----
F3PXM2          ------------------------------------------GLDETY-----TVR----
A0A3E4ZNL4      ------------------------------------------VLNETY-----IIR----
A0A174AHH7      ------------------------------------------GLNEIY-----TIR----
A0A174JCE8      ------------------------------------------GLNEIY-----TIR----
A0A3E4JMC4      ------------------------------------------GLNEIY-----TIR----
A0A412SND6      ------------------------------------------GLNEIY-----TIR----
A0A414IEQ9      ------------------------------------------GLNEIY-----TIR----
A0A415UKN5      ------------------------------------------GLNEIY-----TIR----
A0A0M1W8D8      ------------------------------------------GLNEIY-----TIR----
A0A3R6GKX5      ------------------------------------------GLNEIY-----TIR----
A7V4S1          ------------------------------------------GLNEIY-----TIR----
B0NU19          ------------------------------------------GLNEIY-----TIR----
D4V601          ------------------------------------------GLNEIY-----TIR----
A0A397WLT5      ------------------------------------------GLNEIY-----TIR----
A0A3R6GM96      ------------------------------------------GLNEIY-----TIR----
A0A015XH67      ------------------------------------------GLNEIY-----TIR----
A0A078RZN2      ------------------------------------------GLNEIY-----TIR----
A6L0K5          ------------------------------------------GLNEIY-----TIR----
A7ACT5          ------------------------------------------GLNEIY-----TIR----
A6KY94          ------------------------------------------GLNEIY-----TVR----
A0A173UQR8      ------------------------------------------GLNEIY-----TVR----
A0A3R6HK75      ------------------------------------------GLNEIY-----TVR----
A0A412B7D1      ------------------------------------------GLNEIY-----TVR----
A0A412VNY9      ------------------------------------------GLNEIY-----TVR----
A0A414LTU9      ------------------------------------------GLNEIY-----TVR----
I9Q4U4          ------------------------------------------GLNEIY-----TVR----
A0A373ISF0      ------------------------------------------RLNETY-----TVR----
U6RF62          ------------------------------------------RLNETY-----TVR----
A0A073I794      ------------------------------------------GLNEAY-----TVR----
A0A108TH71      ------------------------------------------GLNETF-----TIR----
I8VXH0          ------------------------------------------GLNETF-----TIR----
A0A412S0N6      ------------------------------------------GLNETY-----TIR----
A0A412IIJ0      ------------------------------------------GLNETF-----TIR----
A0A0P0FM97      ------------------------------------------GLNETF-----TIR----
R6KTP3          ------------------------------------------GLNETF-----TIR----
A0A139LU87      ------------------------------------------GLNETF-----TIR----
A0A1C6B3Y5      ------------------------------------------GLNETF-----TIR----
E2NMQ4          ------------------------------------------GLNETF-----TIR----
A0A412YDB9      ------------------------------------------GLNETF-----TVR----
R7DY01          ------------------------------------------GLNETF-----TVR----
A0A414LGK8      ------------------------------------------GLNEVF-----TVR----
A0A016E4F9      ------------------------------------------GLNETY-----TIR----
A0A413PP50      ------------------------------------------GLNETY-----TIR----
A0A3A5TI83      ------------------------------------------GLNETY-----TVR----
A0A415NEB6      ------------------------------------------GLNETY-----TVR----
A7AJ60          ------------------------------------------GLNETY-----TVR----
A0A015UXN7      ------------------------------------------GLNETY-----TVR----
A0A395YYT3      ------------------------------------------GLNETY-----TVR----
A0A415IPQ4      ------------------------------------------GLNETF-----TIR----
A0A3E5BRW7      ------------------------------------------GLNDIF-----TVR----
K9DXS6          ------------------------------------------GLNDIF-----TVR----
A0A1M6KFV3      ------------------------------------------GLNESF-----TVR----
A0A1Q6G7L3      ------------------------------------------GLNESF-----TVR----
A0A413H235      ------------------------------------------GLNESF-----TVR----
A0A1M5B2J8      ------------------------------------------HLEMNY-----LVE----
A0A255RCT5      ------------------------------------------HLDMNY-----LVD----
A0A1Y4GLF5      ------------------------------------------QLGTTY-----YLP----
A0A1H3XSC0      ------------------------------------------HLDMNY-----TVP----
B3JI46          ------------------------------------------RLDMNY-----FVR----
A0A174UR09      ------------------------------------------RLDMNY-----FVP----
A6LE40          ------------------------------------------RLDMNY-----FVP----
R6NN15          ------------------------------------------HLEVDY-----STE----
A0A358R8U0      ------------------------------------------HLDMNY-----HIP----
R6WSB6          ------------------------------------------HLDMNY-----HIP----
A0A401LPX7      ------------------------------------------HLEMNY-----QTD----
A0A3A5Z900      ------------------------------------------HLEMNY-----QTD----
A0A3R6I893      ------------------------------------------HLEMNY-----QTD----
A0A3R6EGW5      ------------------------------------------HLEMNY-----QTD----
A0A285TGL6      ------------------------------------------HLEMNY-----QTD----
A0A3A5RFX4      ------------------------------------------HLEMNY-----QTD----
A0A1Q6IUW9      ------------------------------------------HLEMNY-----QTD----
A0A3R6NPG7      ------------------------------------------HLEMNY-----QTD----
A0A413XDP6      ------------------------------------------HLEMNY-----QTD----
K6AP24          ------------------------------------------HLEMNY-----QTD----
A0A076IQN8      ------------------------------------------HLEMNY-----QTD----
A0A078RYI7      ------------------------------------------HLEMNY-----QTD----
C7XEQ8          ------------------------------------------HLEMNY-----QTD----
D7INX6          ------------------------------------------HLEMNY-----QTD----
K5ZG55          ------------------------------------------HLEMNY-----QTD----
A0A3N2N9B8      ------------------------------------------KLDMDY-----YSH----
A0A3N2NMI0      ------------------------------------------NLDVNY-----FRK----
A0A359I8H7      ------------------------------------------GLDVNY-----STP----
A0A3N2KA63      ------------------------------------------GLDVNY-----STP----
A0A3B9FAU3      ------------------------------------------NLDMNY-----TME----
A0A3C1E5L7      ------------------------------------------NLDMNY-----TME----
A0A354SN68      ------------------------------------------HLEVSY-----SIS----
A0A0A2DUD9      ------------------------------------------ELWTSY-----EAP----
A0A3N2N595      ------------------------------------------KLDMNY-----FKD----
R5FHS9          ------------------------------------------GLNVSY-----LTD----
A0A3P1ZBJ5      ------------------------------------------HLDIDY-----SVE----
A0A413TW79      ------------------------------------------KLDVNY-----SEG----
A0A3E5E9M7      ------------------------------------------KLDVNY-----SED----
A0A3E4SK73      ------------------------------------------KLDVNY-----SED----
A0A415GGC6      ------------------------------------------KLDVNY-----SED----
A0A413DBH9      ------------------------------------------KLDVNY-----SED----
G9S1S8          ------------------------------------------HLNMDY-----HVD----
A0A354M4S6      ------------------------------------------HLNMDY-----HVD----
R7DH52          ------------------------------------------HLNMDY-----HVD----
A0A396N3D5      ------------------------------------------HLNMDY-----LVD----
A0A415ZDP9      ------------------------------------------HLNMDY-----HVD----
A0A016CWA4      ------------------------------------------RLDMNY-----FVP----
A0A1C6H117      ------------------------------------------RLDMNY-----FVP----
A0A415TAH7      ------------------------------------------RLDMNY-----FVP----
A0A0M1W0V2      ------------------------------------------RLDMNY-----FVP----
A0A139KA16      ------------------------------------------RLDMNY-----FVP----
A0A174VQ92      ------------------------------------------RLDMNY-----FVP----
A0A1Q6HCG0      ------------------------------------------RLDMNY-----FVP----
A0A1Y4JYM9      ------------------------------------------RLDMNY-----FVP----
A0A3A5QW67      ------------------------------------------RLDMNY-----FVP----
A0A3A5RQE6      ------------------------------------------RLDMNY-----FVP----
A0A3A6BP07      ------------------------------------------RLDMNY-----FVP----
A0A3E5E153      ------------------------------------------RLDMNY-----FVP----
A0A3Q9IP20      ------------------------------------------RLDMNY-----FVP----
A0A412WV15      ------------------------------------------RLDMNY-----FVP----
A0A413ICP6      ------------------------------------------RLDMNY-----FVP----
A0A414KYB9      ------------------------------------------RLDMNY-----FVP----
A0A416X133      ------------------------------------------RLDMNY-----FVP----
E5WX00          ------------------------------------------RLDMNY-----FVP----
K0X3P3          ------------------------------------------RLDMNY-----FVP----
A0A3A5Z014      ------------------------------------------HLDMNY-----FVP----
A0A1M4YZ07      ------------------------------------------RLDMNY-----FVP----
A0A078S3Q8      ------------------------------------------RLDMNY-----FVP----
A0A069SJV7      ------------------------------------------RLDMNY-----FVP----
A0A3E5DXI5      ------------------------------------------RLDMNY-----FVP----
A0A3E5EM98      ------------------------------------------RLDMNY-----FVP----
A0A3E5F453      ------------------------------------------RLDMNY-----FVP----
I9T3G6          ------------------------------------------RLDMNY-----FVP----
A0A0P0FQW1      ------------------------------------------RLDMNY-----FVP----
C3RFN5          ------------------------------------------RLDMNY-----FVP----
A0A3E4SYU0      ------------------------------------------RLDMNY-----FVP----
A6LGY1          ------------------------------------------RLDMNY-----FVP----
K5ZSH4          ------------------------------------------RLDMNY-----FVP----
A0A078T2W6      ------------------------------------------RLDMNY-----FVP----
A0A3R6D1V4      ------------------------------------------RLDMNY-----FVP----
A0A3R6EAF7      ------------------------------------------RLDMNY-----FVP----
A0A412MJT7      ------------------------------------------RLDMNY-----FVR----
A0A3E4WKT5      ------------------------------------------RLDMNY-----FVR----
A0A3A5YY33      ------------------------------------------RLDMNY-----FVR----
A0A078TAH2      ------------------------------------------RLDMNY-----FVR----
A0A1E9CFZ7      ------------------------------------------RLDMNY-----FVR----
A0A373FYU5      ------------------------------------------RLDMNY-----FVR----
A0A3A5TZ72      ------------------------------------------RLDMNY-----FVR----
A0A3A5XBP2      ------------------------------------------RLDMNY-----FVR----
A0A3A6MEG9      ------------------------------------------RLDMNY-----FVR----
A0A3E4JP35      ------------------------------------------RLDMNY-----FVR----
A0A3E4KP40      ------------------------------------------RLDMNY-----FVR----
A0A3E4NX82      ------------------------------------------RLDMNY-----FVR----
A0A3E4XFU8      ------------------------------------------RLDMNY-----FVR----
A0A412RG70      ------------------------------------------RLDMNY-----FVR----
A0A412TD37      ------------------------------------------RLDMNY-----FVR----
A0A413GAA4      ------------------------------------------RLDMNY-----FVR----
A0A414M7I4      ------------------------------------------RLDMNY-----FVR----
E5UZA2          ------------------------------------------RLDMNY-----FVR----
A0A069SMG6      ------------------------------------------RLDMNY-----FVR----
A0A1Y4PQK7      ------------------------------------------HLDMSY-----YAP----
A0A1Y3ZDB3      ------------------------------------------HLDMSY-----YAP----
A0A3A6AAP4      ------------------------------------------HLDMSY-----YAP----
A0A1Y4IH41      ------------------------------------------HLDMSY-----YAP----
A0A1Y4DYA7      ------------------------------------------HLNINY-----YTK----
A0A1Y3X4I9      ------------------------------------------HLNINY-----STD----
A0A1Y4FNK8      ------------------------------------------HLDINY-----YTD----
A0A355FD59      ------------------------------------------HIDVDY-----QIN----
A0A359CEZ9      ------------------------------------------HIDVDY-----QIN----
A0A353Q7B4      ------------------------------------------HIDVDY-----QIN----
A0A1M3KVR9      ------------------------------------------HLDVNY-----QIK----
F8X3A5          ------------------------------------------HLDVNY-----QIK----
A0A3C1ITV0      ------------------------------------------RLNVTY-----KSK----
R7HN19          ------------------------------------------RLNVTY-----KSK----
A0A415EEZ4      ------------------------------------------GLETEY-----SMK----
A0A060RD97      ------------------------------------------DLNVSY-----SYM----
A0A350IHV0      ------------------------------------------GLEASY-----VEK----
A0A077ENE7      ------------------------------------------HADKSY-----KVH----
T0NN57          ------------------------------------------GSDISY-----KVR----
X5K347          ------------------------------------------GSDISY-----KVR----
A0A1T5K9D4      ------------------------------------------NIDVNY-----IHH----
R5RVP0          ------------------------------------------GLETTY-----VEK----
A0A285T4L1      ------------------------------------------HADVDY-----RVE----
A0A3E5BU42      ------------------------------------------HADVDY-----RVE----
A0A414ZBF2      ------------------------------------------RLDVSY-----KER----
R5KD55          ------------------------------------------GLDVSY-----TTR----
A0A174QNT3      ------------------------------------------HLDINY-----VVR----
R9I0H0          ------------------------------------------HLDVDY-----TIR----
K5BUT9          ------------------------------------------HLDVDY-----AKD----
A0A174FPA3      ------------------------------------------HLDVGY-----AKD----
R6S9Y6          ------------------------------------------HLDVGY-----AKD----
C9KX15          ------------------------------------------HLDVGY-----AKD----
A0A3L8AAP1      ------------------------------------------HLDVSY-----EKE----
R6DAG6          ------------------------------------------HLDVSY-----EKE----
A0A1G8BVM8      ------------------------------------------GLETNY-----QVK----
A0A416GGJ1      ------------------------------------------HGDVDY-----LIE----
A0A3D1NQW3      ------------------------------------------GLTVQY-----ETK----
B0MT10          ------------------------------------------GLTVQY-----ETK----
R7JGW9          ------------------------------------------GLTVQY-----ETK----
A0A0E2M2Y7      ------------------------------------------DLDVSI-----SKD----
A0A0K2J6Z0      ------------------------------------------DLDVSI-----SKD----
B2RKZ8          ------------------------------------------DLDVSI-----SKD----
A0A212GC82      ------------------------------------------DLDVSI-----SKD----
A0A254MU12      ------------------------------------------DLDVSI-----SKD----
R6CQ93          ------------------------------------------HADVDY-----RVE----
A0A3D2BF46      ------------------------------------------NLHVNY-----VVK----
A0A358R538      ------------------------------------------GLTTDY-----SVR----
A0A1Y4AAB8      ------------------------------------------RLTTGY-----SKR----
A0A1Y3WWY9      ------------------------------------------NLTEAY-----SIH----
A0A1Y4U5L4      ------------------------------------------NLTEAY-----SIH----
A0A1Y3VCJ1      ------------------------------------------NLTVNY-----TVD----
A0A1Y3QTW7      ------------------------------------------HLTVNY-----SVR----
R6XWY7          ------------------------------------------HLTVNY-----SVR----
A0A174AVF1      ------------------------------------------HLTVNY-----SVR----
A0A373HTL7      ------------------------------------------HLTVNY-----SVR----
A0A1Q6EIY0      ------------------------------------------HLTVNY-----SVR----
E4M8L3          ------------------------------------------HLTVNY-----SVR----
I3YQ50          ------------------------------------------HLTVNY-----SVR----
R5UEY8          ------------------------------------------HLTVNY-----SVR----
A0A1H4D866      ------------------------------------------DLTVSY-----SVR----
A0A374A9J5      ------------------------------------------NLTVNY-----SVS----
A0A1Q6E9S3      ------------------------------------------NLTVNY-----SVS----
D4IJ36          ------------------------------------------NLTVNY-----SVS----
A0A414Q925      ------------------------------------------HLDISY-----KEW----
A0A415PUS9      ------------------------------------------HLDISY-----KEW----
A0A108TCU0      ------------------------------------------HLDISY-----KEW----
A0A413BA42      ------------------------------------------HLDISY-----KEW----
S3Y344          ------------------------------------------HLDISY-----KEW----
A0A413MY74      ------------------------------------------HLDISY-----KEW----
A0A412TGL3      ------------------------------------------HLDISY-----KEW----
A0A413VJ33      ------------------------------------------HLDISY-----KEW----
A0A414L0W6      ------------------------------------------HLDISY-----KEW----
A0A412DP39      ------------------------------------------HLDISY-----KEW----
A0A413ZSE8      ------------------------------------------HLDISY-----KEW----
B0NP84          ------------------------------------------HLDISY-----KEW----
R6AK43          ------------------------------------------HLDISY-----KEW----
A0A412N2D9      ------------------------------------------HLNVSY-----KEW----
R6LHA4          ------------------------------------------HLNVSY-----KEW----
A0A1Q6FL18      ------------------------------------------HLNVSY-----KEW----
A0A1Y4JYS9      ------------------------------------------HLNVSY-----KEW----
A0A3E5HPT8      ------------------------------------------HADVSY-----MVR----
C6IJ48          ------------------------------------------HADVSY-----MVR----
Q8A3U2          ------------------------------------------HADVSY-----MVR----
A0A3R6S1H6      ------------------------------------------NLNISY-----RVE----
A0A3R6SD81      ------------------------------------------NLNISY-----RVE----
A0A413VXJ7      ------------------------------------------HLDISY-----KIK----
I9RSN9          ------------------------------------------HLDISY-----KIK----
U6RJK5          ------------------------------------------HLDISY-----KIK----
A0A1Q6GA32      ------------------------------------------HLDISY-----KIK----
I9RPU6          ------------------------------------------HLDMSY-----KVK----
I8Y597          ------------------------------------------HLDMSY-----KVK----
I8YFS5          ------------------------------------------HLDMSY-----KVK----
A0A1Q6GBF5      ------------------------------------------HLDMSY-----KVK----
I8YFZ3          ------------------------------------------HLDMSY-----KVK----
A0A1Q6GDH2      ------------------------------------------HLDMSY-----KVK----
U6RSB0          ------------------------------------------HLDMSY-----KVK----
I9SIK1          ------------------------------------------HLDMSY-----QVK----
I9GXM2          ------------------------------------------HLDMSY-----KVK----
I9TP59          ------------------------------------------HLDMSY-----QVK----
A0A0J6CIR2      ------------------------------------------NLDISY-----TIK----
A0A3D8HG59      ------------------------------------------KLDISY-----TQK----
A0A3R6S408      ------------------------------------------KLDISY-----TQK----
A0A354WXN6      ------------------------------------------HLDINY-----SIK----
R5IP14          ------------------------------------------DLDVGY-----VMQ----
A0A316SZX7      ------------------------------------------KLDVNY-----TED----
A0A1Y4AIY1      ------------------------------------------HLDVSY-----TEK----
F3ZRU7          ------------------------------------------SLNTTY-----SVR----
A0A1C5Q1F3      ------------------------------------------KLDIFY-----SVK----
R7A239          ------------------------------------------KLDIFY-----SVK----
A0A1M6K7I9      ------------------------------------------SLNMSY-----KVR----
A0A3R6HIK7      ------------------------------------------HLDVSY-----QVK----
K5ZVW7          ------------------------------------------HLDVSY-----QVK----
A0A1Y4D5Z0      ------------------------------------------HLDISY-----TVK----
R5S343          ------------------------------------------SLEQIY-----TTK----
A0A3R5ZMK1      ------------------------------------------HLDVSY-----TVK----
A0A3E4ZTK7      ------------------------------------------HLDVSY-----TVK----
A0A1Y3ZIA4      ------------------------------------------HLDVSY-----TVK----
K5Y1A4          ------------------------------------------HLDVSY-----TVK----
A0A3R6K8X4      ------------------------------------------HLDVSY-----TVK----
A0A1Q6I3T6      ------------------------------------------HLDVSY-----TVK----
A0A414XX40      ------------------------------------------HLDVSY-----TVK----
A0A412DM15      ------------------------------------------HLDVSY-----TVK----
A7AEU7          ------------------------------------------HLDVSY-----TVK----
A0A415BDM7      ------------------------------------------HLDVSY-----TVK----
A0A3R5ZYK4      ------------------------------------------HLDVSY-----TVK----
A0A414GI87      ------------------------------------------HLDVSY-----TVK----
A0A3R6BKI7      ------------------------------------------HLDVSY-----TVK----
A0A414LPI6      ------------------------------------------HLDVSY-----TVK----
A0A412M2W1      ------------------------------------------HLDVSY-----TVK----
K5ZX55          ------------------------------------------HLDVSY-----TVK----
K5ZBN2          ------------------------------------------DLDISY-----SIR----
A0A0J6CKW3      ------------------------------------------DLDISY-----SIR----
A0A0F5IQM7      ------------------------------------------DLDISY-----SIR----
S0GLB0          ------------------------------------------DLDISY-----SIR----
A0A3R6NLC1      ------------------------------------------DLDISY-----SIR----
A0A416WYC9      ------------------------------------------DLDISY-----SIR----
A0A0F5IT40      ------------------------------------------NLDISY-----TIK----
S0GSI7          ------------------------------------------NLDISY-----TIK----
K5YB65          ------------------------------------------NLDISY-----TIK----
A0A0F5IWP9      ------------------------------------------NLDIGY-----TVK----
A0A0F5IZT8      ------------------------------------------NLDIGY-----TVK----
A0A417LKQ2      ------------------------------------------NLDVSY-----TVK----
A0A416TME1      ------------------------------------------NLDVSY-----TEK----
A0A416XPE8      ------------------------------------------NLDVSY-----TEK----
L8JI02          ------------------------------------------LDFGIS-----YFS----
A6EBM4          ------------------------------------------LQYHIS-----FYS----
A0A2N3U785      ------------------------------------------SLYVNY-----YVE----
A0A0E3ZG78      ------------------------------------------SLFIGY-----YIE----
A0A1I6BRK6      ------------------------------------------DLVTRY-----YVE----
A0A243WAB1      ------------------------------------------NLVANY-----YVE----
A0A399SH26      ------------------------------------------LHLYAP-----VYE----
A0A0E3ZGV6      ------------------------------------------LKLYAP-----VYE----
A0A1I2N4S1      ------------------------------------------LKLYAP-----IYE----
A0A2T5YE44      ------------------------------------------LKLYAP-----IYE----
A0A1M4YED3      ------------------------------------------LNLYTE-----IKE----
A0A3P1Z8V4      ------------------------------------------GLEVDY-----TCR----
A0A2L2WX98      ------------------------------------------HLDVDY-----TIK----
G5GD56          ------------------------------------------GLDVDY-----TTS----
R6A0L2          ------------------------------------------NLDVDY-----TTK----
R7LG80          ------------------------------------------DLDVDY-----LMP----
A0A1M6XHU0      ------------------------------------------AIVATA-----ETA----
D0MHQ9          ------------------------------------------AIVATA-----ETA----
G2SF81          ------------------------------------------AIVATA-----ETA----
A0A2H3NSN0      ------------------------------------------ELRTAA-----DTT----
A0A2P6C324      ------------------------------------------TIEDVA-----DTT----
A0A126PFG0      YQQRDHLGARDLYGRSPVQF----------------------TLVPTH-----SVP----
A0A3M1N7Z3      VYSIGKVG-RSLVFPHPFQI----------------------SF---------SSP----
R7PCR1          YDTKDGLRPISLFSIRPFNVVFQAPFSKALAFDVKILDENSFELKNLQ-----FED----
A0A2A8CVM9      ------------------------------------------ELRATE-----SAL----
A0A3C0ZQC7      ------------------------------------------RLIKRG-----YTD----
A0A2E3R1D0      ------------------------------------------RLIEAE-----TVP----
A0A2T2USC0      ------------------------------------------RLDSME-----TNP----
A0A2T2V0F3      ------------------------------------------RLDTME-----THP----
A0A2T2S682      ------------------------------------------RLDTMG-----THP----
D5H561          ------------------------------------------RLLEQG-----EAR----
A0A2H3NWA9      ------------------------------------------RMDEM-------YP----
A0A2A8CVB6      ------------------------------------------SLLALG-----RHP----
A0A2P6C1S6      ------------------------------------------QLQRMG-----THP----
A0A2T2UTM4      ------------------------------------------RLQDLG-----THP----
A0A1T5MMH4      ------------------------------------------NIDVTY-----YSK----
A0A2W4R1L8      ------------------------------------------KIDVSY-----YNK----
A0A2E5CV79      -----------------------------------------------------WDS----
A0A2A4G4B1      ------------------------------------------NLHIRY-----YSK----
A0A2D4ZVH1      -------------------------------------------NEVEF------------
A0A0E3V905      ------------------------------------------HLDVRY-----FQN----
A0A1M6GR99      ------------------------------------------NLEVSY-----YEY----
A0A1M5BA90      ------------------------------------------HLYAPI-----FED----
A0A1V9F098      ------------------------------------------QLYAPIYEAAGNKG----
A0A1V9FHD0      ------------------------------------------HLYAPVSEAADFGS----
A0A1T5CS78      ------------------------------------------DLYAPI-----YED----
A0A0Q9Z8F1      ------------------------------------------NLYAPI-----YED----
A0A2N0U0M7      ------------------------------------------NLYAPI-----YED----
A0A1M6TTV4      ------------------------------------------GMDVSY-----FRP----
A0A1Q6IT42      ------------------------------------------DLNISY-----TSK----
K0X1U5          ------------------------------------------DLNISY-----TSK----
A0A416XAH0      ------------------------------------------DLNISY-----TSK----
R5EXK3          ------------------------------------------DLNISY-----TSK----
A0A401UAP7      ------------------------------------------KLDVSY-----YSV----
A0A1W2GF52      ------------------------------------------GMGISY-----YHP----
A0A2G5L7B8      ------------------------------------------GMNVSY-----FHP----
A0A0D3LFR6      ------------------------------------------DLDVSY-----FTQ----
M7N6D4          ------------------------------------------DLDVSY-----FEK----
A0A364XUP5      ------------------------------------------NLSVSY-----FNK----
A0A1M5RLA9      ------------------------------------------DLNVSY-----FSV----
A0A385SFR9      ------------------------------------------DLNVSY-----FSV----
L8JW09          ------------------------------------------DLDLSY-----YTA----
A0A1Q3ZMZ7      ------------------------------------------DLAVGF-----FNK----
A0A2D8JJW3      ------------------------------------------PVNSLF-----LTP----
A0A2W2AFF7      ------------------------------------------QLNVNY-----FSS----
A0A2N5YXE2      ------------------------------------------PLDVSY-----YRQ----
A0A2I0QZ80      ------------------------------------------PLQISL-----YAK----
A0A2U2XBJ3      ------------------------------------------PLTVSL-----YAK----
A0A3E1F1A3      ------------------------------------------PLTVSH-----YAK----
A0A1V9F383      ------------------------------------------LLYAPINEGPEYSM----
G8TRZ6          ------------------------------------------HLYAPIYEGIDFSQ----
A0A2W1NDY9      ------------------------------------------NLKISY-----FSE----
A0A1G0CI31      ------------------------------------------HMNVSL-----FSK----
F2IKD6          ------------------------------------------NMNVSV-----FSK----
A0A1I7BM74      ------------------------------------------NLEVSH-----FAK----
A0A2G2FJ17      ------------------------------------------DLQVSL-----FAE----
A0A416X8R7      ------------------------------------------HLDVTY-----QVK----
K0XJ09          ------------------------------------------HLDVTY-----QVK----
R5EUZ0          ------------------------------------------HLDVTY-----QVK----
W0EQS0          ------------------------------------------HLDVAY-----RVK----
A0A1Y3WE15      ------------------------------------------HLDVTY-----QVK----
A0A1Y4GUK3      ------------------------------------------NLDVTY-----QVK----
A0A2U1FKU2      ------------------------------------------NLDLTL-----SKD----
A0A0A2F954      ------------------------------------------DLDVSI-----SKQ----
A0A0A2FW91      ------------------------------------------DLDVSI-----SKQ----
A0A2D2N2N1      ------------------------------------------DLDVSI-----YKQ----
Q7MWZ2          ------------------------------------------DLDVSI-----YKQ----
T2NDT6          ------------------------------------------DLDVSI-----YKQ----
W1R7P9          ------------------------------------------DLDVSI-----YKQ----
A0A1R4AFZ0      ------------------------------------------DLDVSI-----YKQ----
A0A1R4DVZ7      ------------------------------------------DLDVSI-----YKQ----
A0A1G9E2A9      ------------------------------------------DLAVSY-----YVV----
A0A2T2YJE8      ------------------------------------------PLDINY-----YSI----
A0A3M9N829      ------------------------------------------PLQVSY-----HVD----
A0A0P0CSF9      ------------------------------------------PLQVSY-----FVE----
A0A3M9MNC3      ------------------------------------------PLQVSY-----HIE----
A0A2M6GH67      ------------------------------------------NLKVNY-----YAM----
A0A127B287      ------------------------------------------PLQVSY-----HVE----
A0A369QP10      ------------------------------------------PLDISY-----YAI----
A0A418R9X5      ------------------------------------------TLDVNY-----YVQ----
A0A428JSJ3      ------------------------------------------ELDVNY-----YVQ----
A0A428KI59      ------------------------------------------ALDVNY-----YVQ----
W8F1I6          ------------------------------------------ALDVNY-----YVQ----
A0A246FQC0      ------------------------------------------DLDVNY-----YVQ----
A0A372E5P8      ------------------------------------------ALDVNY-----YVQ----
A0A1H3EMW1      ------------------------------------------ALDVNY-----YVQ----
A0A1H9ZSN3      ------------------------------------------ALDVNY-----YVQ----
A0A0M3RW20      ------------------------------------------ELDVNY-----YAQ----
A0A1S9B3W0      ------------------------------------------PLDVNY-----YAE----
A0A1W1VRL3      ------------------------------------------ALDVNY-----YVE----
A0A1M6R305      ------------------------------------------DLDVNY-----YAE----
A0A2M9B9H9      ------------------------------------------ELNVNY-----YVE----
A0A126PDF2      ------------------------------------------DLYVNY-----YVQ----
A0A2Z3GKA1      ------------------------------------------DLYVNY-----YVQ----
A0A328BL48      ------------------------------------------ELDVNY-----YTE----
A0A3S0QKV1      ------------------------------------------PLDVNY-----YAE----
A0A3R9P8H7      ------------------------------------------TLDVNY-----YVQ----
A0A212UCJ7      ------------------------------------------DLEVNY-----YAE----
A0A238WIA7      ------------------------------------------ELEVAY-----YAE----
A0A0W8EDI5      ------------------------------------------NLNVSY-----FVE----
A0A3B7RBP8      ------------------------------------------NLNVGY-----FVE----
A0A1I5WSL8      ------------------------------------------ALDVNY-----YVQ----
A0A0U3JVM7      ------------------------------------------ALDINY-----YVQ----
A0A1G1SSV2      ------------------------------------------ALDVNY-----YVQ----
A0A1G1SXV7      ------------------------------------------ALDVNY-----YVQ----
A0A243WHR7      ------------------------------------------ALDVNY-----YVE----
A0A076HRT9      ------------------------------------------DLDVNY-----YAE----
A0A1M6DHW8      ------------------------------------------DLDVNY-----YVE----
A0A3D1KEX9      ------------------------------------------NLDVDY-----VMM----
A0A358Y7S2      ------------------------------------------GIHTNL-----YSK----
A0A1X7J248      ------------------------------------------PLDVTY-----HVI----
E4TQD2          ------------------------------------------PLDVSY-----HVI----
A0A2J6HHN3      ------------------------------------------PLDVSI-----FAK----
A0A1Y3WMT8      ------------------------------------------ELNKIY-----TSK----
A0A1Y4GQU1      ------------------------------------------ELNKVY-----TSK----
A0A1V5W8T5      ------------------------------------------NLYTSY-----YLE----
A0A2T8HKA9      ------------------------------------------QGDISY-----SKT----
A0A3B8INU3      ------------------------------------------PLQVSY-----FTQ----
A0A098LL25      ------------------------------------------KMNVSY-----FAY----
A0A1Q3Q573      ------------------------------------------PLDISY-----LKE----
A0A357YNR3      ------------------------------------------GLYATY-----TEM----
F4KK08          ------------------------------------------GLDVQY-----HYD----
A0A3N2N6F7      ------------------------------------------GLRANY-----VYK----
A0A419VXB7      ------------------------------------------GWNVSW-----YRH----
A0A2V1ILM4      ------------------------------------------GLQTDY-----IYR----
A0A3N2L0E8      ------------------------------------------GLQTDY-----IYR----
A0A3N2LFC5      ------------------------------------------GLQTDY-----IYR----
C3J7R8          ------------------------------------------NLDVSY-----SQS----
A0A0B0BTJ4      ------------------------------------------DANIVY-----ATK----
A0A3B9CNN6      ------------------------------------------DANIVY-----ATK----
R5X290          ------------------------------------------DANIVY-----ATK----
A0A1Q6E6I7      ------------------------------------------DANIVY-----ATK----
A0A2G2F510      ------------------------------------------SLNVSL-----YSR----
A0A316JZ08      ------------------------------------------NMSVSM-----FSR----
A0A1I1FXP9      ------------------------------------------NIHITY-----MQK----
A0A3B9FXJ0      ------------------------------------------PIEISL-----IAS----
R5GSU5          ------------------------------------------KLDVDY-----SVK----
A0A2P8EAX2      ------------------------------------------SAFVTF-----YDK----
A0A3N4H5N3      ------------------------------------------KAFIFL-----YDK----
A0A2A3UE91      ------------------------------------------DISVNY-----YSE----
A0A0A2G557      ------------------------------------------NLRVTY-----RKK----
A0A2N2WFW8      ------------------------------------------PLDVSI-----FVK----
A0A1F3IU95      ------------------------------------------PLGVSV-----FAK----
A0A3D0VUF6      ------------------------------------------PLGVSV-----FAK----
A0A1T4PT95      ------------------------------------------NLRVNY-----QRK----
A0A3Q9FR88      ------------------------------------------DLTVTY-----QSV----
A0A150ADJ9      ------------------------------------------DLRLSY-----YSV----
A0A1B1FWQ4      ------------------------------------------DLSVEY-----YSV----
A0A1S1Z228      ------------------------------------------DLSVDY-----YSV----
A0A1F3SJM1      ------------------------------------------NLNVSL-----YSR----
A0A2G2EB96      ------------------------------------------NLNVSL-----FSR----
A0A2G6PRA9      ------------------------------------------NLSVSL-----FSR----
A1ZKR2          ------------------------------------------DLWISY-----YQQ----
A0A1Q3GX01      ------------------------------------------DLWVSY-----YEQ----
A0A349DQI4      ------------------------------------------DLWVSY-----YEQ----
A0A2N3IIZ0      ------------------------------------------DLSVEY-----YAE----
A0A2A4PYG9      ------------------------------------------DLGISY-----YSK----
A0A2A5FYT6      ------------------------------------------DLEVSY-----FSE----
A0A2E6SYP1      ------------------------------------------KLDVNY-----YSK----
A0A2E5RLE8      ------------------------------------------NIDVNY-----YTK----
A0A2E7TQF6      ------------------------------------------NIDVNY-----YTK----
A0A2E6GVY9      ------------------------------------------NIDVNY-----YTK----
A0A350JJ90      ------------------------------------------PVDVSY-----YAE----
A0A3M1CDV2      ------------------------------------------NLQISY-----YNE----
A0A2E2TFD1      ------------------------------------------PLDISY-----FNE----
A0A2E4ELE6      ------------------------------------------PLTISY-----YTE----
A0A2E3XZI5      ------------------------------------------KLNILY-----YNE----
A0A2M7NLQ9      ------------------------------------------DLNISY-----FVK----
I4AFR0          ------------------------------------------DLSVSY-----FVK----
A0A2N2Y3E5      ------------------------------------------PLDVSY-----YSK----
A0A2D9D7T6      ------------------------------------------SLYTSV-----YSE----
A0A1F3PPL5      ------------------------------------------PIDIQY-----FNE----
A0A357QK06      ------------------------------------------PIDIQY-----FNE----
A0A2A5B3B0      ------------------------------------------PIDVSY-----YRK----
A0A0F2NS19      ------------------------------------------PLEVSY-----FNQ----
A0A2A5H8X6      ------------------------------------------PLEVSY-----FNQ----
A0A2H0GAU8      ------------------------------------------QLKVSY-----YNQ----
A0A2M8FTK1      ------------------------------------------QLKVSY-----YNQ----
A0A0S2HYK8      ------------------------------------------PLDIRY-----FVE----
A0A2N5ZWN6      ------------------------------------------PLETRY-----YIE----
A0A2E0FJ09      ------------------------------------------PLQIRY-----FLE----
A0A1F3FZ62      ------------------------------------------NFEVSY-----YIK----
A0A1F3K211      ------------------------------------------NFEVSY-----YIK----
A0A1F3KLL5      ------------------------------------------PFEISY-----FSQ----
A0A359D1M1      ------------------------------------------PFEISY-----FSQ----
A0A2E7CT70      ------------------------------------------NENVRY-----YSE----
A0A2D5V560      ------------------------------------------ELKVFY-----YFE----
A0A2D7K5A8      ------------------------------------------NLKVFY-----YFK----
A0A2E1XQ82      ------------------------------------------NLKVFY-----YFE----
A0A1V6I2U9      ------------------------------------------PLDISY-----YRK----
A0A1F3C1M2      ------------------------------------------PFQITY-----FSE----
A0A1F3DS87      ------------------------------------------PFQVTY-----FSE----
A0A2H0B957      ------------------------------------------PLGVSY-----YSQ----
A0A1F3CFW6      ------------------------------------------PLKISY-----FSQ----
A0A2M7E2T8      ------------------------------------------PLKISY-----FSQ----
A0A2M7NC69      ------------------------------------------PLKISY-----FSQ----
A0A1F3K695      ------------------------------------------PLSIAY-----YSE----
A0A353KZR1      ------------------------------------------PLSIAY-----YSE----
A0A2N2WYB5      ------------------------------------------PLQVSY-----FSE----
A0A1F3K4G0      ------------------------------------------PIQISY-----FSE----
A0A356H8Y3      ------------------------------------------PIQISY-----FSE----
A0A351HSA6      ------------------------------------------PIQISY-----FSE----
A0A1F3Q014      ------------------------------------------PLQASY-----YAE----
A0A2A4YXP3      ------------------------------------------PIDVSY-----YNQ----
A0A2D5KD44      ------------------------------------------PLQVSY-----FSE----
A0A1F3R158      ------------------------------------------PLNVSY-----FNQ----
A0A2M8ADX2      ------------------------------------------PLEVSY-----FNK----
A0A1J5B2H0      ------------------------------------------PLDISY-----YTE----
A0A1V5N756      ------------------------------------------PLDIAY-----YKK----
                                                                            

A0A1I3J6V0      -----EQL------------------V-----TRVDVSSP--------------------
A0A1H4ADG3      -----KDF------------------R-SK--PLYKKSLP---------FTT-SITGFST
A0A3D5KRY6      -----RFI------------------G-KR--DLYKNDP----------------LTLVL
A0A1V5IPN7      SAYPVGNL------------------R-RI--QI--------------------------
A0A1V3WH52      FGAGWDRL------------------M-GR--SNDTVKV----------------TDFVI
A0A2K8Z965      -----TTF------------------S-KR--ELYEDSP----------------IELII
A0A418M8U8      -----TAF------------------G-KR--EIYKASP----------------VDVFV
I2GTA4          -----TAF------------------G-KR--EIYKASP----------------VEVFI
A0A2K8ZAJ2      -----TRT------------------L-KK--HIYQESP----------------IRLIV
A0A368JPA3      -----TPF------------------G-KR--EIYEEAP----------------IRIVL
A0A3P1BT12      -----TPF------------------G-KR--EIYDDAP----------------LRIIL
A0A3P1CI15      -----TPF------------------G-KR--EIYEEAP----------------IRLVL
A0A1Q3PII2      -----GHL------------------K-TT--ELYEKTP----------------YKITL
A0A351BXT2      ---------------------------------------------------------IDT
A0A3D0MYJ7      -----DTL------------------N-TI--KDIDKSL----------------YPNLY
A0A3D3LS70      ---------------------------------------------------------IDS
A0A1G7ZF38      -----GTL------------------K-TT--ELYDKTP----------------YKVRF
C6VS52          -----GLL------------------K-TT--ELYEKAP----------------YRVRF
A0A1G1TM36      -----GRF------------------S-AQ--DLYGKSP----------------VQLTF
A0A1V3WH27      VGRLWQRL------------------Q-GR--EQGKITL----------------GELQI
A0A0D3L8Q3      -----GRI------------------K-DP--ELYGNKLP---------FRV-VTNK---
A0A0K8QSK7      -----GQI------------------L-DP--EVYTAA-P---------FVV-EWDR---
A0A1V6CN82      -----GKL------------------S-TA--ENYTDA-A---------FRV-EWDR---
A0A1M4XZ45      -----GRV------------------A-IA--ERYEEV-P---------FQV-IWDE---
A0A399D319      -----GRV------------------A-VS--ERYKEV-P---------FQV-VWDE---
A0A0P7X1V8      -----GRL------------------Y------------P---------VIWRAFPE---
A0A3B0C2S4      -----GNI------------------K-TT--EIWNPPFA---------ITK-LIAE---
A0A416GA42      -----GFW------------------R-PT--DLYGVS-P---------VTV-HFVQ---
A0A3N2M1H3      -----GGF------------------H-PV--TLYGHTLP---------YIV-DMQG---
A0A1T3IYP5      -----SGL------------------R-DY--ELYKKS-P---------VHV-KIEG---
A0A212K7W5      -----GFF------------------R-NK--PLYKNS-P---------VIV-SIDS---
F5IU11          -----GFF------------------R-NR--SLYKNS-P---------VIV-STGP---
A0A352Z1R7      -----SKD------------------L-DF--KLLDFS----------------------
A0A0A2F501      -----GRY------------------Y-KE--VLYGQELP---------YRV-KFLG---
R5B7P0          -----GTF------------------H-RN--VLYGTSLP---------ISA-DLLD---
R5B0L5          -----GRF------------------H-KD--LLYGSSLP---------IDV-DFST---
A0A374THP7      -----GAF------------------H-KE--ALYGGDLP---------VTV-DFIG---
A0A3R5XWG1      -----GRF------------------H-RN--VLYGNDLP---------VTV-QFLT---
A0A414YFM3      -----GRF------------------H-RN--VLYGNDLP---------VTV-QFLT---
A0A0A2EVS5      -----GRF------------------H-RS--TLYGSELP---------IVV-SIDR---
A0A1T4NAJ7      -----GRF------------------H-RS--TLYGSELP---------IMV-SIDR---
A0A2V1IJY1      -----GRF------------------H-DV--VAYGSNLP---------VRV-EMPG---
A0A3N2KCL3      -----GRF------------------H-DV--VAYGSNLP---------VRV-EMPG---
A0A255T941      -----EGL------------------K-RV--ELYGTS-P---------VEV-MMRK---
A0A1Y4CHN5      -----GRF------------------Y-DR--VLYGQNLP---------VSV-SFLD---
A0A1Y3V692      -----KGL------------------K-DV--GLYKSN-P---------VAV-SYRH---
A0A174TYU6      -----KGL------------------K-DV--GLYKSN-P---------VAV-SYRH---
A0A1M6I2S6      -----KGL------------------K-DV--GLYKSN-P---------VAV-SYRH---
F3PXM2          -----RGL------------------R-RV--ELYRSA-P---------VAV-RFCG---
A0A3E4ZNL4      -----RGL------------------K-QI--ELYKNS-P---------VWV-TYLA---
A0A174AHH7      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A174JCE8      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A3E4JMC4      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A412SND6      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A414IEQ9      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A415UKN5      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A0M1W8D8      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLV---
A0A3R6GKX5      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A7V4S1          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
B0NU19          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
D4V601          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A397WLT5      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A3R6GM96      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A015XH67      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A078RZN2      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A6L0K5          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A7ACT5          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A6KY94          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A173UQR8      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A3R6HK75      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A412B7D1      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A412VNY9      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A414LTU9      -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
I9Q4U4          -----RGL------------------K-RI--ELYKSS-P---------ILV-TYLF---
A0A373ISF0      -----KGL------------------K-NV--GLYKAN-P---------VAV-TFGE---
U6RF62          -----KGL------------------K-NV--DLYKAN-P---------VAV-TFGE---
A0A073I794      -----KGL------------------K-VV--ELYKSS-P---------ITV-TCSH---
A0A108TH71      -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
I8VXH0          -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
A0A412S0N6      -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
A0A412IIJ0      -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
A0A0P0FM97      -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
R6KTP3          -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
A0A139LU87      -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
A0A1C6B3Y5      -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
E2NMQ4          -----KGL------------------K-NV--DLYKVS-P---------VTI-TFCD---
A0A412YDB9      -----RGL------------------K-KV--DLYKAA-P---------FTV-TFRD---
R7DY01          -----RGL------------------K-KV--DLYKAA-P---------FTV-TFRD---
A0A414LGK8      -----KGL------------------K-KV--DLYKAA-P---------FTV-TFRD---
A0A016E4F9      -----KGL------------------R-TI--GLYKCN-P---------IAV-TYRH---
A0A413PP50      -----KGL------------------K-DV--GLYKSN-P---------IAV-TYRH---
A0A3A5TI83      -----KGL------------------K-DV--ELYKSS-P---------LAV-TYRH---
A0A415NEB6      -----KGL------------------K-DV--ELYKSS-P---------LAV-TYRH---
A7AJ60          -----KGL------------------K-DV--ELYKSS-P---------LAV-TYRH---
A0A015UXN7      -----KGL------------------K-DV--ELYKSS-P---------LAV-TYRH---
A0A395YYT3      -----KGL------------------K-DV--ELYKSS-P---------LAV-TYRH---
A0A415IPQ4      -----RGL------------------K-SV--DLYKGS-P---------VTI-TFCD---
A0A3E5BRW7      -----RGL------------------K-NV--DLYQST-P---------VTV-TFFD---
K9DXS6          -----RGL------------------K-NV--DLYQST-P---------VTV-TFFD---
A0A1M6KFV3      -----RGL------------------K-NV--DLYKSA-P---------VAV-TFLD---
A0A1Q6G7L3      -----RGL------------------K-NV--DLYKSA-P---------VAV-TFLD---
A0A413H235      -----RGL------------------K-NV--DLYKSA-P---------VAV-TFLD---
A0A1M5B2J8      -----GRF------------------H-KN--TIYGDQLP---------VAV-TLTD---
A0A255RCT5      -----GRF------------------H-KV--TIYGDQLP---------VAV-SFAD---
A0A1Y4GLF5      -----GKF------------------H-RV--VAYGKNLP---------VTV-TLCD---
A0A1H3XSC0      -----GRF------------------H-RQ--VAYGPTLP---------VNV-SING---
B3JI46          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A174UR09      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A6LE40          -----GKF------------------H-RK--VAYGLTLP---------VDV-TISD---
R6NN15          -----GSF------------------Y-AQ--VRYGQNLP---------VTV-SFAG---
A0A358R8U0      -----GRF------------------Q-DR--VAYGASLP---------LTV-SLPE---
R6WSB6          -----GRF------------------Q-DR--VAYGASLP---------LTV-SLPE---
A0A401LPX7      -----GRF------------------H-KQ--TVYGNQLP---------VHV-VIPN---
A0A3A5Z900      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A3R6I893      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A3R6EGW5      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A285TGL6      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A3A5RFX4      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A1Q6IUW9      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A3R6NPG7      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A413XDP6      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
K6AP24          -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A076IQN8      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A078RYI7      -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
C7XEQ8          -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
D7INX6          -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
K5ZG55          -----GRF------------------H-KQ--TVYGNQLP---------VQV-VIPN---
A0A3N2N9B8      -----GRF------------------H-DE--VAYGTTLP---------IEL-SIVN---
A0A3N2NMI0      -----GRF------------------H-NI--VAYGTGLP---------IQL-EIVN---
A0A359I8H7      -----GRF------------------H-EK--TLYGSNLP---------VNV-KFHD---
A0A3N2KA63      -----GRF------------------H-EK--TLYGSNLP---------VNV-KFHD---
A0A3B9FAU3      -----GRW------------------H-KN--ILYGRSLP---------ANV-RMMG---
A0A3C1E5L7      -----GRW------------------H-KN--ILYGRSLP---------ANV-RMMG---
A0A354SN68      -----DRL------------------K-EI--TLYGKNLP---------IKV-SFLE---
A0A0A2DUD9      -----GAF------------------H-DH--LLYGTNLP---------LNL-RFTD---
A0A3N2N595      -----GTF------------------H-KE--IAYGYTLP---------ICA-ELID---
R5FHS9          -----STF------------------Y-KG--VLYGQNMP---------YTV-SMPD---
A0A3P1ZBJ5      -----GFF------------------H-DI--TLYGRTLP---------FQV-RFLS---
A0A413TW79      -----GTF------------------H-PV--ALYGRTLP---------VTV-HFYS---
A0A3E5E9M7      -----GTF------------------H-PV--ALYGRTLP---------VTV-HFYS---
A0A3E4SK73      -----GTF------------------H-PV--ALYGRTLP---------VTV-HFYS---
A0A415GGC6      -----GTF------------------H-PV--ALYGRTLP---------VTV-HFYS---
A0A413DBH9      -----GTF------------------H-PV--ALYGRTLP---------VTV-HFYS---
G9S1S8          -----GGF------------------Y-RE--MLYGRTLP---------INV-SIDT---
A0A354M4S6      -----GGF------------------Y-RE--VLYGRTLP---------INV-SIDT---
R7DH52          -----GGF------------------Y-RE--VLYGRTLP---------INV-SIDT---
A0A396N3D5      -----GGF------------------Y-RE--VLYGHTLP---------INV-SIDT---
A0A415ZDP9      -----GGF------------------Y-QE--VLYGRTLP---------INV-SIDT---
A0A016CWA4      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A1C6H117      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A415TAH7      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A0M1W0V2      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A139KA16      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A174VQ92      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A1Q6HCG0      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A1Y4JYM9      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A3A5QW67      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A3A5RQE6      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A3A6BP07      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A3E5E153      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A3Q9IP20      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A412WV15      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A413ICP6      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A414KYB9      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A416X133      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
E5WX00          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
K0X3P3          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
A0A3A5Z014      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A1M4YZ07      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A078S3Q8      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A069SJV7      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E5DXI5      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E5EM98      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E5F453      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
I9T3G6          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A0P0FQW1      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TISD---
C3RFN5          -----GKF------------------H-RK--VAYGLTLP---------VDV-TIND---
A0A3E4SYU0      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A6LGY1          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
K5ZSH4          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A078T2W6      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3R6D1V4      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3R6EAF7      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A412MJT7      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E4WKT5      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3A5YY33      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A078TAH2      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A1E9CFZ7      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A373FYU5      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3A5TZ72      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3A5XBP2      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3A6MEG9      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E4JP35      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E4KP40      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E4NX82      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A3E4XFU8      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A412RG70      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A412TD37      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A413GAA4      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A414M7I4      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
E5UZA2          -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A069SMG6      -----GKF------------------H-RQ--VAYGLTLP---------VDV-TIND---
A0A1Y4PQK7      -----GRF------------------H-DR--LLYGMALP---------FQA-NITG---
A0A1Y3ZDB3      -----GRF------------------H-DR--LLYGMTLP---------FQA-NIAG---
A0A3A6AAP4      -----GRF------------------H-DR--LLYGMTLP---------FQA-NIAG---
A0A1Y4IH41      -----GRF------------------H-DR--LLYGMTLP---------FQA-NIAG---
A0A1Y4DYA7      -----GVF------------------Y-NH--ILYGQNCP---------YEV-EFFD---
A0A1Y3X4I9      -----GTF------------------Y-KQ--VLYGQACP---------YEV-EFFD---
A0A1Y4FNK8      -----GGF------------------Y-KK--VLYGGTCP---------YSV-SFND---
A0A355FD59      -----GPF------------------H-RK--TLYGSELP---------VRV-VFTD---
A0A359CEZ9      -----GPF------------------H-RK--TLYGSELP---------VRV-VFAD---
A0A353Q7B4      -----GPF------------------H-RK--TLYGSELP---------VRV-VFTD---
A0A1M3KVR9      -----DSF------------------Y-KK--VLYGPDLP---------ITV-SFAD---
F8X3A5          -----DAF------------------Y-KK--VLYGPDLP---------ITV-SFTD---
A0A3C1ITV0      -----NWI------------------GYVT--DWYDKT-P---------ICV-EYKNLPD
R7HN19          -----NWI------------------GYVT--DWYDKT-P---------ICV-EYKNLPD
A0A415EEZ4      -----DGF------------------R-RK--VLYPDI-P---------IRV-KFDS---
A0A060RD97      -----GRF------------------R-KL--DIYGEETP---------IVVKNVAE---
A0A350IHV0      -----QFL------------------R-SR--ELFTSS-P---------IAL-VQTG---
A0A077ENE7      -----KGL------------------R-DY--ELYKKS-P---------VQV-KVEG---
T0NN57          -----YGL------------------R-EY--ELYKKS-P---------IYA-KVLG---
X5K347          -----YGL------------------R-EY--ELYKKS-P---------IYA-KVLG---
A0A1T5K9D4      -----VGL------------------R-NI--ELYRNA-P---------IRI-FFSR---
R5RVP0          -----QFL------------------R-SR--EKFTDS-P---------IAL-VLAG---
A0A285T4L1      -----EGL------------------R-MN--ELYNQS-P---------INV-SFIN---
A0A3E5BU42      -----EGL------------------R-MN--ELYNQS-P---------INV-SFIN---
A0A414ZBF2      -----NGL------------------R-KR--ELYNST-P---------FTV-VFQD---
R5KD55          -----GTF------------------Y-DK--TLYGKTLP---------VKV-VFRD---
A0A174QNT3      -----NGL------------------R-HD--HIFGEL-P---------FEI-NFLD---
R9I0H0          -----DGL------------------R-RD--NLFGDL-P---------FEV-RFLD---
K5BUT9          -----GIL------------------R-DT--PLYAES-P---------VDV-HFID---
A0A174FPA3      -----GIL------------------R-DA--PLYAES-P---------VEV-HFID---
R6S9Y6          -----GIL------------------R-DA--PLYAES-P---------VEV-HFID---
C9KX15          -----GIL------------------R-DA--PLYAES-P---------VEV-HFID---
A0A3L8AAP1      -----GFF------------------R-NT--SLYAES-P---------VEV-NFID---
R6DAG6          -----GFF------------------R-NT--SLYAES-P---------VEV-NFID---
A0A1G8BVM8      -----DGL------------------R-FK--DLYTSS-P---------IEV-EYMD---
A0A416GGJ1      -----DGL------------------R-HI--ELYTKA-P---------VTV-SFPG---
A0A3D1NQW3      -----DGL------------------R-PQ--DLYGQS-P---------IAV-EFIN---
B0MT10          -----DGL------------------R-PQ--DLYGQS-P---------IAV-EFIN---
R7JGW9          -----DGL------------------R-PQ--DLYGQS-P---------IAV-EFIN---
A0A0E2M2Y7      -----GFW------------------R-HE--SLYGKS-P---------VSI-RITD---
A0A0K2J6Z0      -----GFW------------------R-HE--SLYGKS-P---------VSI-RITD---
B2RKZ8          -----GFW------------------R-HE--SLYGKS-P---------VSI-RITD---
A0A212GC82      -----GFW------------------R-HE--SLYGKS-P---------VSI-RITD---
A0A254MU12      -----GFW------------------R-HE--SLYGKS-P---------VSI-RITD---
R6CQ93          -----KGL------------------R-MN--ELYNLS-P---------VQV-SFFN---
A0A3D2BF46      -----HGL------------------R-TE--NLYRRS-P---------IDV-TFID---
A0A358R538      -----DRL------------------R-AR--DLYGQS-P---------LRV-RFID---
A0A1Y4AAB8      -----SGL------------------R-TQ--DLYGRS-P---------IEA-DFVD---
A0A1Y3WWY9      -----EHL------------------R-DR--DLYGQS-P---------IDV-DFIN---
A0A1Y4U5L4      -----EHL------------------R-DR--DLYGQS-P---------IDV-DFIN---
A0A1Y3VCJ1      -----GRF------------------Q-DR--DLYGQS-P---------VEV-VFVN---
A0A1Y3QTW7      -----DGL------------------R-TL--DLYGRS-P---------IEV-DFID---
R6XWY7          -----DGL------------------R-TL--DLYGRS-P---------IEV-DFID---
A0A174AVF1      -----DGL------------------R-TL--DLYGRS-P---------IEV-DFID---
A0A373HTL7      -----DGL------------------R-TL--DLYGRS-P---------IEV-DFID---
A0A1Q6EIY0      -----EGL------------------R-TA--DLYGRS-P---------IEV-DFIN---
E4M8L3          -----EGL------------------R-TA--DLYGRS-P---------IEV-DFIN---
I3YQ50          -----EGL------------------R-TA--DLYGRS-P---------IEV-DFIN---
R5UEY8          -----EGL------------------R-TA--DLYGRS-P---------IEV-DFIN---
A0A1H4D866      -----ERL------------------R-RR--DLYAQS-P---------VEV-TFVN---
A0A374A9J5      -----DGL------------------R-RR--DLYGQA-P---------IDV-KFIN---
A0A1Q6E9S3      -----DGL------------------R-RR--DLYGQA-P---------IDV-KFIN---
D4IJ36          -----DGL------------------R-RR--DLYGQA-P---------IDV-KFIN---
A0A414Q925      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A415PUS9      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A108TCU0      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A413BA42      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
S3Y344          -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A413MY74      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A412TGL3      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A413VJ33      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A414L0W6      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A412DP39      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A413ZSE8      -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
B0NP84          -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
R6AK43          -----DGL------------------R-KK--ELYTST-P---------FAV-TFLD---
A0A412N2D9      -----DGL------------------R-KK--ELYTST-P---------FTV-NFLD---
R6LHA4          -----DGL------------------R-KK--ELYTST-P---------FTV-NFLD---
A0A1Q6FL18      -----DGL------------------R-KK--ELYTST-P---------FTV-NFLD---
A0A1Y4JYS9      -----DGL------------------R-KK--ELYTST-P---------FTV-NFLD---
A0A3E5HPT8      -----DGL------------------R-PR--ELYTDS-P---------VRV-AFLE---
C6IJ48          -----DGL------------------R-PR--ELYTDS-P---------VRV-AFLE---
Q8A3U2          -----DGL------------------R-PR--ELYTDS-P---------VRV-AFLE---
A0A3R6S1H6      -----AGL------------------R-EI--ELYKES-P---------VVL-RFPD---
A0A3R6SD81      -----AGL------------------R-EL--ELYKES-P---------VVL-RFPD---
A0A413VXJ7      -----EGL------------------R-NK--ELYTHS-P---------IIL-SFPE---
I9RSN9          -----EGL------------------R-NK--ELYTHS-P---------IIL-SFPE---
U6RJK5          -----EGL------------------R-NK--ELYTHS-P---------IIL-SFPE---
A0A1Q6GA32      -----EGL------------------R-NK--ELYTHS-P---------IIL-SFPE---
I9RPU6          -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
I8Y597          -----NGL------------------R-ED--ELYTHS-P---------ITV-LFPE---
I8YFS5          -----NGL------------------R-ED--ELYTHS-P---------ITV-LFPE---
A0A1Q6GBF5      -----NGL------------------R-ED--ELYTHT-P---------VTV-SFPE---
I8YFZ3          -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
A0A1Q6GDH2      -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
U6RSB0          -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
I9SIK1          -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
I9GXM2          -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
I9TP59          -----NGL------------------R-ND--ELYTHA-P---------VTV-SFPE---
A0A0J6CIR2      -----DGL------------------R-TE--ELYTQS-P---------IAV-RFPE---
A0A3D8HG59      -----RGL------------------R-TT--ELYTQS-P---------VHL-EFPD---
A0A3R6S408      -----RGL------------------R-TT--ELYTQS-P---------VHL-EFPD---
A0A354WXN6      -----EGL------------------R-TV--DLYTQS-P---------INL-TFPE---
R5IP14          -----GGL------------------R-DR--SLYKDS-P---------LAV-SFIT---
A0A316SZX7      -----MGL------------------Q-TI--DLYRNT-P---------IEV-SFVD---
A0A1Y4AIY1      -----RGL------------------R-TV--ELYRQS-P---------VIL-SFPD---
F3ZRU7          -----QGL------------------R-KK--DLYGNN-P---------FEV-VFLE---
A0A1C5Q1F3      -----GKF------------------R-DW--DLYTTS-P---------VTL-TFPE---
R7A239          -----GKF------------------R-DW--DLYTTS-P---------VTL-TFPE---
A0A1M6K7I9      -----IGL------------------R-TI--ELYTQS-P---------IKV-AFPD---
A0A3R6HIK7      -----RGL------------------R-MV--ELYTHS-P---------VVL-SFPE---
K5ZVW7          -----RGL------------------R-TV--ELYTHS-P---------VVL-SFPE---
A0A1Y4D5Z0      -----QGL------------------R-TV--ELYRES-P---------VVL-SFPE---
R5S343          -----RGL------------------C-TV--DLYGIS-P---------IRV-RFLD---
A0A3R5ZMK1      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A3E4ZTK7      -----EGL------------------R-TV--ELYTQS-P---------VLL-SFPD---
A0A1Y3ZIA4      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
K5Y1A4          -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A3R6K8X4      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A1Q6I3T6      -----DGL------------------R-MV--ELYTQS-P---------VQL-SFPD---
A0A414XX40      -----DGL------------------R-MV--ELYTQS-P---------VQL-SFPD---
A0A412DM15      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A7AEU7          -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A415BDM7      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A3R5ZYK4      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A414GI87      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A3R6BKI7      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A414LPI6      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
A0A412M2W1      -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
K5ZX55          -----DGL------------------R-TV--ELYTQS-P---------VQL-SFPD---
K5ZBN2          -----EGL------------------R-TV--ELYSHS-P---------VVV-RFPE---
A0A0J6CKW3      -----EGL------------------R-TV--ELYSHS-P---------VVV-RFPE---
A0A0F5IQM7      -----EGL------------------R-TV--ELYSHS-P---------VVV-RFPE---
S0GLB0          -----EGL------------------R-TV--ELYSHS-P---------VVV-RFPE---
A0A3R6NLC1      -----EGL------------------R-TV--ELYSHS-P---------VVV-RFPE---
A0A416WYC9      -----EGL------------------R-TV--ELYSHS-P---------VVV-RFPE---
A0A0F5IT40      -----DGL------------------R-TE--ELYTQS-P---------IAV-RFPE---
S0GSI7          -----DGL------------------R-TE--ELYTQS-P---------IAV-RFPE---
K5YB65          -----DGL------------------R-TE--ELYTQS-P---------IAV-RFPE---
A0A0F5IWP9      -----EGL------------------R-TV--ELYTQS-P---------IAV-QFPE---
A0A0F5IZT8      -----EGL------------------R-TV--ELYTQS-P---------IAV-QFPE---
A0A417LKQ2      -----EGL------------------R-TV--ELYTQS-P---------VAV-QFPE---
A0A416TME1      -----DGL------------------R-TV--ELYTQS-P---------VAV-QFPE---
A0A416XPE8      -----DGL------------------R-TV--ELYTQS-P---------VAV-QFPE---
L8JI02          -----KES------------------F-RA--EEKYGDFP---------FIV-ELDS---
A6EBM4          -----YER------------------L-LQ--TDLYPQQP---------LQI-DILK---
A0A2N3U785      -----GHI------------------K-TE--EIYGSSLP---------IKV-VVSD---
A0A0E3ZG78      -----GRV------------------N-DI--EIYGSEVP---------IKV-LVND---
A0A1I6BRK6      -----ERI------------------T-DR--EIYGEALP---------FRI-VRNG---
A0A243WAB1      -----GKF------------------V-NR--EIYGRELP---------AKL-LIDK---
A0A399SH26      -----DTK------------------F-KE--VAAYTSSP---------VIV-THYN---
A0A0E3ZGV6      -----ETK------------------L-RS--VPAYTSSP---------ITI-TLKD---
A0A1I2N4S1      -----EDR------------------F-KS--IPAYNTSP---------ITI-SLKS---
A0A2T5YE44      -----EDR------------------F-KS--IPAYTTSP---------ITI-SLKS---
A0A1M4YED3      -----ETQ------------------W-GL--RSAYNTSP---------VKV-IAQN---
A0A3P1Z8V4      -----EGL------------------H-NV--ALYR-DRP---------FTV-HFDR---
A0A2L2WX98      -----ESL------------------H-EV--SLY-RNRP---------FRI-EFSS---
G5GD56          -----AGL------------------H-SV--ALY-TDRP---------FEI-AFQQ---
R6A0L2          -----EKL------------------H-SI--TLYGKELP---------FQV-LFQK---
R7LG80          -----VSL------------------H-KV--ALYKNERP---------IEV-LFHD---
A0A1M6XHU0      -----GA------------------------------KER---------FPI-LAP----
D0MHQ9          -----GA------------------------------KDR---------FPI-LAP----
G2SF81          -----GA------------------------------KDR---------FPI-LAP----
A0A2H3NSN0      -----D-------------------------------T-P---------FQL-FAA----
A0A2P6C324      -----QG------------------------------V-Q---------FTL-LAP----
A0A126PFG0      -----RQH------------------V-L---------------------DI-VLKD---
A0A3M1N7Z3      -----RAE------------------S-LF--WQ---GGR---------VRV-IFDA---
R7PCR1          -----FDS------------------E-FN--YKGTFGRP---------FST-PVG----
A0A2A8CVM9      -----EE------------------------------KGK---------FPL-LYG----
A0A3C0ZQC7      -----STN-----------------------------SER---------ILI-IWD----
A0A2E3R1D0      -----GT------------------------------NRP---------LPI-LRD----
A0A2T2USC0      -----YT------------------------------GEQ---------LSV-LTGP---
A0A2T2V0F3      -----RT------------------------------GEP---------LAV-LTG----
A0A2T2S682      -----RT------------------------------GKP---------LDV-LTT----
D5H561          -----RVL------------------S-SQ--GVSPFGRL---------MDR-AWA----
A0A2H3NWA9      -----EG------------------------------EGP---------PIM-YTA----
A0A2A8CVB6      -----ET------------------------------GRP---------IQM-LSD----
A0A2P6C1S6      -----DT------------------------------GQP---------LQI-LRG----
A0A2T2UTM4      -----ET------------------------------GEP---------LQI-LRG----
A0A1T5MMH4      -----GEV------------------L-NH--ELFGNS-P---------ILV-S-YK---
A0A2W4R1L8      -----GEI------------------L-NY--EFFGNL-P---------FTV-D-YT---
A0A2E5CV79      -----NRR------------------N-SL--ALFNTR-K---------YYP-RGEK---
A0A2A4G4B1      -----NSF------------------K-NT--ELFLDK-P---------FKL-EWLS---
A0A2D4ZVH1      --------------------------------DQYGNKFP---------ILW-RAYP---
A0A0E3V905      -----TTF------------------G-KR--EIYTDS-P---------IEL-I-VE---
A0A1M6GR99      -----KNY------------------Q-YY--NAYNES-P---------FKV-FIFK---
A0A1M5BA90      -----GPI------------------V-SR--SAYTSS-P---------VTI-E------
A0A1V9F098      ------KI------------------K-PT--SAYNSS-PVT-------IIA-RKPD---
A0A1V9FHD0      -----LKM------------------H-AT--SAYLSS-PIT-------IVA-QDPD---
A0A1T5CS78      -----GRI------------------K-AI--SAYTSS-P---------IKV-IVKE---
A0A0Q9Z8F1      -----AGI------------------K-TI--SAYTSS-P---------IKV-IVED---
A0A2N0U0M7      -----TGI------------------K-TI--SAYTSS-P---------IRV-IVQD---
A0A1M6TTV4      -----GRS-----------------HL-SD--ERYGNS-P---------FQV-L-YN---
A0A1Q6IT42      -----KNF------------------F-KKK-EYYRNS-P---------FTV-DIPE---
K0X1U5          -----KNF------------------F-KKK-EYYRNS-P---------FTV-DIPE---
A0A416XAH0      -----KNF------------------F-KKK-EYYRNS-P---------LTV-EIPE---
R5EXK3          -----KNF------------------F-KKK-EYYRNS-P---------LTV-EIPE---
A0A401UAP7      -----GEF------------------L-DY--ELYKNS-P---------FKV-TPIE---
A0A1W2GF52      -----GRS-----------------HL-VD--ERYGNS-P---------FEV-Q-YD---
A0A2G5L7B8      -----GRS-----------------HL-YD--ERYGNS-P---------FIV-D-VQ---
A0A0D3LFR6      -----GKI------------------L-DD--EKYRSA-P---------FKV-D-YL---
M7N6D4          -----GKI------------------L-DD--EKYRSS-P---------FEV-S-YL---
A0A364XUP5      -----GEL------------------L-NH--ELFGNT-P---------YHI-E-YK---
A0A1M5RLA9      -----GRV------------------L-ND--ELFQNA-P---------FLV-R-YK---
A0A385SFR9      -----GRV------------------L-ND--ELFQSA-P---------FVV-R-YK---
L8JW09          -----GQV------------------L-ND--EKFKTS-P---------FIV-D-YN---
A0A1Q3ZMZ7      -----GSI------------------L-TS--QIYQSS-S---------LGY-KSLL---
A0A2D8JJW3      -----DYK------------------------LIFKYK-E---------DKK-DTVS---
A0A2W2AFF7      -----GRV------------------K-KT--PLYEDV-P---------FHF-VFIP---
A0A2N5YXE2      -----GTF------------------L-YT--ELYGNT-P---------FEV-N-YR---
A0A2I0QZ80      -----GEF------------------L-TE--QRYRQG-N---------LEI-SPLL---
A0A2U2XBJ3      -----GEF------------------L-TE--TLYKQG-V---------VRI-MPLI---
A0A3E1F1A3      -----GEF------------------L-TE--TLYKQN-S---------VSI-DPVL---
A0A1V9F383      -----GKF------------------N-ET--SAYVSS-PVS-------IVA-KDPD---
G8TRZ6          -----WKF------------------N-ET--SAYISS-PVS-------IVA-RNPD---
A0A2W1NDY9      -----GEV------------------L-IE--EKFKQS-P---------YHL-IFYE---
A0A1G0CI31      -----GRI------------------L-TE--EKYLQS-S---------FNV-QPFQ---
F2IKD6          -----GKI------------------L-TE--EKYHQN-T---------FTI-LPYS---
A0A1I7BM74      -----GEF------------------L-TE--ERYTQS-Q---------FQV-QLFK---
A0A2G2FJ17      -----GDV------------------L-TE--KRYKQS-T---------FYI-KQSH---
A0A416X8R7      -----NWL------------------H-YD--QLYAES-P---------IRV-N------
K0XJ09          -----NWL------------------H-YD--QLYAES-P---------IRV-N------
R5EUZ0          -----NWL------------------H-YD--QLYAES-P---------IRV-N------
W0EQS0          -----DWL------------------H-YK--SLYAES-P---------IRV-N------
A0A1Y3WE15      -----DFL------------------H-NK--QLYAES-P---------IRV-D------
A0A1Y4GUK3      -----DFL------------------H-NK--QLYAES-P---------LRA-H------
A0A2U1FKU2      -----GFW------------------R-KE--SLYANS-P---------LSI-KITN---
A0A0A2F954      -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
A0A0A2FW91      -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
A0A2D2N2N1      -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
Q7MWZ2          -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
T2NDT6          -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
W1R7P9          -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
A0A1R4AFZ0      -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
A0A1R4DVZ7      -----GFW------------------R-NE--SLYGNS-P---------VSI-QITD---
A0A1G9E2A9      -----GDV------------------V-NS--EAYHDS-P---------FRV-E-YK---
A0A2T2YJE8      -----GNV------------------L-NE--ELYKNS-P---------FKI-T-YQ---
A0A3M9N829      -----ARV------------------L-DA--ELYKDS-P---------FAV-N-YD---
A0A0P0CSF9      -----ARV------------------L-DA--ELYKDS-P---------FQV-S-YD---
A0A3M9MNC3      -----ARV------------------L-DA--ELYKSS-P---------FEV-V-YD---
A0A2M6GH67      -----GNV------------------L-NE--ELYNNA-P---------FKI-D-YE---
A0A127B287      -----ARI------------------L-EV--ELYKDS-P---------FKV-A-FD---
A0A369QP10      -----GNI------------------L-NE--ELYRSS-P---------FHI-S-YE---
A0A418R9X5      -----GTV------------------L-ES--ELYSLS-P---------VRI-E-YK---
A0A428JSJ3      -----GTV------------------L-ES--ELYNLS-P---------VRV-E-YT---
A0A428KI59      -----GTV------------------L-ES--ELYNLS-P---------VRV-E-YK---
W8F1I6          -----GTV------------------L-ES--ELYNLS-P---------IRV-E-YK---
A0A246FQC0      -----GTV------------------L-ES--ELYASS-P---------FIV-K-YK---
A0A372E5P8      -----GTV------------------L-ET--EIYGAS-P---------FEV-S-YE---
A0A1H3EMW1      -----GTV------------------L-ET--EIYGIS-P---------FEV-S-YQ---
A0A1H9ZSN3      -----GTV------------------L-ET--EIYGSS-P---------FEV-S-YE---
A0A0M3RW20      -----GTV------------------L-ES--ELYKAS-P---------FHI-E-YA---
A0A1S9B3W0      -----GTV------------------L-ET--ELYGVS-P---------FHV-T-YT---
A0A1W1VRL3      -----GTV------------------L-ES--ELYTRS-P---------FQV-T-YK---
A0A1M6R305      -----GTV------------------L-ET--ELYGVS-P---------FRV-D-YE---
A0A2M9B9H9      -----GTV------------------L-EN--ELYGIS-P---------FKV-S-YD---
A0A126PDF2      -----GTV------------------L-ES--ELYGIS-P---------FQI-A-YT---
A0A2Z3GKA1      -----GTV------------------L-ES--ELYGIS-P---------FRI-A-YT---
A0A328BL48      -----GTV------------------L-ET--ELYRTA-P---------FRV-E-YA---
A0A3S0QKV1      -----GTV------------------L-ET--ELYGNS-P---------FRV-E-YT---
A0A3R9P8H7      -----GTV------------------L-ET--EMYNTS-P---------FKV-V-YT---
A0A212UCJ7      -----GTV------------------L-ET--ELYRAS-P---------FKV-E-YQ---
A0A238WIA7      -----GTV------------------L-ET--ELYKTS-P---------FKV-E-YE---
A0A0W8EDI5      -----GTV------------------L-AS--ELYNAT-P---------FRI-D-YD---
A0A3B7RBP8      -----GTV------------------L-AN--ELYTDT-P---------FRV-Q-YS---
A0A1I5WSL8      -----GTV------------------L-EA--ELYGTS-P---------FKV-I-YK---
A0A0U3JVM7      -----GTV------------------L-ES--ELYGIA-P---------FRV-K-YH---
A0A1G1SSV2      -----GTV------------------L-ES--ELYGTS-P---------FRV-K-YN---
A0A1G1SXV7      -----GTV------------------L-ES--ELYRTS-P---------FRV-K-YS---
A0A243WHR7      -----GTV------------------L-EN--ELYGLS-P---------FKV-N-YK---
A0A076HRT9      -----GTV------------------L-ES--ELYGTS-P---------FRV-Q-Y----
A0A1M6DHW8      -----GTV------------------L-EN--ELYGTS-P---------FEV-E-YR---
A0A3D1KEX9      -----KGL------------------Q-PV--TLFKHN-P---------IKV-E------
A0A358Y7S2      -----GTI------------------L-TQ--NLYRET-G---------FSL-MVYS---
A0A1X7J248      -----GRF------------------K-DD--ERYRFT-P---------FTV-S-YD---
E4TQD2          -----GRF------------------K-NE--ERYRFS-P---------FTV-S-YE---
A0A2J6HHN3      -----GNI------------------L-NS--ELYKSA-P---------FKV-Y-YE---
A0A1Y3WMT8      -----KNF------------------F-NK--VEYYGNSP---------ITV-DVPE---
A0A1Y4GQU1      -----KNF------------------F-SK--KEYYGNSP---------ITV-DVPE---
A0A1V5W8T5      -----GKF------------------L-TS--ELYNKT-P---------FFV-E-YQ---
A0A2T8HKA9      -----EGL------------------R-NI--ELYKDS-P---------IRV-TFTK---
A0A3B8INU3      -----GKI------------------L-DD--EKYKES-P---------FEA-T-IT---
A0A098LL25      -----GNI------------------L-YE--ERYNNS-P---------FKV-I-GE---
A0A1Q3Q573      -----GKS------------------K-FITEDLYQSA-P---------FEI-L-PE---
A0A357YNR3      -----RPLSLLARFGLKDNVPSFLIIK-SN--SLYGNESP---------VLV-R-MS---
F4KK08          -----AGL------------------R-EK--DLYKQS-P---------VSI-RFVN---
A0A3N2N6F7      -----KRL------------------R-PV--SLYGDSMV---------LSV-SLPD---
A0A419VXB7      -----MPL------------------G-DF--ILYGNE-PCHVEFEPDAFNL-KGVP---
A0A2V1ILM4      -----HNL------------------K-NI--TLYGDSCP---------VSV-NFLS---
A0A3N2L0E8      -----HNL------------------K-NI--TLYGDSCP---------VSV-DFLS---
A0A3N2LFC5      -----HNL------------------K-NI--TLYGDSCP---------VSV-DFLS---
C3J7R8          -----RGI------------------R-TE--MLYKDT-P---------LEV-R-FV---
A0A0B0BTJ4      -----SKL------------------R-YS--YLTAESSP---------LKL-TADT---
A0A3B9CNN6      -----SKL------------------R-YS--YLTAESSP---------LKL-TADT---
R5X290          -----SKL------------------R-YS--YLTAESSP---------LKL-TADT---
A0A1Q6E6I7      -----SKL------------------R-YS--YLTAESSP---------LKL-TADT---
A0A2G2F510      -----GNV------------------L-TE--EKYLSS-S---------YYI-QPYE---
A0A316JZ08      -----GKL------------------L-TE--ELYLAS-S---------FNI-QPYE---
A0A1I1FXP9      -----GNF------------------V-FS--EMYKSS-P---------FRV-E-YE---
A0A3B9FXJ0      -----GRI------------------R-NT--DMYYNG-P---------FWV-D-ID---
R5GSU5          -----NGL------------------G-QS--TLYKKR-P---------FEA-T-FL---
A0A2P8EAX2      -----IGI------------------F-KR--EISPYNVS---------INI-VVHE---
A0A3N4H5N3      -----IGF------------------F-KK--EISPFSLP---------VEI-EVHE---
A0A2A3UE91      -----GVF------------------K-NN--ELYDSS-P---------YLI-K-IN---
A0A0A2G557      -----EGL------------------R-SK--KLYKET-P---------IRL-T--L---
A0A2N2WFW8      -----GNI------------------L-NF--ELYDGA-P---------FHI-Q-YQ---
A0A1F3IU95      -----GNI------------------L-NF--ELYDDV-P---------FDI-K-YE---
A0A3D0VUF6      -----GNI------------------L-NF--ELYDDV-P---------FDI-K-YE---
A0A1T4PT95      -----EGI------------------S-SK--KLYKDS-P---------IHL-TLLE---
A0A3Q9FR88      -----GDV------------------R-DS--ELFGDAVP---------FTF-EYPN---
A0A150ADJ9      -----GEI------------------R-DS--ELFGKNLP---------FSI-TFPS---
A0A1B1FWQ4      -----GDV------------------R-DS--ELFEDGVP---------FTL-TYPS---
A0A1S1Z228      -----GDV------------------R-DS--ELFGDGVP---------FTL-TYPS---
A0A1F3SJM1      -----GKI------------------L-TE--EKYLSS-S---------FHV-QPYE---
A0A2G2EB96      -----GQI------------------L-TE--EKYLSS-A---------FNI-QPYQ---
A0A2G6PRA9      -----GEI------------------L-TE--EKYLSS-S---------FNI-QPYE---
A1ZKR2          -----GNI------------------L-DA--EYYKNP-P---------FKV-IDHQ---
A0A1Q3GX01      -----GNI------------------L-EA--EYYTNA-P---------FKV-VDYK---
A0A349DQI4      -----GNI------------------L-EA--EYYTNA-P---------FKV-VDYK---
A0A2N3IIZ0      -----GRI------------------L-DN--EMHGFS-P---------IEV-Q-AV---
A0A2A4PYG9      -----GKI------------------L-DS--EIYTAS-P---------YTV-E-VR---
A0A2A5FYT6      -----GQV------------------M-AT--ENYANH-P---------YSV-G-FQ---
A0A2E6SYP1      -----GKF------------------L-NT--ENYRSS-K---------YKI-S-YQ---
A0A2E5RLE8      -----GKF------------------L-NT--ENYHSN-P---------FSI-S-YQ---
A0A2E7TQF6      -----GKF------------------L-NT--ENYHSN-P---------FSI-S-YQ---
A0A2E6GVY9      -----GKF------------------L-NT--ENYQSN-P---------FSI-S-YQ---
A0A350JJ90      -----GEV------------------L-NH--ERYLSS-D---------FEV-I-YE---
A0A3M1CDV2      -----GTF------------------K-NH--ELYKNS-P---------YLA-D-IN---
A0A2E2TFD1      -----GEL------------------L-NY--ELYMSS-P---------YIV-D-YD---
A0A2E4ELE6      -----GEF------------------L-TF--EHYKSC-P---------FEV-K-FE---
A0A2E3XZI5      -----GEI------------------I-SR--LLYKKN-T---------YKL-ENFY---
A0A2M7NLQ9      -----GRW------------------W-FNYFERFQDS-P---------FEV-TEYE---
I4AFR0          -----GRW------------------W-FNYFERFQDS-P---------FEV-TDYE---
A0A2N2Y3E5      -----GTF------------------L-ET--EQYRNS-P---------FTV-V-FR---
A0A2D9D7T6      -----GKL------------------L-TK--DLYRSN-L---------VSV-EPVK---
A0A1F3PPL5      -----GTF------------------L-SN--EMYKSS-P---------FEV-K-VK---
A0A357QK06      -----GTF------------------L-SN--EMYKSS-P---------FEV-K-VK---
A0A2A5B3B0      -----GEI------------------L-IN--ELYRST-P---------IKV-S-YV---
A0A0F2NS19      -----GKI------------------L-EY--ELYKNS-P---------FKV-F-FE---
A0A2A5H8X6      -----GKI------------------L-EY--ELYKNS-P---------FKV-F-FE---
A0A2H0GAU8      -----GNF------------------L-NN--ELYVGS-P---------MKV-N-YA---
A0A2M8FTK1      -----GNF------------------L-NN--ELYVGS-P---------MKV-N-YA---
A0A0S2HYK8      -----GAF------------------L-SD--EIYQSS-P---------FEI-Q-YK---
A0A2N5ZWN6      -----GAF------------------L-ST--ETYNNS-S---------YSV-N-YE---
A0A2E0FJ09      -----GKI------------------L-KH--EKYNGS-L---------FLV-EDFQ---
A0A1F3FZ62      -----GRI------------------L-NF--DVYRNT-P---------FII-E-QK---
A0A1F3K211      -----GRI------------------L-NF--DVYRNT-P---------FII-E-QK---
A0A1F3KLL5      -----GTF------------------L-ST--ETYRTS-S---------YII-EVRN---
A0A359D1M1      -----GTF------------------L-ST--ETYRTS-S---------YII-EVRN---
A0A2E7CT70      -----GEI------------------L-TS--DLYKTS-P---------FEI-KDLK---
A0A2D5V560      -----GEX------------------I-TR--FLYNQS-P---------XSF-ENFS---
A0A2D7K5A8      -----GEI------------------L-TR--FLYNQS-P---------FIF-ENFS---
A0A2E1XQ82      -----GEI------------------L-TR--FLYNQS-P---------FIF-ENFS---
A0A1V6I2U9      -----GTF------------------L-ST--ELYGST-P---------FEI-K-YN---
A0A1F3C1M2      -----GTF------------------L-KN--ELYKNA-P---------FTI-E-FN---
A0A1F3DS87      -----GTF------------------L-KN--ELYKNE-P---------FSI-E-FN---
A0A2H0B957      -----GTF------------------L-VS--ELYKAT-P---------FTV-D-FH---
A0A1F3CFW6      -----GTF------------------L-EN--ELYKAN-P---------FSI-D-YK---
A0A2M7E2T8      -----GTF------------------L-EN--ELYKAN-P---------FSI-D-YK---
A0A2M7NC69      -----GTF------------------L-EN--ELYKAN-P---------FSI-D-YK---
A0A1F3K695      -----GTF------------------L-TN--ELYRMS-P---------FTV-E-AN---
A0A353KZR1      -----GTF------------------L-TN--ELYRMS-P---------FTV-E-AN---
A0A2N2WYB5      -----GTF------------------L-ST--ELYKRS-P---------FKV-E-WK---
A0A1F3K4G0      -----GTF------------------L-ST--ELYRRS-P---------FQI-E-WK---
A0A356H8Y3      -----GTF------------------L-ST--ELYRRS-P---------FQI-E-WK---
A0A351HSA6      -----GTF------------------L-ST--ELYRRS-P---------FQI-E-WK---
A0A1F3Q014      -----GTF------------------K-NN--ELYTSS-P---------YSV-D-YK---
A0A2A4YXP3      -----GEI------------------L-TN--ELYRSS-P---------IKV-E-HQ---
A0A2D5KD44      -----GQF------------------L-RN--EIYKNA-P---------FNV-E-VL---
A0A1F3R158      -----GKF------------------L-TF--ELYKNS-P---------INI-E-YY---
A0A2M8ADX2      -----GKF------------------L-TF--ELYKNS-P---------LDV-N-YD---
A0A1J5B2H0      -----GRL------------------L-NF--ELYKSS-P---------FEI-K-YS---
A0A1V5N756      -----GRF------------------L-NT--EMYRSN-H---------YNV-H-YV---
                                                                            

A0A1I3J6V0      ------------------------------------------------------------
A0A1H4ADG3      DNLDPSQLSYE------FTLNGKSGFTVSS--------------DKHVWKGKW-------
A0A3D5KRY6      PSDFIQLENVP------IHIKIISKTKYEISCDEKIRIGGWSKHIQFHKEQTL-------
A0A1V5IPN7      ------------------------------------------------------------
A0A1V3WH52      PKGAGDQTFTL------TVLGPKQYQLTSD--------------AGFSARGEV-------
A0A2K8Z965      EQPISALYKSP------LDITLPGDNTVTI----------------NEHVYPL-------
A0A418M8U8      EFGKPELYEEP------MLLTFIDSSSVEI----------------NEQVYPL-------
I2GTA4          EFGKPELYEAP------MLLTFIDSSSVEI----------------NEQVYPL-------
A0A2K8ZAJ2      EKPTSQLYMEE------LKFLFVDSKMVKL----------------NGHMYPV-------
A0A368JPA3      TDPTPNLYRAD------LEIGIISPTTVRL----------------NDWVYPA-------
A0A3P1BT12      KEPTANLYRAD------LEIGIISPTTIRL----------------NDWVYPA-------
A0A3P1CI15      SDPTPNLYRAD------LEISIISPTTVRL----------------NDWVYPA-------
A0A1Q3PII2      LKPRTAKPTTY------HIERRTGNTFTVR----T---------PSNIYKGTF-------
A0A351BXT2      FKIDEDKKKFY------YILNHGENEDVTA------------------------------
A0A3D0MYJ7      IKNKEN------------------------------------------------------
A0A3D3LS70      FKNSDSKTDFY------YLINRNKKVNSEH------------------------------
A0A1G7ZF38      LKSRPAKPESY------LIIRETDSTFRLQ----T---------SDHYYKGSF-------
C6VS52          IQKQPPRPETY------HIVRQAGDFYIIE----I---------SGSRFRGRF-------
A0A1G1TM36      LHTLRGQHVLN------IVLQDTASFAVRA----A---------DGTLTRHAF-------
A0A1V3WH27      PQVEGNAQELT------LTVQEAGKYHLTGENIEA---------DGQVGKTLV-------
A0A0D3L8Q3      --LDSLAYGKV------IKVHLKGNNSYDIEYNE-----------------------KIS
A0A0K8QSK7      --SHPQMIGTR------IRLTFAGDG-K-IRYQ-------AEGENVRVHDFVTGENIRTI
A0A1V6CN82      --NHPQLIGFD------FRISVHPDR-S-ITLS-------GFGEGVGVYNYSENRGAGYF
A0A1M4XZ45      --DHPQIINAD------FYLTIQPDG-K-LRVE-------MDQEDVAVYNYLDEKIVERL
A0A399D319      --EHPQVIDAD------FFLTIEPNG-K-LKID-------MEEEVISAYSYTEEEVVKRI
A0A0P7X1V8      ------------------------------------------------------------
A0A3B0C2S4      --DSIGQP-RV------YDISLDAFEARITNMDGATTVVGLAEKD---------------
A0A416GA42      ---GDDLA-CS------FRLRLLPGR-K-VELSQLKYQA-QELTE------------TKT
A0A3N2M1H3      --IEEQGG-AS------FKMELSADG-N-IKMREFRKFTIDGKIE--LAGEATLPKG---
A0A1T3IYP5      --KTQESS-YS------FIITPFDSK-T-VILKGWD----QSGKD-------------VK
A0A212K7W5      --TNVNES-FS------FYIELLPQN-K-IRLANLT----LNGEE--LDFP------DEE
F5IU11          --VNVNES-FS------FQIELLSQN-K-IRLSDLI----LNGEE--LDFT------DKE
A0A352Z1R7      ---STAKT-PS------YRIEMTGAD-T-FTVKDDDDKLVGEGSS---------------
A0A0A2F501      --LKDTDN-AS------LTLTILANG-Q-FAISNLM----LNDNE--LQTQR------IT
R5B7P0          --VDENVG-VG------FTVS-ENGG-R-VTLNDFI----HKNEK--VGGKP------VV
R5B0L5          --LADGES-GS------VIVKINKKG-V-IVLSDLV----LNNIP--VDLPN-----SGV
A0A374THP7      --FTDDQS-GS------FQLQLKGDG-S-YVISKIKGSN-RDNLP--VDDSD-----EIS
A0A3R5XWG1      --IGEEHY-GS------MTVYLKGGD-K-FELTDFKGTS-SNGTP--VETNK-----TVT
A0A414YFM3      --IGEEHY-GS------MTVYLKGGD-K-FELTDFKGTS-SNGTP--VETNK-----TVT
A0A0A2EVS5      --FYGALE-WS------LSVTVRGDG-M-VEVSDMI----LDGEP--MGEGQ-----IFL
A0A1T4NAJ7      --FYGALE-WS------LSLTVRGDG-M-VEVSDMI----LDGEP--MGEGQ-----IFL
A0A2V1IJY1      --FAENGS-AL------FRVEVDGAG-K-VSVSDVK----SGDLK--SEER-------VQ
A0A3N2KCL3      --FAENGS-AS------FRVEVDGDG-K-VSVSDVK----SGDLK--SEER-------VQ
A0A255T941      ---QSKYP-FS------FVIKLNDEH-S-FTLYDFK----MYTEDGKVEYDK-----EVK
A0A1Y4CHN5      --LNDNES-AS------FTIKPAADG-T-LGFSDFV----RNGEE--SDAE-------AT
A0A1Y3V692      ---QDETP-VS------FKIDFSSKE-E-FTISDVM----IDGEE--LETE-------FS
A0A174TYU6      ---QDETP-VS------FKIDFSSKE-E-FTISDVM----INGEE--LETE-------FS
A0A1M6I2S6      ---QDETP-VS------FKIDFSSKE-E-FTISDVM----INGEE--LETE-------FS
F3PXM2          ---KAERP-VA------FDLELTSRN-D-FLLSGFK----VEGEE--TGET-------FS
A0A3E4ZNL4      ---NNKKD-VS------FAIEINGSN-Q-FHLSEFV----VAGEE--TDEQ-------FE
A0A174AHH7      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A174JCE8      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A3E4JMC4      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A412SND6      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A414IEQ9      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A415UKN5      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A0M1W8D8      ---DNKKN-VS------FDIEVDTQN-K-FYLSNFI----VAGKE--TGER-------FE
A0A3R6GKX5      ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A7V4S1          ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
B0NU19          ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
D4V601          ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A0A397WLT5      ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A0A3R6GM96      ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A0A015XH67      ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A0A078RZN2      ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A6L0K5          ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A7ACT5          ---DNKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------FE
A6KY94          ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------LE
A0A173UQR8      ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TEER-------LE
A0A3R6HK75      ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TEER-------LE
A0A412B7D1      ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TEER-------LE
A0A412VNY9      ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TEER-------LE
A0A414LTU9      ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TGER-------LE
I9Q4U4          ---DDKKS-VS------FDIEVGAQN-K-FYLSNFI----VAGEE--TEER-------LE
A0A373ISF0      ---VMEKP-VS------FTIRIDSKD-A-FTISGLK----VAGVE--SENT-------FA
U6RF62          ---VMEKP-VS------FTIRIDSKD-A-FTISGLK----VAGVE--SENS-------FA
A0A073I794      ---LNEKS-VS------FTIDILSKD-T-FAISDME----VNGKA--FGED-------FS
A0A108TH71      ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
I8VXH0          ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
A0A412S0N6      ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
A0A412IIJ0      ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
A0A0P0FM97      ---KTEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
R6KTP3          ---KTEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
A0A139LU87      ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
A0A1C6B3Y5      ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
E2NMQ4          ---KIEVP-LS------FTIKFSSKE-A-FAISELE----ISGED--IGET-------LS
A0A412YDB9      ---QPEAP-LS------FTIEFSSKD-T-FTISDLK----VSDES--TGET-------FS
R7DY01          ---QPEAP-LS------FTIEFSSKD-T-FTISDLK----VSDES--TGET-------FS
A0A414LGK8      ---QPEAP-LS------FTIEFSSKN-T-FTISDLK----VSDES--TGET-------FS
A0A016E4F9      ---LDEIP-IS------FTINLPSKK-E-FTISDVM----IDGEE--LGID-------FS
A0A413PP50      ---QDETP-VS------FKIDLPSKG-E-FVLSDVM----VNGEK--SGKE-------FS
A0A3A5TI83      ---LDETP-VG------FTIDISSKE-T-FVISDME----VNGKA--FGED-------FS
A0A415NEB6      ---LDETP-VG------FTIDISSKE-T-FVISDME----VNGKA--FGEE-------FS
A7AJ60          ---LDETP-VG------FTIDISSKE-T-FVISDME----VNGKA--FGED-------FS
A0A015UXN7      ---LDETP-VG------FTIDISSKE-T-FVISDME----VNGKA--FGED-------FS
A0A395YYT3      ---LDETP-VG------FTIDISSKE-T-FVISDME----VNGKA--FGED-------FS
A0A415IPQ4      ---KIEVP-LS------FTIEFSSKE-A-FTISEFE----ISGES--IGET-------FS
A0A3E5BRW7      ---KVETP-LS------FTIEFSSKD-M-FTISEFE----ISEES--TRET-------FS
K9DXS6          ---KVETP-LS------FTIEFSSKD-M-FTISEFE----ISEES--TGET-------FS
A0A1M6KFV3      ---KMEAP-LS------FTIEFSSKD-T-FAISEFE----VSGVD--TRET-------FS
A0A1Q6G7L3      ---KVEAP-LS------FTIEFSSKD-T-FAISEFE----VSGVD--TREN-------FS
A0A413H235      ---KVEAP-LS------FTIEFSSKD-T-FAISEFE----VSGVD--TREN-------FS
A0A1M5B2J8      --FPDNQS-AA------FQLHLGKDG-H-YTISDLT----RNGTP--VEG-E------VN
A0A255RCT5      --FPDNQS-AS------FRLHLGTNG-R-YTLYELT----RNGEH--VGG-E------VK
A0A1Y4GLF5      --LPEDET-GS------FTVEIRPGR-S-FGLSDFT----RNGDD--MKSDK------IT
A0A1H3XSC0      --LSENES-VG------FTLQVQPDS-T-VRLSDFT----RNGNE--FDD-E------IS
B3JI46          --LPENES-AG------FTLEIQPDG-T-LYLSDFI----RNGTD--LEEKD------VK
A0A174UR09      --VPENES-AG------FTLEVQPDG-T-LFLSDFI----RNGTE--LDEKD------IK
A6LE40          --LPENES-AG------FTLEVQPDG-T-LFLSDFT----RNGTE--LDGKD------IK
R6NN15          --LADNET-AA------LTVEPAQSK-G-IKLTSFV----HNGEK--V--DG-----EVV
A0A358R8U0      --LTENES-AR------FTLKVRPGG-E-VELSEFV----RNGEE--IPSEK-----VIK
R6WSB6          --LTENES-AR------FTLKVRPGG-E-VELSEFV----RNGEE--IPSEK-----VIK
A0A401LPX7      --LSENES-AT------FELYLAKDG-A-VELSSFT----RNGTE--IENDD-----IVK
A0A3A5Z900      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A3R6I893      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A3R6EGW5      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A285TGL6      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A3A5RFX4      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A1Q6IUW9      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A3R6NPG7      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A413XDP6      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
K6AP24          --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A076IQN8      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A078RYI7      --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
C7XEQ8          --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
D7INX6          --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
K5ZG55          --LSENES-AT------FELHLAKDG-A-VELSSFT----RNGTE--IENDG-----FVK
A0A3N2N9B8      --APADAS-AE------MNVDISPEG-K-ASISEL-----RYAGK--EFKG------TFT
A0A3N2NMI0      --FPTDAS-AT------LELNISADK-K-VTIREL-----KQGEL--KWEE------SFT
A0A359I8H7      --LEEQQC-AG------FRIELGKDG-N-VVLRKFHLET-PDGDE--EIEK------EVK
A0A3N2KA63      --LEEQQC-AG------FRIELGKDG-N-VVLSKFHLET-PDGDE--EIEK------EVK
A0A3B9FAU3      --LGDHES-AA------MQMELQPNG-V-VKLSNF---M-RNGKP--VGSPEV----TVT
A0A3C1E5L7      --LGDHES-AA------MQMELQPNG-V-VKLSNF---M-RNGKP--VGSPEV----TVT
A0A354SN68      --ATSMDN-LS------FEIQLEKGG-K-AILSHF---KGDFGDE--VVNDEEAEMKTIL
A0A0A2DUD9      --LSEQES-AE------CILSQLPSG-E-LQLHSF---V-LNGEK--TEVQD-----PVT
A0A3N2N595      --FSAYGT-LK------FDLMVNGDG-N-VTISGM---K-IGEKD--IIKA------DFS
R5FHS9          --VQDEDV-VK------FTVKM--EG-TRFVLSKF---I-RNKEE--LDGE------DVT
A0A3P1ZBJ5      --LNEEQG-AR------LSINYQQDG-S-FELTGF---E-SANTK--KKDKEL----RIK
A0A413TW79      --LNDMQS-AS------LDVEVKHGN-L-FSIVHV---S---GTD--KAGNQVESDEEVQ
A0A3E5E9M7      --LNDMQS-AN------LDVEVKHGN-L-FSIVHV---S---GTD--KAGNQVESDEEVQ
A0A3E4SK73      --LNDMQS-AN------LDVEVKHGN-L-FSIVHV---S---GTD--KAGNVVESDEEVQ
A0A415GGC6      --LNDMQS-AS------LDVEVKHGN-L-FSIVHV---S---GTD--KAGNVVESAVEVQ
A0A413DBH9      --LNDMQS-AN------LDVEVKHDD-L-FSIVHV---S---GTD--KDGNQVESDEEVQ
G9S1S8          --PDNNES-SA------LTVKILADS-T-VELSDF---I-RNGEE--LPGK------LLK
A0A354M4S6      --PNDNES-SA------LTVKILADS-T-VELSDF---I-RNGEE--LPGK------LLK
R7DH52          --PNDNES-SA------LTVKILADS-T-VELSDF---I-RNGEE--LPGK------LLK
A0A396N3D5      --PDNNES-SA------LTVKILADS-T-VELSDF---I-RNGEE--LPGK------LVK
A0A415ZDP9      --PDNNES-SA------LTVKILADS-T-VELSDF---I-RNGEE--LPGK------LVK
A0A016CWA4      --LPENES-AG------FTLEVRPDS-T-LLLSGF---T-RNGTD--LEGK------DIK
A0A1C6H117      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A415TAH7      --FPENES-AR------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A0M1W0V2      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A139KA16      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A174VQ92      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A1Q6HCG0      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A1Y4JYM9      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A3A5QW67      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A3A5RQE6      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A3A6BP07      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A3E5E153      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A3Q9IP20      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A412WV15      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A413ICP6      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A414KYB9      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A416X133      --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
E5WX00          --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
K0X3P3          --FPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
A0A3A5Z014      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A1M4YZ07      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDGK------DIK
A0A078S3Q8      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A069SJV7      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A3E5DXI5      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A3E5EM98      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A3E5F453      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
I9T3G6          --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A0P0FQW1      --LPENES-AG------FTLEVQPDS-T-LLLSDF---T-RNGTE--LDGK------DIK
C3RFN5          --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A3E4SYU0      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A6LGY1          --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
K5ZSH4          --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A078T2W6      --LPENES-AG------FTLKIQPDG-T-LYLSDF---I-RNGTD--LDEK------DVK
A0A3R6D1V4      --LPENES-AG------FTLKIQPDG-T-LYLSDF---I-RNGTD--LDEK------DVK
A0A3R6EAF7      --LPENES-AG------FTLEVQPDG-T-LFLSDF---I-RNGTD--LDEK------DIK
A0A412MJT7      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3E4WKT5      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3A5YY33      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A078TAH2      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A1E9CFZ7      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A373FYU5      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3A5TZ72      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3A5XBP2      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3A6MEG9      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3E4JP35      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3E4KP40      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3E4NX82      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A3E4XFU8      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A412RG70      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A412TD37      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A413GAA4      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A414M7I4      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
E5UZA2          --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A069SMG6      --LPENES-AG------FTLEIQPDG-T-LYLSDF---I-RNGTD--LEEK------DVK
A0A1Y4PQK7      --LQENES-VG------FTVNVYKDG-H-VQLSDF---VLKGESL--KEVK------PVT
A0A1Y3ZDB3      --IQENDF-AG------FTVNVYKDG-R-VQLSDF---VLKGELL--KEVK------PVT
A0A3A6AAP4      --IQENDF-AG------FTVNVYKDG-R-VQLSDF---VLKGELL--KEVK------PVT
A0A1Y4IH41      --IQENDF-AG------FTVNVYKDG-R-VQLSDF---VLKGELL--KEVK------PVT
A0A1Y4DYA7      --LQDNDV-AS------FTIFPVSGN-KGVELTDF---I-HG-GE--ESDK------RIV
A0A1Y3X4I9      --LLDNEG-AS------LTILPVSGN-KGVELTDF---V-RG-EE--ESGQ------AVK
A0A1Y4FNK8      --LQDNES-VS------FTVNPSSIG-Q-VKLTDF---V-HN-GE--DVDG------EVT
A0A355FD59      --LTDKEN-AK------LTLRVSEDS-T-VVLSDF---V-WGDGS--KSSK------AID
A0A359CEZ9      --LTDKEN-AK------LTLRVSEDS-T-VVLSDF---V-WGDGS--KSSK------AID
A0A353Q7B4      --LTDKEN-AK------LTLRVSEDS-T-VVLSDF---V-WGDGS--KSSK------TID
A0A1M3KVR9      --LADNES-VE------LVIKLLADG-T-FECSDF---T-SDNKD--IANN------VIK
F8X3A5          --LADNES-AE------LIIKLLADG-T-FECSDF---A-CDNKD--IANN------VIK
A0A3C1ITV0      HVGEQPLNSVT------FVAEKEGQS-Q-LTVKDFKING-IKSDA--P---------AQT
R7HN19          HVGEQPLNSVT------FVAKKEGQS-Q-LTVKDFKING-IKSDA--P---------AQT
A0A415EEZ4      --LFNKN--VS------LSVIPLSET-Y-YQIEDFSEDP-DW---------------SVK
A0A060RD97      --SEQSNNPVS------FTVTPKNSE-A-FQLSYIDENE-TRV--------------SIE
A0A350IHV0      --DNHASA-YS------FELTKTGDS-T-FVIKNLRVA-----GE--KMKYKG----KIK
A0A077ENE7      --ISSEGS-YN------FTVIPLDGN-S-VIIKNWNPEN-KDK--------------EIK
T0NN57          --KRAEDS-YS------FVITPIDSR-S-VIIKNWSKNG-NEK--------------EIK
X5K347          --KRAEDS-YS------FVITPIDSR-S-VIIKNWSKNG-NEK--------------EIK
A0A1T5K9D4      --EDNPIGYFT------IKATPRDSK-T-IELDLSSLGQ-K----------------NVV
R5RVP0          --DNNASA-FS------FEIVNEKDS-T-FVIKDLAVV-----GE--TIKHTE----KIT
A0A285T4L1      --VMPERY-IS------FTVTPKNAK-Q-VLLSDFTGIP-AANDK------------TYT
A0A3E5BU42      --VMPERY-IS------FTVTPKNAK-Q-VLLSDFTGIP-AANDK------------TYT
A0A414ZBF2      --AEPGQE-IS------LTATAIDGN-R-ALLSDFVLD---------ENDFDE----VVT
R5KD55          --IPKDET-AS------LHIRLKKDG-S-IKMSEFVKNG-KPQNS--Y---------DLT
A0A174QNT3      --NYPGY--TE------LKVSVVNDK-Q-CRISNIEIEE-ETRDY--D----------KI
R9I0H0          --IYPGF--TE------LTVSIINEK-G-VRISQLEIDG-NAPSY--E----------QV
K5BUT9          --PYNQP--VS------FNITPLNTT-K-FRISDWKVMG-EKGEI--Q---------EQE
A0A174FPA3      --PYNQP--VS------FNITPLNTT-K-FRISDWKVAG-EKGRM--Q---------EQD
R6S9Y6          --PYNQP--VS------FNITPLNTT-K-FRISDWKVAG-EKGRM--Q---------EQD
C9KX15          --PYNQP--VS------FNITPLNTT-K-FRISDWKVAG-EKGRM--Q---------EQD
A0A3L8AAP1      --PYHAY--YR------TKVTPLDVK-N-YTISD------------------------KK
R6DAG6          --PYHDY--YR------TKVTPLDVK-N-YTILG------------------------EK
A0A1G8BVM8      --DVAKQGMFT------ITVTLLKNN-K-AKLTYNISET-RDDGE--IISNDV----VDD
A0A416GGJ1      --MSPNGA-VQ------FKLKMLNLK-E-AQITTLGDA-------------GK----TYK
A0A3D1NQW3      --DNDRQG-FR------FEVSLRPDS-I-VKLNYFEIF----GPD--KQKFKQ----EIS
B0MT10          --DNDRQG-FR------FEVSLRPDS-I-VKLNYFEIF----GPD--KQKFKQ----EIS
R7JGW9          --DNDRQG-FR------FEVSLRPDS-I-VKLNYFEIF----GPD--KQKFKQ----EIS
A0A0E2M2Y7      --RDSTES-YS------FKIDIKDSR-S-FQLSDFKQQK-LNRIS--EI--------KVE
A0A0K2J6Z0      --RDSTES-YS------FKIDIKDSR-S-FQLSDFKQQK-LNRIS--EI--------KVE
B2RKZ8          --RDSTES-YS------FKIDIKDSR-S-FQLSDFKQQK-LNRIS--EI--------KVE
A0A212GC82      --RDSTES-YS------FKIDIKDSR-S-FQLSDFKQQK-LNRIS--EI--------KVE
A0A254MU12      --RDSTES-YS------FKIDIKDSR-S-FQLSDFKQQK-LNRIS--EI--------KVE
R6CQ93          --VLPERY-FS------FVVTPKDET-S-VELSEIEGIP-GAQE-------------TYK
A0A3D2BF46      --DNERQA-LA------FELTPVDNE-K-FSLTKFVNRT-SADSD--KDKDSEIYEVEMT
A0A358R538      --ETEDLS-AE------LTVTPLPDG-R-LRLSDFDDGF-LPKSE--RRT-------QIV
A0A1Y4AAB8      --EGENQS-FS------FRARPLAGGEQ-VELTDFDDGY-ISDEE--RGR-------VVT
A0A1Y3WWY9      --GDDNQS-LS------MTVTPRGEQ-Q-IEISQFQDGF-VSKQE--SRS-------VVT
A0A1Y4U5L4      --GDDNQT-LS------MTITPRGEQ-Q-IEISQFQDGF-VSKQE--SRS-------VVT
A0A1Y3VCJ1      --DNDNLT-LS------LEVTPVDDQ-N-IRLSNFHDPF-ISKQE--SED-------RVS
A0A1Y3QTW7      --DDN-QR-LS------LEVTELEDG-R-IKLADFDDKY-LTKQE--KRR-------VIR
R6XWY7          --DDN-QR-LS------LEVTELEDG-R-IKLADFDDKY-LTKQE--KRR-------VIR
A0A174AVF1      --DDN-QR-LS------LEVTELEDG-R-IKLADFDDKY-LTKQE--KRR-------VIR
A0A373HTL7      --DDN-QR-LS------LEVTELEDG-R-IKLADFDDKY-LTKQE--KRR-------VIR
A0A1Q6EIY0      --DNSKQK-LS------LEVTPLRNG-K-IELTDFEDKF-VTRQE--TKR-------VIL
E4M8L3          --DNSKQK-LS------LEVTPLRNG-K-IELTDFEDKF-VTRQE--TKR-------VIL
I3YQ50          --DNSKQK-LS------LEVTPLRNG-K-IELTDFEDKF-VTRQE--TKR-------VIL
R5UEY8          --DNSKQK-LS------LEVTPLRNG-K-IELTDFEDKF-VTRQE--TKR-------VIL
A0A1H4D866      --DSDNQS-LS------MEITPLEGD-K-VRLTNFEDRF-VTKQE--TRS-------SIT
A0A374A9J5      --DNDNQS-LA------MEITPIDDD-K-IRLSEFKDQF-VTKHE--SRS-------VIT
A0A1Q6E9S3      --DNDNQS-LA------MEITPIDDD-K-IRLSEFKDQF-VTKHE--SRS-------VIT
D4IJ36          --DNDNQS-LA------MEITPIDDD-K-IRLSEFKDQF-VTKHE--SRS-------VIT
A0A414Q925      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A415PUS9      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A108TCU0      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A413BA42      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
S3Y344          --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A413MY74      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A412TGL3      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A413VJ33      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A414L0W6      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A412DP39      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A413ZSE8      --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
B0NP84          --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
R6AK43          --ATPSQQ-IS------LTVTMSDNG-K-VTLADMTLQ---NEEE--EEEFDE----ILT
A0A412N2D9      --ADPAQK-IS------LTVTMTDNG-K-VTLTDMVLQ---NELE--EEEFDE----SLT
R6LHA4          --ADPAQK-IS------LTVTMTDNG-K-VTLTDMVLQ---NELE--EEEFDE----SLT
A0A1Q6FL18      --ADPAQK-IS------LTVTMTDNG-K-VTLTDMVLQ---NELE--EEEFDE----SLT
A0A1Y4JYS9      --ADPAQK-IS------LTVTMTDNG-K-VTLTDMVLQ---NELE--EEEFDE----SLT
A0A3E5HPT8      --AGLDEV-CS------LSVIPKNKQ-Q-VELADFSLD-----------ELEQ----RKT
C6IJ48          --AGLDEV-CS------LSVIPKNKQ-Q-VELADFSLD-----------ELEQ----RKT
Q8A3U2          --AGLDEV-CS------LSVIPKNKQ-Q-VELADFSLD-----------ELEQ----RKT
A0A3R6S1H6      --AEETSS-LQ------MVVTPLDDK-T-VMLAGWKGD-----------DEEW----KQK
A0A3R6SD81      --AEETSS-LQ------MVVTPLDDK-T-VMLAGWKGD-----------DEEW----KQK
A0A413VXJ7      --AEERQS-IL------VTVTPIDSA-R-VRLSDLKMS---VGDG--EVTSNE----VLE
I9RSN9          --AEERQS-IL------VTVTPIDSA-R-VRLSDLKMS---VGDG--EVTSNE----VLE
U6RJK5          --AEERQS-IL------VTVTPIDSA-R-VRLSDLKMS---VGDG--EVTSNE----VLE
A0A1Q6GA32      --AEERQS-IL------VTVTPIDSA-R-VRLSDLKMS---VGDG--EVTSNE----VLE
I9RPU6          --AEERQV-IT------VVVTPVDSV-T-VRLSGFSLA---VGGG--GVHSEE----ALD
I8Y597          --SEERQV-IE------MTVTPVDSA-T-VRLSDFSLS---IAGE--EIRSAE----VVD
I8YFS5          --SEERQV-IE------MTVTPVDSA-T-VRLSDFSLS---IAGE--EIRSAE----VVD
A0A1Q6GBF5      --AEERQV-IK------VAVVPVDSV-T-VRLSGFSLA---VGGG--IIHSEE----ILD
I8YFZ3          --AEERQV-IR------VVVTPVDSI-M-VRLSGFSLA---VGGG--EVHSEE----VLD
A0A1Q6GDH2      --AEERQI-IT------VVVTPVDSV-T-VRLSGFSLA---VGGG--GVHSEE----VLD
U6RSB0          --AEERQV-IT------VVVTPVDSV-T-VRLSGFSLA---VGGG--GIHSEE----VLD
I9SIK1          --AEERQV-IK------VVVTPVDSA-T-VRLSGFSLA---VGGG--GVRSEE----VLD
I9GXM2          --AEERQI-IK------VVVTPVDSV-T-VRLSDFSLA---VGGG--EISSEE----VLD
I9TP59          --AEERQV-IK------VVVTPVDSA-T-VRLSGFSLA---VGEG--EIHSEE----VLD
A0A0J6CIR2      --AEASQS-FS------LVATPLSAG-E-ILLSGFS-------TN--E---AK----SLK
A0A3D8HG59      --AEPNQQ-FR------LVATAIDEG-K-VALSDFE-------AD--SVDVSD----AVT
A0A3R6S408      --AEPNQQ-FR------LVATAIDES-K-VALSDFE-------AD--SVDVSD----AMT
A0A354WXN6      --AEGEQV-FS------LKATPLDDK-K-VLLHDFKIA--NTEGK--LVEAGK----PME
R5IP14          --KDNNSQ-FS------FDIVPISDQ-E-VLLSDFTSN------------EDW----SKK
A0A316SZX7      ---DDDKS-YS------GFTAKKKGK-E-IYLSDLRTS---AQVS--DIDRDL----TIK
A0A1Y4AIY1      --ASETQS-FS------LTAIPLSKE-K-VRLFDFVTV--NEAGE--PVEIKN----PQE
F3ZRU7          --ASTEQP-IQ------LKG-KLKEN-Q-VQFTDVKTW----TGG--EEVELP----HFS
A0A1C5Q1F3      --ALETSS-FS------FKVTPLNDK-E-VLLSDFPEM------E--GVKPVE----QMK
R7A239          --ALETSS-FS------FKVTPLNDK-E-VLLSDFPEM------E--GVKPVE----QMK
A0A1M6K7I9      --AEDNQY-IH------VCVTPLSEN-K-VRLSELLMI---VNNE--EIQSVD----EPE
A0A3R6HIK7      --TEESQS-FA------LKVTPLSKE-K-VRLSDFIMA--DSNGQ--RVEIKK----AQD
K5ZVW7          --TEESQS-FA------LKVTPLSKE-K-VRLSDFITA--DSNGQ--RVEIKK----AQD
A0A1Y4D5Z0      --AGEGQS-FS------LTVTPMSDK-E-VVLSKFITR--NEEGK--LVEIEK----AQR
R5S343          --RGEDEA-AT------CAVTFMTCE-R-VLLSGFKEE-------------NR----EIE
A0A3R5ZMK1      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GQ--EVADGK----PVK
A0A3E4ZTK7      --AEEAQA-FS------LRAKPISAE-E-VVLSDFVID-----DE----SAGE----SMT
A0A1Y3ZIA4      --AEEAQA-FS------LQAVPVSGK-E-VMLSGFTLG-----DQ--EVSDGK----PMK
K5Y1A4          --AEEAQA-FS------LQAVPVSGK-E-VMLSGFTLG-----DQ--EVSDGK----PMK
A0A3R6K8X4      --AEEAQA-FS------LKAVPVSGK-E-VILSGFTLG-----GQ--EVADGK----PVK
A0A1Q6I3T6      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GQ--EVADGK----PVK
A0A414XX40      --AEEAQA-FS------LKAVPVSGK-E-VILSGFTLG-----GQ--EVADGK----PVK
A0A412DM15      --AEEAQA-FS------LKAVPVSGK-E-VILSGFTLG-----GQ--EVADGK----PVK
A7AEU7          --AEEAQA-FS------LKAVPVSGK-E-VILSGFTLG-----GQ--EVADGK----PVK
A0A415BDM7      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GR--EVADGK----PVK
A0A3R5ZYK4      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GR--EVADGK----PVK
A0A414GI87      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GR--EVADGK----PVK
A0A3R6BKI7      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GQ--EVADGK----PVK
A0A414LPI6      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GQ--EVADGK----PVK
A0A412M2W1      --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GQ--EVADGK----PVK
K5ZX55          --AEEAQA-FS------LKAVPVSGK-E-VVLSGFTLG-----GQ--EVADGK----PVK
K5ZBN2          --ANENLE-FG------LTVVPVSDK-E-VSLSGFFSEE-LEEEG--QVQEDQ----TLT
A0A0J6CKW3      --ANENLE-FG------LTVVPVSDK-E-VSLSGFFSEE-LEEEG--QVQEDQ----TLT
A0A0F5IQM7      --ANESLE-FG------LTVVPVSDK-E-VSLSGFFSEE-LEEEG--QVLEDQ----TLT
S0GLB0          --ANENLE-FG------LTVVPVSDK-E-VSLSGFFSEE-LEEEG--QVQEDQ----TLT
A0A3R6NLC1      --INENLE-IG------LTVVPVSDK-E-VSLSGFTSEE-LEEEG--QSLEDQ----TLT
A0A416WYC9      --INENLE-IG------LTVVPVSDK-E-VSLSGFTSEE-LEEEG--QTLEDQ----TQT
A0A0F5IT40      --AEASQS-FS------LVATPLSAG-E-ILLSGFSTN------------EAK----SLK
S0GSI7          --AEASQS-FS------LVATPLSAG-E-ILLSGFSTN------------EAK----SLK
K5YB65          --AEASQS-FS------LVATPLSAG-E-ILLSGFSTN------------EAK----SLK
A0A0F5IWP9      --AEATQA-FS------LNVTPLTET-E-VMLSDFSTD------------ETK----MLK
A0A0F5IZT8      --AEATQA-FS------LNVTPLTET-E-VMLSDFSTD------------ETK----MLK
A0A417LKQ2      --TEAVQA-FS------LTVTPLSEK-E-VMLSDFSTD------------EGK----MQK
A0A416TME1      --AEATQA-FS------LVVTPLSEK-E-VLLSDFSMA------------EGK----MQK
A0A416XPE8      --AEATQA-FS------LVVTPLSEK-E-VLLSDFSMA------------EGK----MQK
L8JI02          --TISQMIDVP------VYIEPLPGG-S-YRIEAVGR------DV--DVYNFLTNRTEDT
A6EBM4          --IDSLQSGRQ------LILFDPIDH-E-KFTLTWTI-----------------------
A0A2N3U785      --LKQPAFGKT------LRVQIKDKN-N-FVLND-EE-----------------------
A0A0E3ZG78      --LAPPAYRKS------FVIHIKSDS-T-YNLDDNEG-----------------------
A0A1I6BRK6      --LDSTMTGKS------IIIHLKKNN-F-FDLEDYKG-----------------------
A0A243WAB1      --LDSTAIGKS------ITLHLHPDN-S-FQLEDYDG-----------------------
A0A399SH26      --PDAILATED------EPQKIYFTY-N-PDLEEVTV-----------------------
A0A0E3ZGV6      --PE----KAT------ENPMIFFTY-D-ESSKEVII-----------------------
A0A1I2N4S1      --PE----TAV------EYPAVYFTY-D-QATQKVQI-----------------------
A0A2T5YE44      --PE----TAA------EYPAVYFTF-D-QATQKVKI-----------------------
A0A1M4YED3      --PADLKRTEE------IDLSVNATT-N-VVTVDGKS-----------------------
A0A3P1Z8V4      --PSKRYTRME------AV------------INPDNTVTLTDFEG--IRGLSSEQENLKL
A0A2L2WX98      --ECQRP--------------EKFEV-V-KTGDRKFALSNF--------ERGKDKYKGKV
G5GD56          --KAENL--------------VRFEA-K-IQADGTVKLSDFVCYN--RSTGKKKIFKEHL
R6A0L2          --QYKGKRG------------QHIDV-V-KKGSNTVTLKGM-------TDRMGNDVPD-V
R7LG80          --SLPSENPIP------KNMIVSLKI-K-KLDQNTVEIKGF-------RNKKGKKTDEKI
A0A1M6XHU0      -------------------------------TEDGRE-----------------------
D0MHQ9          -------------------------------AEDGRE-----------------------
G2SF81          -------------------------------TEDGRE-----------------------
A0A2H3NSN0      -------------------------------VDDEQP-----------------------
A0A2P6C324      -------------------------------VSEEEP-----------------------
A0A126PFG0      --QTSFYMAAT------NGNLTAHPF-G-RPVSDSIGTWQL-------------------
A0A3M1N7Z3      --ERKVEIWRA------ETLI----------VSGKIGQWMA-------------------
R7PCR1          ----------K------IVLNKNSQY-I-SEFVGKKI-----------------------
A0A2A8CVM9      -------------------------------EDGQAR-----------------------
A0A3C0ZQC7      -------------------------------RAESGP-----------------------
A0A2E3R1D0      -------------------------------DDPSTP-----------------------
A0A2T2USC0      --KDPSDTSEQ------SASETVAGL-L-MSPEEERR-----------------------
A0A2T2V0F3      -------------------------------PEGERR-----------------------
A0A2T2S682      -------------------------------PSGEGR-----------------------
D5H561          -------------------------------WAGQGTGGAE-------------------
A0A2H3NWA9      -------------------------------ETQERL-----------------------
A0A2A8CVB6      -------------------------------VEGNRL-----------------------
A0A2P6C1S6      -------------------------------PEGEQR-----------------------
A0A2T2UTM4      -------------------------------PEGKRR-----------------------
A0A1T5MMH4      ---IENPAFFN------QPFFLEKES---PET------------FSLVWGEGTQKIS---
A0A2W4R1L8      ---ITRPAFYG------VPIFVDLGS---TEA------------VRLRINQDGDQVS---
A0A2E5CV79      ----------------------------------------------------------YR
A0A2A4G4B1      --PINDSYTFDFALLDSENFSLSING---SEE--------------------------MP
A0A2D4ZVH1      ------------------------------------------------------------
A0A0E3V905      ---SGKPELYK------KPLEVSMLS---NKAV---------------------KINEQV
A0A1M6GR99      ----EHPQLVG------PVFDVILNS---DGSYALKVEKQDAMVYNYNTGHKIGERKDLE
A0A1M5BA90      ---LEYPNNIQ------DTDRID---------------------FVYNKGNNTVAIEGKM
A0A1V9F098      --ELKSTGDSV------VHFQVNYYD---DNNAGEF-------RNVDEPKVKEVVIGKKV
A0A1V9FHD0      --QVKETGDTD------VLFSVNYFP---GPNGKAS-------K-----EIKEVVIDKKA
A0A1T5CS78      ----------P------NRISISNEE---PEKHF----------FNYNFNEENVVFSGKE
A0A0Q9Z8F1      ----------P------NKISLSEDE---PEKHF----------FKYNANDEKVIFSGKE
A0A2N0U0M7      ----------P------NRISISADE---PEKHF----------FKYNANDEKVVFSGKE
A0A1M6TTV4      ---ELSSELLD------RRIYIEFVG---DNH------------FYLSLDHDQTEGR-PK
A0A1Q6IT42      --SMADTLSSG------FVVKVQTGG---SDDKIKV-------LL-------------KK
K0X1U5          --SMVDTLSSG------FVVKVQTGG---SDDKIKV-------LL-------------KK
A0A416XAH0      --SMVDTLSSG------FVVKVQTGD---SDDKIKV-------LL-------------KK
R5EXK3          --SMVDTLSSG------FVVKVQTGD---SDDKIKV-------LL-------------KK
A0A401UAP7      ----VNNSYYN------LNHTIDKKS---EAQ------------FEITLSDGEKLTG---
A0A1W2GF52      ---LTNSALLD------KRFDIEILN---ETD------------FYISSEYLGGRIG-EK
A0A2G5L7B8      ---VSDPSILN------RRIDVEILS---DDH------------FVMDFELHGTSHR-TR
A0A0D3LFR6      ---LKDERFFN------QKIYVNIHD---LQE------------YTLSYFQGENEVS-NR
M7N6D4          ---VKDESFFN------RRFFVRIHN---SEE------------YTLSYQLGDQEIS-GR
A0A364XUP5      ---NVDDGLYN------IPLHLTETD---GNS------------FSIKVGESQRKIT---
A0A1M5RLA9      ---AQNESSFN------VPIHLDDSG---SDE------------FTLQVGDEGQKTT---
A0A385SFR9      ---AQNESSFN------APIHLDDTG---NDE------------FTLQVGDEGQKAA---
L8JW09          ---LKNPQLLD------RRIFVNIVD---EKT------------YTINFSGDEQEKA-MK
A0A1Q3ZMZ7      ---IKDSSIIG------QPVYLILQD---ENL------------IRYQSKGKTYTFP---
A0A2D8JJW3      --FLFNNEIID------VPIHIKEGC---GTLIENI-------SETIQIKNEKNALNNLS
A0A2W2AFF7      ---LYEDSVSK------DMYTFSVKI---NGDN-----------IALKCSGKKCNNVDWK
A0A2N5YXE2      ---INNTVILD------QKVNIEFVD---YK-------------CHLYYKIGNQDYE-YL
A0A2I0QZ80      ---LKDSSLLN------TPINITTEG---NK-------------IFLNFTHQNKAHH-IA
A0A2U2XBJ3      ---IKDSSLFG------TPIFLSSME---DK-------------IIMNFKFNGGNYN-YK
A0A3E1F1A3      ---LKDSSLFG------VPIYLSVDE---EK-------------VLMRFNHKGVDYN-YK
A0A1V9F383      --ELIETGDTD------IVMSVNYYT---DKERRAA-------TNVYKDKVKEVVIENRK
G8TRZ6          --ELTETGDTD------IAIAVNYYS---PKEMQVA-------HNGYKDKVKEVVIENKK
A0A2W1NDY9      ---LKDSSLIN------VPIYLK-DG---QDG------------LYLVFNANQKKNE-IP
A0A1G0CI31      ---LKDSSLCD------IPIWIE-LK---GNK------------VQLSYQVGGKSYS-ML
F2IKD6          ---LSDSSLCD------IPIWIETLE---NRK------------IRLSYSLLGRNYS-KV
A0A1I7BM74      ---LNEPDLYN------LPIYFYKDN---SNQ------------YKIKYNYKGKEYI-EE
A0A2G2FJ17      ---IKDSSVFH------IPIYIKPKA---QGL------------VELSMQRHGERLK-WD
A0A416X8R7      ---FLDAYTAP------VSMEIKPLN---GNRFLLN-------QLKIGKEKSD-NEG-QE
K0XJ09          ---FLDAYTAP------VSMEIKPLN---GNRFLLN-------QLKIGTKKSD-NEG-QE
R5EUZ0          ---FLDAYTAP------VSMEIKPLN---GNRFLLN-------QLKIGTKKSD-NEG-QE
W0EQS0          ---FIDPYTAP------VFMKIRPLD---DTHYLLK-------QFSVGGVKSE-DRE-QE
A0A1Y3WE15      ---FLDDYTAP------VSMKIKPVD---ENRFLLK-------QLSIGGGKKS-ESE-QE
A0A1Y4GUK3      ---FLDAYTLP------VSMKVSPID---ENHYALK-------ELNVGGKKTN-EGN-QQ
A0A2U1FKU2      -----RDSTEG------YSFRIQIKD---EKTFRLT-------HFKRHAGRGLSGME-VD
A0A0A2F954      -----RDSTEN------YSFRIRIND---AHSFQLT-------HFEQKERNGIGDIK-ID
A0A0A2FW91      -----RDSTEN------YSFRIRIND---AHSFQLT-------HFEQKERNGIGDIK-ID
A0A2D2N2N1      -----RDSTEN------YSFRIQIND---AHSFQLT-------HFEQKERNGIGDIK-ID
Q7MWZ2          -----RDSTEN------YSFRIQIND---AHSFQLT-------HFEQKERNGIGDIK-ID
T2NDT6          -----RDSTEN------YSFRIQIND---AHSFQLT-------HFEQKERNGIGDIK-ID
W1R7P9          -----RDSTEN------YSFRIQIND---AHSFQLT-------HFEQKERNGIGDIK-ID
A0A1R4AFZ0      -----RDSTEN------YSFRIQIND---AHSFQLT-------HFEQKERNGIGDIK-ID
A0A1R4DVZ7      -----RDSTEN------YSFRIQIND---AHSFQLT-------HFEQKERNGIGDIK-ID
A0A1G9E2A9      ---LKSGAIQD------RSIELEVLN---ERE------------YRLKYELNGEEIQ-GN
A0A2T2YJE8      ---LTNEAYYD------RRYNVTLLD---ATR------------FNLSYLEGDQEIT-EE
A0A3M9N829      ---TSAFDLFD------QQIFIAFSS---PSR------------YEVYVGEEGERLV---
A0A0P0CSF9      ---NESFNLYD------QKIYVKFTS---PSR------------FDLYVGENGNQSS---
A0A3M9MNC3      ---STNFSLFD------QKVYIHFNS---PSK------------FDIYIGKEGKHSS---
A0A2M6GH67      ---IRDGSFYD------KEFKVNFID---NNT------------FKLVYLIGEEEIT-GE
A0A127B287      ---SSRFDLYD------QKIYVTFDS---RTR------------YTVQIGEDGKK-S-DV
A0A369QP10      ---MSNEAYYN------IKFGVSILD---ATR------------YNLSYVQGDQEVT-EE
A0A418R9X5      ---AGKGAMFN------QKIGLQLLE---NDR------------FSLQLPNG-ASAT-QA
A0A428JSJ3      ---ANKGAAFN------QKIGLELLD---NDQ------------FKLHLPGN-GSET-SA
A0A428KI59      ---AGKGAMFN------QKIGFQLLE---NDR------------FRLQLPGG-AAET-GE
W8F1I6          ---AGKGALFN------QKIGFQLLE---NDR------------FRLQLPNG-GTET-GE
A0A246FQC0      ---PINNAVFD------LKIGINLLS---ATT------------FQLILPDGLGGGE-QE
A0A372E5P8      ---ATANAAFD------QKIALRFLS---PTT------------FELILPEDLGGTE-QQ
A0A1H3EMW1      ---ATADATFD------QKLALRFLS---PTT------------FELTLPEQLGGGE-QQ
A0A1H9ZSN3      ---ALADAAFD------RKIALRFLS---PTT------------FELTLPEELGGTE-QQ
A0A0M3RW20      ---IKDPGYYG------IQFNIQFLN---KDK------------FILSYALRGNEIK-EE
A0A1S9B3W0      ---VREPSQFN------LKFSVKLLD---AQR------------FKLSYPAGAGETE-GE
A0A1W1VRL3      ---IKNPAFYN------RKFNVNFSS---PTQ------------FRLSYLEGEQEVS-GV
A0A1M6R305      -----GDILYN------TKFSVVFTS---PQK------------FRISYLQGGQEQT-SE
A0A2M9B9H9      ---IKDPNFYN------SKFNLNFTG---GKQ------------FRLSYLYLGQERS-AT
A0A126PDF2      ---IKDKDLYN------QKISLAFTS---PTR------------YSISYSGPGTALD-GE
A0A2Z3GKA1      ---IKDKELYN------QKISLEFTS---PTR------------YSISYSGPGAALD-GE
A0A328BL48      ---VREPLQFG------QKFSVEVLD---QNR------------FRLSYAQGQAEQG-GE
A0A3S0QKV1      ---VREPIQFN------KKFSVRLLE---GKR------------FRLSYLMGQQEID-GE
A0A3R9P8H7      ---PTDDAAYD------QKIAVQFMS---PTT------------FRLTLPESLGGGV-QE
A0A212UCJ7      ---TKGGGQYN------TKFGLRFLT---PQQ------------IELTYQENGQEVI-QK
A0A238WIA7      ---SKNGSLFN------TRFNLKFLS---PNR------------VQLTYLEGGQEVV-KE
A0A0W8EDI5      ---PADQILYN------RKFDIVFSD---AKR------------FSLVSKAESGDVR-VD
A0A3B7RBP8      ---TKDGFLFN------KKIYINFID---EQH------------FLLLYRKNDVEQK-VN
A0A1I5WSL8      ---ITDPSLYN------RKFDLRFIN---KQR------------FILEFMGQGRPTS-GE
A0A0U3JVM7      ---ITDPSLYN------HKFDLKFVG---PQR------------FALEFTGQGRPLG-GE
A0A1G1SSV2      ---ITDPSLYN------RKFELRFTG---PSR------------FKLDFVAQGRPLG-GE
A0A1G1SXV7      ---ITDPSLYN------RKFELRFTA---PGR------------FRLEFVGQGRPLG-GE
A0A243WHR7      ---IKDGSLYN------TRFDLTFSN---PQQ------------FRLSYQYKGQEIS-AE
A0A076HRT9      ----DGEVLYN------TKFNLRFKD---AQF------------FHLSYQKDGQEQG-GD
A0A1M6DHW8      ---IKDASLYN------TKFNLVFTG---SQR------------IRLSYLYAGQERS-GE
A0A3D1KEX9      ---FLSPYFED------ISFEVELLP---SKQLKV---------SDMQIDDSDVDFK-QV
A0A358Y7S2      ---LNDSSLCG------TEMHVSVEN---DLIL-----------IDYEKSGA--KNK-LK
A0A1X7J248      ----KSCAAYG------EKFFVDIID---KTNFKI-------------STNQDGEEW-VS
E4TQD2          ----KSCANYD------QKFYVDIID---KENFKL-------------TTNPDEDQW-IN
A0A2J6HHN3      ---LIDSTFYA------ESLDITIHD---DHLN-----------VSYMNLDGS-MED-KS
A0A1Y3WMT8      --SMLDTLVSG------FVVKVQTNK---GSDKIK-------------------VLL-KQ
A0A1Y4GQU1      --SMLDTLVSG------FVVKVQTDK---SSDKIK-------------------VVL-KR
A0A1V5W8T5      ---DVQSAIFN------KNIYLDYNK---KTDKIT---------IEYSLDGEK-SIK-HE
A0A2T8HKA9      ---LDPEAHAS------MTIIPKDSN---HVDFLL-------------MENDNIIHS-QR
A0A3B8INU3      ---VRNPAVFD------KKVMVTILD---NDRY-E---------IRFPWVGED-VQP-EE
A0A098LL25      ---IKHPDFLD------FKFDITFLD---KDKF-----------LLSYKKNDE-EIK-SE
A0A1Q3Q573      ---QIAPEFYG------NPVYIRLVN---KNSM-----------VVSYSFNGD-EFE-KE
A0A357YNR3      ---DKDLNNLI------DKVSIDV--------------------VVYPTGNYN-FSV-EY
F4KK08          ---ADPDEKIS------LRIKSDKEA---HNQVILY-------DIKSSLIGKV-QEP-IA
A0A3N2N6F7      ---ISVNRGLR------MRMTILEDG---KVEV-S---------DMYDHLGNE-LDV-MT
A0A419VXB7      ---VHISPIND------REFKIEVKS---KANLLG---------INTEV-----DFE-GT
A0A2V1ILM4      ---IPSKQSAS------MELDIRDDG---KIDISK---------MMLNGVECD-PSE-MT
A0A3N2L0E8      ---IPSKQSAS------MGLDIRDDG---KIDISK---------MMLNGVECD-PSE-MT
A0A3N2LFC5      ---IPSKQSAS------MELDIRDDG---KIDISK---------MMLNGVECD-PSE-MT
C3J7R8          ---GNSSDVYC------KLEVSSVDA---SHVSLL---------CEESSIEAARGTT-SQ
A0A0B0BTJ4      ---IRYTFNIH------IKSIEDADG---SFKA-L---------LEYRLPGQK-TTE-KT
A0A3B9CNN6      ---IRYTFNIH------IKSIEDADG---SFKA-L---------LEYRLPGQK-TTE-KT
R5X290          ---IRYTFNIH------IKSIEDADG---SFKA-L---------LEYRLPGQK-TTE-KT
A0A1Q6E6I7      ---IRYTFNIH------IKSIEDADG---SFKA-L---------LEYRLPGQK-TTE-KT
A0A2G2F510      ---LYDSTLIN------KEVRVDYDG---ENI--S---------LSYLK-NGE-TKV-VK
A0A316JZ08      ---LVDSTLIG------QEIGITTRN---DQV--I---------LSYSK-GGK-NVK-LK
A0A1I1FXP9      ---VKNPAFYD------IPVDVLFID---EKQF-S---------LKYKL-GNV-NYS-RN
A0A3B9FXJ0      ---VQDSTVLG------DVIELRPIG---DQKI-R---------CAYEW-KGE-TWS-QE
R5GSU5          ---RPAEIDED------ITFKVDLID---NQKFRI---------FDVRYKDEDCRID-KV
A0A2P8EAX2      ---FNEEFLLE------GEVFTIKVL---NEKKFE---------IEFAK-----NKK-TE
A0A3N4H5N3      ---INNDFVGG------GELLQIHLK---EENKFE---------LILED-----EKK-AE
A0A2A3UE91      ---AKKGTVYG------SQIKVELNK---QLTGGV---------LKIGT------QK-LN
A0A0A2G557      ---LNTSDTLS------GSFSLSFIE---ENKVSL---------SNFEG-----DFE-QL
A0A2N2WFW8      ---IVDSLSYG------TPYSLTVGD---STF--V---------ISTKTAGGT-ESE-TE
A0A1F3IU95      ---IVDSTFYG------VPLLIEVHD---TGF--V---------IT--EINGI-QTD-KS
A0A3D0VUF6      ---IVDSTFYG------VPLLIEVHD---TGF--V---------IT--EINGI-QTD-KS
A0A1T4PT95      ---FPED--HS------GSFILSFEG---SDKVRL---------SHFKG-----DFS-KT
A0A3Q9FR88      ---NVQPTLKD------LPFFLEFSN---GGKDFI---------ITYKI-GEQ-QIE-IA
A0A150ADJ9      ---GKLPFLQD------KPILLNFSG---DGKSYQ---------LTYNQ-GKS---V-VE
A0A1B1FWQ4      ---GKQPALKN------TPFYLQFSN---EGKEYV---------ITYKV-GQT-EKE-IK
A0A1S1Z228      ---GKQPAFKD------IPLFLQFLN---GGDQYQ---------VTYKT-GDQ-ENT-IS
A0A1F3SJM1      ---LRDSSLVY------EGTEVAVAY---NNGKVV---------LSYLK-NGK-KKT-IR
A0A2G2EB96      ---LSDSSLIN------QEIAV-TSS---GNSKVK---------LTYVK-NGK-QVI-LS
A0A2G6PRA9      ---LSDSSIIN------QEVAV-VSK---GRNKVE---------LSYVK-GGE-KQR-VE
A1ZKR2          ---VKSDAFLD------KNINIEIID---DQRF-Q---------LSYVL-GTQ-TVK-KT
A0A1Q3GX01      ---IKAPVYYD------KKFNIRIKN---QNEF-E---------LSFQV-GTN-LKK-QI
A0A349DQI4      ---IKTPGYYD------KKFNIKLKS---QKEF-E---------LSFQT-GKV-LNK-QV
A0A2N3IIZ0      ---VLNENLYN------QKFYIESED---GHSY-N---------IEVKNDKKT-LAE-YK
A0A2A4PYG9      ---NVGPGLLG------KPIYISFPS---TKKI-Y---------TSYYV-GEE-QFN-KP
A0A2A5FYT6      ---VKDSSIFG------RKIYIQFDD---EFKA-I---------ASYTI-NDS-VYS-RE
A0A2E6SYP1      ---IKDKSVLN------KLIQIEFVK---GC---A---------LLSFN-DDP-SSN-TI
A0A2E5RLE8      ---LKKREAVK------SPIMVNFSN---GS---A---------IISKV-DVD-SGT-VL
A0A2E7TQF6      ---LKKREAVK------SPIMVNFSN---GS---A---------IISKV-DVD-SGT-VL
A0A2E6GVY9      ---LKKRKAVN------YPLMINFKN---GS---A---------VISKM-DVD-SGS-FI
A0A350JJ90      ---IHDPIILD------RRIYIEFET---PTSG-T---------INYLV-GTK-SFS-EK
A0A3M1CDV2      ---IKNENIYG------KKIYVDFND---NLQTGK---------IKILLSEDN-LIQ-IP
A0A2E2TFD1      ---IISAEAFA------HKYYIYFPN---TTQI-H---------LSIDEPIGD-ANY-QV
A0A2E4ELE6      ---IKSPEAFG------KDYYVYFES---EKEL-I---------LTIENGKET-VEK-RL
A0A2E3XZI5      ---IKDSSIIS------KKIYLKF-E---KNYF-S---------LVDEE-NEK-IYA-EY
A0A2M7NLQ9      ---VYDASFYN------RHLDIQIID---EEEF-V---------LTYQTATGE-DFS-KI
I4AFR0          ---VYDNSFYN------HPLNIQIID---EEEF-V---------LTYETPTGD-NFS-KI
A0A2N2Y3E5      ---NEGFKHFD------VPIALDFEN---ITDG-W---------LYFQN-NSS-AEK-VK
A0A2D9D7T6      ---LLDSTLCG------VHFDIK-EK---KGKL-E---------ISYTH-NGQ-SKK-IS
A0A1F3PPL5      ---INNGAIYD------KKIYIDFEN---PTTY-H---------LKINS-DDL-EFE--N
A0A357QK06      ---INNGAIYD------KKIYIDFEN---PTTY-H---------LKINS-DDL-EFE--N
A0A2A5B3B0      ---IKDSTILG------QSFFVEFID---DYKF-R---------L---T-QND-KVI-GD
A0A0F2NS19      ---VKDSSVLG------KKFYLEKTN---NEKF-N---------L---F-QSE-KLI-GE
A0A2A5H8X6      ---VKDSSVLG------KKFYIEKTN---NEKF-N---------L---F-QSE-KLI-GE
A0A2H0GAU8      ---IKDSSIVG------IPFFIEITK---NNKF-N---------L---F-ENE-TLL-GE
A0A2M8FTK1      ---IKDSSIVG------IPFFIEITK---NNKF-N---------L---F-ENE-TLL-GE
A0A0S2HYK8      ---IKDSKAFG------IPVFISFKD---KKNV-V---------FEYEY-NGE-TYS-YP
A0A2N5ZWN6      ---IQNPSIYG------EPIHIQFID---ENNA-K---------IEFEI-GDN-IIT-KD
A0A2E0FJ09      ---LLNSSLVN------VPIYVLLKP---DKTI-H---------LKYTV-DEE-TFE-FN
A0A1F3FZ62      ---VFNPSIYG------INFDIEFKG---NNKY-I---------LRYLL-NEK-LNI-RE
A0A1F3K211      ---VFNPSIYG------INFDIEFKG---NNKY-I---------LRYLL-NEK-LNI-RE
A0A1F3KLL5      ---VEPE-MYN------NQIYISFLN---KNSF-T---------LEYYI-NGV-KSH-YS
A0A359D1M1      ---VEPE-MYN------NQIYISFLN---KNSF-T---------LEYYI-NGV-KSH-YS
A0A2E7CT70      ---IRDSIIIG------LPIYIQK-K---GDYF-I---------LTDFD-NQK-SYA-KF
A0A2D5V560      ---IKDMSIIS------KPIYLLF-D---GNYF-S---------LTDEK-AEI-IYA-KY
A0A2D7K5A8      ---VKDESILS------KAIYLLY-D---GTYF-S---------LTDEN-EEI-EYA-NY
A0A2E1XQ82      ---VKDESIFS------KPIYLSF-D---GTYF-S---------LKDKN-QEI-EYA-NY
A0A1V6I2U9      ---IINTEIYD------QNIDLEF-K---DYKC-H---------IAYTL-GNQ-KYE-YT
A0A1F3C1M2      ---IKNNIVYD------IPIYIEFID---KLNF-N---------LSFTI-NEK-TIE-KK
A0A1F3DS87      ---IKNNIIYD------VPIYIEFID---KINY-N---------LSYEI-NDK-KFE-RK
A0A2H0B957      ---ITKGNLYN------IPIYVSFSL---NGDA-A---------IKYTY-NNQ-IVQ-KS
A0A1F3CFW6      ---NTKRNLYN------VPIYVSFDK---NGDS-N---------IKYKT-NNT-NFE-KT
A0A2M7E2T8      ---NTKRNLYN------VPIYVSFDK---NGDS-N---------IKYKT-NNT-NYE-KT
A0A2M7NC69      ---NTKRNLYN------VPIYVSFDK---NGDS-N---------IKYKT-NNT-NYE-KT
A0A1F3K695      ---ILDSRIYE------IPIYIDFIS---SKETKA-----------LYKIGEE-NHE-FA
A0A353KZR1      ---ILDSRIYE------IPIYIDFIS---SKETKA-----------LYKIGEE-NHE-FA
A0A2N2WYB5      ---TLNPSIFN------TPIYIDFTD---DKNGII---------TTYVKKEGY-DQK---
A0A1F3K4G0      ---MITGKLYD------IPVYIEFDG---SEKALI-----------YYGDGGV-NAS-YP
A0A356H8Y3      ---MITGKLYD------IPVYIEFDG---SEKALI-----------YYGDGGV-NAS-YP
A0A351HSA6      ---MITGKLYD------IPVYIEFDG---SEKALI-----------YYGDGGV-NAS-YP
A0A1F3Q014      ---IINPKISG------VKIYIDFVD---STHGTI----------SYSFDNET-EQQ-HN
A0A2A4YXP3      ---VKDSSILG------QHFYVKFID---THK--------------FELVVNK-LVL-GE
A0A2D5KD44      ---YKEPSLSS------TKIDISFAN---SSSGKL----------SWGEGKES-SV---D
A0A1F3R158      ---IKDSSVIG------ISHFVEITN---NNK--------------FKLYENE-KLI-GE
A0A2M8ADX2      ---IKDSSIIG------LPFYIELTQ---NDK--------------FKLFENE-TFL-GE
A0A1J5B2H0      ---IKNPAIYG------IPIYINFND---DKQIKI----------SYCISDNS-KIE-KT
A0A1V5N756      ---VKKPVIYN------VPINISFLS---NSNIHI----------DFEAEKKS-N-Q-YE
                                                                            

A0A1I3J6V0      ------------------------------------------------------------
A0A1H4ADG3      ----SVPV---------------------------------VLPIGQLTLEKNELTNDWD
A0A3D5KRY6      ----GEAF---------------------------------KNEFFQFTISAKTGVAPQE
A0A1V5IPN7      ------------------------------------------------------------
A0A1V3WH52      ----GQML---------------------------------TKE---GVSIKVSAIQAHE
A0A2K8Z965      ----NKSI---------------------------------ETPYG-RLKIVSRKATA-R
A0A418M8U8      ----NQRI---------------------------------KTPQG-RFLIKTRRSVGDT
I2GTA4          ----NQRI---------------------------------KTPQG-RFLIKTRRAVGDT
A0A2K8ZAJ2      ----NQSI---------------------------------KTPYG-QLRIFVRKPLSSK
A0A368JPA3      ----NQII---------------------------------NTPFG-RLQIFIKQPVVYT
A0A3P1BT12      ----NQII---------------------------------NTPFG-RMQIFIKQPVVYS
A0A3P1CI15      ----NQVI---------------------------------NTPFG-RLKIFIKQPVVYS
A0A1Q3PII2      ----GIPM---------------------------------ALPHG-LSIIDTTRFKPAS
A0A351BXT2      ------------------------------------------------------------
A0A3D0MYJ7      ------------------------------------------------------------
A0A3D3LS70      ------------------------------------------------------------
A0A1G7ZF38      ----GKKL---------------------------------SLPHG-AAIMDTTRFKPSS
C6VS52          ----SSPL---------------------------------ALPQGVAVIVDTTRFKPSA
A0A1G1TM36      ----GRPI---------------------------------SDSLGTWQLNATASLRGFE
A0A1V3WH27      ----TQGI-----------------------------------------VLLVTSIEAEP
A0A0D3L8Q3      SHKFGQRV---------------------------------NVGFGEFTIVSDSRLIRNG
A0A0K8QSK7      PNV-NIDE---------------------------------TRLLGERFS-GNDYSF--A
A0A1V6CN82      PEV-KIEQ---------------------------------KVQSGEEVVIPGQCSF--K
A0A1M4XZ45      PQF-SFSR---------------------------------DISAGTKLK-AEQFSI--T
A0A399D319      PGY-SFSR---------------------------------TIDPGTKIT-SDEFSF--T
A0A0P7X1V8      ----DSSI---------------------------------VTA----------------
A0A3B0C2S4      ----TVPI---------------------------------QLPFNITFLENAQPIAYEG
A0A416GA42      FVL-NDTV---------------------------------QTAVGQLVVVPTGFYQKFD
A0A3N2M1H3      ----KESV---------------------------------KTPIGIVKVTPNPEY---D
A0A1T3IYP5      VAL-NQLV---------------------------------ETPVGKVFVTPSKNY---K
A0A212K7W5      INL-SESV---------------------------------NTPLGSIRINPTAFYS--K
F5IU11          INL-SEPV---------------------------------NTPLGNITIHPTAFYS--K
A0A352Z1R7      ----GRLM---------------------------------QAKGFSLLLNDLKGEK---
A0A0A2F501      CSL-GDTI---------------------------------SAPIGKLVIVRSESYL--A
R5B7P0          GHY-GDTL---------------------------------QTPVGRIIVQKTKDYS--G
R5B0L5          AIP-GDTI---------------------------------RTQSGNLVVSLTGRGN--P
A0A374THP7      GRL-GQII---------------------------------HTPLGKIKVDKAPSYS--Q
A0A3R5XWG1      GKL-GKLV---------------------------------QTPLGKVKLEAAPSYA--A
A0A414YFM3      GKL-GKLV---------------------------------QTPLGKVKLEAAPSYA--A
A0A0A2EVS5      GEL-VDSI---------------------------------PTPMGIVRVGLNSAYS--D
A0A1T4NAJ7      GEL-VDSI---------------------------------PTPMGIVRVGLNSAYS--D
A0A2V1IJY1      GAM-NDTL---------------------------------MTVVGPMVVVAAEGYK--P
A0A3N2KCL3      GAM-NDTI---------------------------------MTAVGPMVVVAAEGYK--P
A0A255T941      GNI-GKVV---------------------------------MTPIGQMTVHGTKTAR--E
A0A1Y4CHN5      GKL-NDTI---------------------------------ETPVGRIVVSTTPYYS--G
A0A1Y3V692      GKM-GDSI---------------------------------RMEVGTFVINPTKYWN--D
A0A174TYU6      GKM-GDSI---------------------------------RMEVGTFVINPTKYWN--D
A0A1M6I2S6      GKM-GDSI---------------------------------RMEVGTFVINPTKYWN--D
F3PXM2          GKT-GDTL---------------------------------RTSVGTLLIDATPYAT--D
A0A3E4ZNL4      GNI-GDSI---------------------------------QTSAGTLAVSLTSQYN--D
A0A174AHH7      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A174JCE8      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A3E4JMC4      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A412SND6      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A414IEQ9      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A415UKN5      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A0M1W8D8      GNI-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A3R6GKX5      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A7V4S1          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
B0NU19          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
D4V601          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A397WLT5      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A3R6GM96      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A015XH67      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A078RZN2      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A6L0K5          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A7ACT5          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A6KY94          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A173UQR8      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A3R6HK75      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A412B7D1      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A412VNY9      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A414LTU9      GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
I9Q4U4          GII-GDSI---------------------------------QTSAGTLAISLTSQYE--N
A0A373ISF0      GRM-GDSI---------------------------------QTVAGTLFISPTKFYS--D
U6RF62          GRM-GDSI---------------------------------QTAAGTLFISPTKFYS--D
A0A073I794      EKM-GDSI---------------------------------RIETGKLVINPTKYWN--D
A0A108TH71      AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
I8VXH0          AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
A0A412S0N6      AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
A0A412IIJ0      AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
A0A0P0FM97      AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
R6KTP3          AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
A0A139LU87      AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
A0A1C6B3Y5      AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
E2NMQ4          AQM-GDSI---------------------------------QTSAGIMIVSPTQEFT--D
A0A412YDB9      AQM-GDSI---------------------------------RTSAGTMILHPAQKNA--N
R7DY01          AQM-GDSI---------------------------------RTSAGTMILHPAQKNA--N
A0A414LGK8      AQM-GDSI---------------------------------RTSAGTMILHPAQKNA--D
A0A016E4F9      GKM-GDSI---------------------------------RMEIGTFVINLTKYWN--D
A0A413PP50      GKM-GDSI---------------------------------RTEIGTLVINPTKYWD--D
A0A3A5TI83      GKM-GDSI---------------------------------RTEIGTLVINFTKYWN--D
A0A415NEB6      GKM-GDSI---------------------------------RTEIGTLVINFTKYWN--D
A7AJ60          GKM-GDSI---------------------------------RTEIGTLVINFTKYWN--D
A0A015UXN7      GKM-GDSI---------------------------------RTEIGTLVINFTKYWN--D
A0A395YYT3      GKM-GDSI---------------------------------RTEIGTLVINFTKYWN--D
A0A415IPQ4      AQI-GDSI---------------------------------RTSAGIIIISPTEKFT--D
A0A3E5BRW7      ARP-GDSI---------------------------------HTSVGTMIISLTQEFT--D
K9DXS6          ARP-GDSI---------------------------------HTSVGTMIISLTQEFT--D
A0A1M6KFV3      AQT-GDSI---------------------------------HTPAGTMIISPTQAPS--D
A0A1Q6G7L3      AQT-GDSI---------------------------------HTPAGTMIISSTQASS--D
A0A413H235      AQT-GDSI---------------------------------HTPAGTMIISSTQASS--D
A0A1M5B2J8      GQL-GDTI---------------------------------QSPFGKMAVTATAHYR--K
A0A255RCT5      GKL-GDTV---------------------------------QSPFGKMSVTATAHYR--K
A0A1Y4GLF5      GTL-ADTI---------------------------------ATPLGRMVVNATANYV--D
A0A1H3XSC0      GRL-SDTI---------------------------------TTPLGILKIETTPYYK--S
B3JI46          GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A174UR09      GNL-LDSI---------------------------------PTPLGKIIIHTTPNYV--K
A6LE40          GSL-LDSI---------------------------------PTPLGKIIIHTTPNYV--K
R6NN15          GTL-NDSL---------------------------------VTPIGKIVIRPAAAFV--D
A0A358R8U0      GNL-TDTL---------------------------------TTPLGRVEITPTPYYD--I
R6WSB6          GNL-TDTL---------------------------------TTPLGRVEITPTPYYD--I
A0A401LPX7      GSL-NDSI---------------------------------QSPLGPIVVIPSAAYS--G
A0A3A5Z900      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--G
A0A3R6I893      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A3R6EGW5      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A285TGL6      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A3A5RFX4      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A1Q6IUW9      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A3R6NPG7      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A413XDP6      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
K6AP24          GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A076IQN8      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A078RYI7      GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
C7XEQ8          GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
D7INX6          GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
K5ZG55          GNL-NDSI---------------------------------QSPLGPIVVIPSAAYS--D
A0A3N2N9B8      GSI-GDTI---------------------------------STPAGLVVINPSAYYL--P
A0A3N2NMI0      GSL-GDSI---------------------------------ATPVGIVIVNPSPAYT--P
A0A359I8H7      AKIGAGPI---------------------------------ETPVGKVSIIANGNYTAPK
A0A3N2KA63      AKIGAGPI---------------------------------ETPVGKVSITANGNYTAPK
A0A3B9FAU3      GRT-STII---------------------------------GTPVGNVLVTPTQYYG--S
A0A3C1E5L7      GRT-STII---------------------------------GTPVGNVLVTPTQYYG--S
A0A354SN68      SQE-GDTL---------------------------------LTPIGKIFLQKSNSFD--K
A0A0A2DUD9      LVL-GKAT---------------------------------ETPLGKVLVNKNQGDD--L
A0A3N2N595      GKL-NDTI---------------------------------KTDAGPIVILPTDYYK--P
R5FHS9          AKL-NQTV---------------------------------HTPIGRVTIKPSHYYN--S
A0A3P1ZBJ5      GRF-KQVV---------------------------------KTPVGDILVTPTKNFE--L
A0A413TW79      GKL-GQTV---------------------------------RTVMGYVCVDQAPGYS--A
A0A3E5E9M7      GKL-GQTV---------------------------------RTAMGYVCVDQAPGYS--A
A0A3E4SK73      GKL-GQTV---------------------------------RTAMGYVCVDQAPGYS--A
A0A415GGC6      GKL-GQTV---------------------------------RTAMGYVCVDQAPGYS--A
A0A413DBH9      GKL-GQTV---------------------------------RTAMGYVCVDQAPGYS--A
G9S1S8          GQL-RDTI---------------------------------MTPVGKVTICPTPYYT--S
A0A354M4S6      GQL-RDTI---------------------------------MTPVGKVTVCPTPYYT--S
R7DH52          GQL-RDTI---------------------------------MTPVGKVTICPTPYYT--S
A0A396N3D5      GQL-TDTI---------------------------------MTPVGKVTVCPTPYYT--S
A0A415ZDP9      GQL-TDTI---------------------------------MTPVGKVTVCPTPYYT--S
A0A016CWA4      GRL-LDSI---------------------------------TTPLGKIVVHTTPNYV--E
A0A1C6H117      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A415TAH7      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A0M1W0V2      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A139KA16      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A174VQ92      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A1Q6HCG0      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A1Y4JYM9      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A3A5QW67      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A3A5RQE6      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A3A6BP07      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A3E5E153      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A3Q9IP20      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A412WV15      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A413ICP6      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A414KYB9      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A416X133      GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
E5WX00          GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
K0X3P3          GRL-LDSI---------------------------------TTPLGKIIIHATPNYV--K
A0A3A5Z014      GSL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A1M4YZ07      GNL-LDSI---------------------------------PTPLGKIIIHTTPNYV--K
A0A078S3Q8      GNL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A069SJV7      GNL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A3E5DXI5      GNL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A3E5EM98      GNL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A3E5F453      GNL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
I9T3G6          GNL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A0P0FQW1      GNL-LDSI---------------------------------TTPLGKIIIHITPNYV--K
C3RFN5          GSL-FDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A3E4SYU0      GSL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A6LGY1          GSL-FDSI---------------------------------PTPLGKIIIHTTPNYV--K
K5ZSH4          GSL-FDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A078T2W6      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3R6D1V4      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3R6EAF7      GSL-LDSI---------------------------------PTPLGKIIINTTPNYV--K
A0A412MJT7      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3E4WKT5      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3A5YY33      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A078TAH2      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A1E9CFZ7      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A373FYU5      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3A5TZ72      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3A5XBP2      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3A6MEG9      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3E4JP35      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3E4KP40      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3E4NX82      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A3E4XFU8      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A412RG70      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A412TD37      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A413GAA4      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A414M7I4      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
E5UZA2          GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A069SMG6      GSL-LDSI---------------------------------TTPLGKIIIHTTPNYV--K
A0A1Y4PQK7      GKF-PCTL---------------------------------NTPLGKVTLETTSGYV--R
A0A1Y3ZDB3      GKF-PGTL---------------------------------NTPLGKVTLEATSGYV--R
A0A3A6AAP4      GKF-PGTL---------------------------------NTPLGKVTLEATSGYV--R
A0A1Y4IH41      GKF-PGTL---------------------------------NTPLGKVTLEATSGYV--R
A0A1Y4DYA7      VEF-NDTI---------------------------------STPVGRLLIKPTHGIK--D
A0A1Y3X4I9      ALF-NDTV---------------------------------STPVGRLLVKPMAGAE--T
A0A1Y4FNK8      ATL-NDTA---------------------------------DTPIGKLSIKAMNDTV--T
A0A355FD59      TRL-GTIV---------------------------------DTPLGKLSVMPTSHYT--N
A0A359CEZ9      TRL-GTIV---------------------------------DTPLGKLSVMPTSHYT--N
A0A353Q7B4      TRL-GTIV---------------------------------DTPLGKLSVMPTSHYT--N
A0A1M3KVR9      GKF-NDTI---------------------------------DTPLGKIIVVPTSYYT--K
F8X3A5          GKL-NDTI---------------------------------DTPLGKIIVFPTSYYT--K
A0A3C1ITV0      VKL-GQPF---------------------------------KTPVGTVVLKATKEYG--K
R7HN19          VKL-GQPF---------------------------------KTPVGTVVLKATKEYG--K
A0A415EEZ4      GSF-GTPL---------------------------------NTPVGELNIIRTSYFT--P
A0A060RD97      KKF-GDTV---------------------------------LIRNVLIEIKPTI-SA--E
A0A350IHV0      GSF-REEL---------------------------------QTPVGKIKIVPTMHID--K
A0A077ENE7      IAL-NKLT---------------------------------STPVGKILITPSKYYK--K
T0NN57          VSI-NQSV---------------------------------KTPFGEVLIVPSKFYG--T
X5K347          VSI-NQSV---------------------------------KTPFGEVLIVPSKFYG--T
A0A1T5K9D4      VSY-GDKV---------------------------------KIGDGSFTIDKTRNLG--K
R5RVP0          GRL-RDTI---------------------------------STPVGKIVIVPTEFID--K
A0A285T4L1      MRL-NDTL---------------------------------TIGSERILITGTDRWG--Q
A0A3E5BU42      MRL-NDTL---------------------------------TIGSERILITGTDRWG--Q
A0A414ZBF2      VQM-GDTT---------------------------------DTPVGKVVVASTLFMN--E
R5KD55          CHV-GQTV---------------------------------NTPLGRLTIERQPHYP--S
A0A174QNT3      VAF-NDTL---------------------------------FTPVGRIIVTPKAEYV--R
R9I0H0          VAF-NDTL---------------------------------STPAGRILVLPHAESI--P
K5BUT9          LAY-NDTI---------------------------------RTEAGRIVVQLRPENL--S
A0A174FPA3      LTY-NDTI---------------------------------RTEAGRIVVQLRPENL--S
R6S9Y6          LTY-NDTI---------------------------------RTEAGRIVVQLRPENL--S
C9KX15          LTY-NDTI---------------------------------RTEAGRIVVQLRPENL--S
A0A3L8AAP1      YAY-GDTV---------------------------------QTEAGRIVVNLKPENL--S
R6DAG6          YAY-GDTI---------------------------------QTEAGRIVVNLKPENL--S
A0A1G8BVM8      ISL-DSVV---------------------------------AFSHGKIKIKPTIFMH--S
A0A416GGJ1      VQL-RDTT---------------------------------AIGNFKIAVTPTNFLN--K
A0A3D1NQW3      AVF-GDTI---------------------------------STPVGQMIIRPTLYMS--P
B0MT10          AVF-GDTI---------------------------------STPVGQMIIRPTLYMS--P
R7JGW9          AVF-GDTI---------------------------------STPVGQMIIRPTLYMS--P
A0A0E2M2Y7      GSF-GRPI---------------------------------ATPVGELQIDKTIFFA--D
A0A0K2J6Z0      GSF-GRPI---------------------------------ATPVGELQIDKTIFFA--D
B2RKZ8          GSF-GRPI---------------------------------ATPVGELQIDKTIFFA--D
A0A212GC82      GSF-GRPI---------------------------------ATPVGELQIDKTIFFA--D
A0A254MU12      GSF-GRPI---------------------------------ATPVGELQIDKTIFFA--D
R6CQ93          VQL-NDTL---------------------------------SIGGEKILVTSTDHWS--K
A0A3D2BF46      GRF-NDTI---------------------------------TTPCGLLVVTPTLYMS--D
A0A358R538      VES-GDTA---------------------------------ATPVGKVVVERTPYLT--P
A0A1Y4AAB8      AAY-GDTV---------------------------------STPLGRMIIRKTLYLS--P
A0A1Y3WWY9      AQY-GDTI---------------------------------PTPIGEIVVHKTLYMN--P
A0A1Y4U5L4      AQY-GDTI---------------------------------PTPIGEIVVHKTLYMN--P
A0A1Y3VCJ1      ARF-GDTV---------------------------------ASPIGQIIVRKTLYME--P
A0A1Y3QTW7      GQY-GDTI---------------------------------PTPLGQMVVHKTPFMD--S
R6XWY7          GQY-GDTI---------------------------------PTPLGQMVVHKTPFMD--S
A0A174AVF1      AQY-GDTI---------------------------------PTPLGQMVVHKTPFMD--S
A0A373HTL7      AQY-GDTI---------------------------------PTPLGQMVVHKTPFMD--S
A0A1Q6EIY0      AEY-GDTV---------------------------------ATPVGQVVVHKTLFMD--S
E4M8L3          AEY-GDTV---------------------------------ATPVGQVVVHKTLFMD--S
I3YQ50          AEY-GDTV---------------------------------ATPVGQVVVHKTLFMD--S
R5UEY8          AEY-GDTV---------------------------------ATPVGQVVVHKTLFMD--S
A0A1H4D866      AAY-GDTI---------------------------------PTPVGQVIVRKSLYMK--P
A0A374A9J5      AAY-GDTI---------------------------------PTPVGQVVVQKSLYMA--P
A0A1Q6E9S3      AAY-GDTI---------------------------------PTPVGQVVVQKSLYMA--P
D4IJ36          AAY-GDTI---------------------------------PTPVGQVVVQKSLYMA--P
A0A414Q925      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A415PUS9      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A108TCU0      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A413BA42      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
S3Y344          VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A413MY74      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A412TGL3      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A413VJ33      VQP-GDTV---------------------------------NTPVGKMVVASTLFMD--E
A0A414L0W6      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A412DP39      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A413ZSE8      VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
B0NP84          VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
R6AK43          VQP-GDTV---------------------------------NTPVGKMVVASTLFTD--E
A0A412N2D9      VQP-GDTV---------------------------------STPVGKIAVQPTLFTN--E
R6LHA4          VQP-GDTV---------------------------------STPVGKIAVQPTLFTN--E
A0A1Q6FL18      VQP-GDTV---------------------------------NTPVGKIAVQPTLFTN--E
A0A1Y4JYS9      VQP-GDTV---------------------------------NTPVGKIAVQPTLFTN--E
A0A3E5HPT8      VNL-NDTV---------------------------------DTPLGKLIVFAAENYS--E
C6IJ48          VNL-NDTV---------------------------------DTPLGKLIVFTAENYS--E
Q8A3U2          VNL-NDTV---------------------------------DTPLGKLIVFTAENYS--E
A0A3R6S1H6      VAL-KDTV---------------------------------ETPVGKVVVTPTLYYS--K
A0A3R6SD81      VAL-KDTV---------------------------------ETPVGKVVVTPTLYYS--K
A0A413VXJ7      VNL-HDTI---------------------------------QTPVGAMVVMPTLYYS--D
I9RSN9          VNL-HDTI---------------------------------QTPVGAMVVMPTLYYS--D
U6RJK5          VNL-HDTI---------------------------------QTPVGAMVVMPTLYYS--D
A0A1Q6GA32      VNL-HDTI---------------------------------QTPVGAMVVMPTLYYS--D
I9RPU6          VHL-NDTV---------------------------------STPIGPMVITPTLYYT--D
I8Y597          ARL-NDTI---------------------------------STPVGTMVVTPTLYYT--D
I8YFS5          ARL-NDTI---------------------------------STPVGTMVVTPTLYYT--D
A0A1Q6GBF5      VHL-NDTV---------------------------------STPIGTMVVTPTLYYT--D
I8YFZ3          VRL-NDTV---------------------------------STPIGPMVITPTLYYT--D
A0A1Q6GDH2      VHL-NDTV---------------------------------STPIGPMVITPTLYYT--D
U6RSB0          VHL-NDTV---------------------------------STPIGPMVVTPTLYYT--D
I9SIK1          VHL-NDTV---------------------------------STPIGPMVITPTLYYT--D
I9GXM2          VHL-NDTV---------------------------------STPIGPMVITPTLYYT--D
I9TP59          VHL-NDTV---------------------------------STPIGPMVITPTLYYT--D
A0A0J6CIR2      VAL-NDTV---------------------------------STPVGKLVVTPTLYYA--D
A0A3D8HG59      VAL-NDTV---------------------------------QTPVGRVVVTPTLFYT--T
A0A3R6S408      VAL-NDTV---------------------------------QTPVGRVVVTPTLFYT--T
A0A354WXN6      VLL-GDSV---------------------------------DTPVGPLKIEASLDYS--E
R5IP14          VQL-GDTV---------------------------------STPVGVLVVNNTGIPL--T
A0A316SZX7      ASL-YDTI---------------------------------STPIGKLVIKPTPYFD--S
A0A1Y4AIY1      VVL-NDTV---------------------------------TTPVGRIVVQPSLYYT--D
F3ZRU7          VQL-NDTV---------------------------------DSPLG-LLLVKTTGLG--K
A0A1C5Q1F3      VHL-NDTV---------------------------------ATPVGKLVVTPTLYYT--Q
R7A239          VHL-NDTV---------------------------------ATPVGKLVVTPTLYYT--Q
A0A1M6K7I9      VAL-GDTI---------------------------------KTAIGNIVVTPTLYYT--N
A0A3R6HIK7      VAL-NDTV---------------------------------QTPVGRVVVVPSLYYA--D
K5ZVW7          VAL-NDTV---------------------------------QTPVGRVVVVPSLYYA--D
A0A1Y4D5Z0      VAL-NDTV---------------------------------TTPVGKLVVVPSLYYT--D
R5S343          AVL-NDTV---------------------------------DTPSGRAVVAPTGYYN--K
A0A3R5ZMK1      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A3E4ZTK7      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A1Y3ZIA4      VAL-NDTV---------------------------------TTPIGRVVVVPSLYYG--D
K5Y1A4          VAL-NDTV---------------------------------TTPIGRVVVVPSLYYG--D
A0A3R6K8X4      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A1Q6I3T6      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A414XX40      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A412DM15      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A7AEU7          VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A415BDM7      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A3R5ZYK4      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A414GI87      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A3R6BKI7      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A414LPI6      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
A0A412M2W1      VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
K5ZX55          VAL-NDTV---------------------------------TTPVGRVVVVPSLYYG--D
K5ZBN2          VAL-NDTV---------------------------------STPIGKVVVTPSLYYT--D
A0A0J6CKW3      VAL-NDTV---------------------------------STPIGKVVVTPSLYYT--D
A0A0F5IQM7      VAL-NDTV---------------------------------STPIGKVVVTPSLYYT--D
S0GLB0          VAL-NDTV---------------------------------STPIGKVVVTPSLYYT--D
A0A3R6NLC1      VAL-NDTV---------------------------------STPIGKVVVTPSLYYT--D
A0A416WYC9      VAL-NDTV---------------------------------STPIGKVVVTPSLYYT--D
A0A0F5IT40      VAL-NDTV---------------------------------STPVGKLVVTPTLYYA--D
S0GSI7          VAL-NDTV---------------------------------STPVGKLVVTPTLYYA--D
K5YB65          VAL-NDTV---------------------------------STPVGKLVVTPTLYYA--D
A0A0F5IWP9      VVL-NDTV---------------------------------ITSIGKLVVTPTLYYS--D
A0A0F5IZT8      VVL-NDTV---------------------------------ITSIGKLVVTPTLYYS--D
A0A417LKQ2      IAL-NDTV---------------------------------TTPVGKLVVTPTLYYS--D
A0A416TME1      VVL-NDTV---------------------------------ATPAGKLVVTPTLYYS--D
A0A416XPE8      VVL-NDTV---------------------------------ATPAGKLVVTPTLYYS--D
L8JI02          FDEINLRE---------------------------------VVEAGKPFRTHSLAFTIRP
A6EBM4          ---GKEDI---------------------------------RKNFRFNSRIKVGNVSFMI
A0A2N3U785      -----KET---------------------------------LHEFGQKIVLPYATFTVTA
A0A0E3ZG78      -----KMY---------------------------------TYKFGQQIQKPYGVFTVVP
A0A1I6BRK6      -----ITT---------------------------------SHRFGQKIHKAFGSFTVIT
A0A243WAB1      -----TVT---------------------------------SHSFGQQIAKPYGLFTIIA
A0A399SH26      -----DGK---------------------------------SYPLNKSIRMPYGVIKFIP
A0A0E3ZGV6      -----DSK---------------------------------KYSIGTWEKTPYGVMLFSE
A0A1I2N4S1      -----DGK---------------------------------EYPLSTWVVTPYGEMLFEK
A0A2T5YE44      -----DGK---------------------------------EYPLSTWVVTPYGEMLFEK
A0A1M4YED3      ------------------------------------------YPMNKFVTTPFGVLKFTK
A0A3P1Z8V4      KVPFGVKT---------------------------------KTPIGTLTLYKETPFRRFP
A0A2L2WX98      SIAVGETK---------------------------------KTPLGNLHLIADTYIDKMP
G5GD56          SVRPGVMV---------------------------------KTPIGDLAINKTTFFSRFP
R6A0L2          DVQLGQMT---------------------------------QTPYGPLCVVRGPGFGRWT
R7LG80          KANFGQTV---------------------------------KTPAGRLSVVRSKMFNKWE
A0A1M6XHU0      ------------------------------------------------------------
D0MHQ9          ------------------------------------------------------------
G2SF81          ------------------------------------------------------------
A0A2H3NSN0      ------------------------------------------------------------
A0A2P6C324      ------------------------------------------------------------
A0A126PFG0      -------------------------------------------------TPVPAFAL---
A0A3M1N7Z3      -------------------------------------------------LPGASSAQLRI
R7PCR1          ------------------------------------------------------------
A0A2A8CVM9      ------------------------------------------------------------
A0A3C0ZQC7      ------------------------------------------------------------
A0A2E3R1D0      ------------------------------------------------------------
A0A2T2USC0      ------------------------------------------------------------
A0A2T2V0F3      ------------------------------------------------------------
A0A2T2S682      ------------------------------------------------------------
D5H561          -------------------------------------------------GGASGDDPSPV
A0A2H3NWA9      ------------------------------------------------------------
A0A2A8CVB6      ------------------------------------------------------------
A0A2P6C1S6      ------------------------------------------------------------
A0A2T2UTM4      ------------------------------------------------------------
A0A1T5MMH4      GRY-GAPV---------------------------------HISGIELTLRKNEN-----
A0A2W4R1L8      GKY-GEPI---------------------------------DLNGLTVTIHRNPA-----
A0A2E5CV79      RIL-KEIM---------------------------------SLGIYSPEIEKE-------
A0A2A4G4B1      LHF-NKEI---------------------------------GYENVRFRIIPLLDINALK
A0A2D4ZVH1      -------------------------------------------------VDST-------
A0A0E3V905      YPV-NHAI---------------------------------ETPYGRLKIVTKK------
A0A1M6GR99      FSI-NGNVGQVV-----------------------------ETDDFKILVTIN-------
A0A1M5BA90      YSL-NKWI---------------------------------STPFGVARITRNLN-----
A0A1V9F098      FPI-NQWV---------------------------------STKYGELKFEKNER-----
A0A1V9FHD0      YPM-NTWC---------------------------------NTPYGVLKFEKNAR-----
A0A1T5CS78      YSL-NKWF---------------------------------EISNGQTIMFVK-------
A0A0Q9Z8F1      YSL-NEWF---------------------------------EFSAGQTIMFVK-------
A0A2N0U0M7      YSL-NEWF---------------------------------EFSAGQTIMFVK-------
A0A1M6TTV4      YKF-GEMI---------------------------------SHRLGELTIQKT-------
A0A1Q6IT42      GFF-TTLA---------------------------------EMEAASFPIKVDYGEGIVI
K0X1U5          GFF-TTLA---------------------------------EMEATSFPIKVDYGEGIVI
A0A416XAH0      GFF-TTLV---------------------------------EMEATSFPIKVDYGEGIII
R5EXK3          GFF-TTLV---------------------------------EMEATSFPIKVDYGEGIII
A0A401UAP7      -NF-GKVV---------------------------------QMEGFKVLIESAKG-----
A0A1W2GF52      QQF-GNPI---------------------------------VTKDFSFTLEKT-------
A0A2G5L7B8      YPF-GKKI---------------------------------NTAFGELIVSKT-------
A0A0D3LFR6      YRF-GQAV---------------------------------ETGSFNLTLTLL-------
M7N6D4          HRF-GQTV---------------------------------ETDPLTFSLSLR-------
A0A364XUP5      GKF-NEPI---------------------------------NLDASVVTIKRN-------
A0A1M5RLA9      GRY-NSKV---------------------------------SLNGVDLYIEKN-------
A0A385SFR9      GRY-NSKV---------------------------------SLNGVDLYIEKN-------
L8JW09          YNF-GEHA---------------------------------NLPDIEFIIYLT-------
A0A1Q3ZMZ7      FVF-GKLI---------------------------------STPHFEVIINGD-------
A0A2D8JJW3      LHS-DNTVFDLSGVVIPDGDFKDGCDLPKYRQLHVLNTRDYKPVGWRETFNSAISLFGLW
A0A2W2AFF7      GKF-GQTV---------------------------------SLPIGKLQVIKNP------
A0A2N5YXE2      ISP-EEWQ---------------------------------SVFGMEVFIHFP---SKKD
A0A2I0QZ80      IQP-NEIL---------------------------------KNNLFDIKMKVN-----DF
A0A2U2XBJ3      FAP-NSLL---------------------------------KTPFFDMRVIVD-----NW
A0A3E1F1A3      FIP-NSLV---------------------------------QTPFFKMRVDIL-----NW
A0A1V9F383      YPL-RVWC---------------------------------NTRWGELKFIPNDR-----
G8TRZ6          YPL-REWC---------------------------------QTRWGVVKFMPNER-----
A0A2W1NDY9      VAH-DQLV---------------------------------DNEYFKFVFKIN-----NE
A0A1G0CI31      KPI-NSRF---------------------------------SNQHFDIAFKVD-----NI
F2IKD6          SAI-NQTI---------------------------------KTSHFEIGFKVN-----NW
A0A1I7BM74      VFL-NQAH---------------------------------KNEFFHIFIKSE-----NE
A0A2G2FJ17      IES-NKLL---------------------------------ATPYFDLEIEIP-----NW
A0A416X8R7      FLF-GDTI---------------------------------ISAAGRFIVEDI-------
K0XJ09          FLF-GDTI---------------------------------ISAAGRFIVEDI-------
R5EUZ0          FLF-GDTI---------------------------------ISAAGRFIVEDI-------
W0EQS0          IAF-GDTL---------------------------------VSEAGRIVVEAV-------
A0A1Y3WE15      IAF-GDTL---------------------------------VTNAGRMVVTAV-------
A0A1Y4GUK3      IAF-GDTL---------------------------------VSDAGRIVVESV-------
A0A2U1FKU2      GTF-GQPV---------------------------------ATPVGELQIDQT-------
A0A0A2F954      GSF-GRPI---------------------------------ATPVGELKLDTT-------
A0A0A2FW91      GSF-GRPI---------------------------------ATPVGELKLDTT-------
A0A2D2N2N1      GSF-GRPI---------------------------------ATPVGELKLNTT-------
Q7MWZ2          GSF-GRPI---------------------------------ATPVGELKLNTT-------
T2NDT6          GSF-GRPI---------------------------------ATPVGELKLNTT-------
W1R7P9          GSF-GRPI---------------------------------ATPVGELKLNTT-------
A0A1R4AFZ0      GSF-GRPI---------------------------------ATPVGELKLNTT-------
A0A1R4DVZ7      GSF-GRPI---------------------------------ATPVGELKLNTT-------
A0A1G9E2A9      FLF-DKSY---------------------------------ENQHFRFEIHKT-------
A0A2T2YJE8      HTI-GKPV---------------------------------EKPGFSFTLTLR-------
A0A3M9N829      ATV-GQPV---------------------------------NISGNNITITTT-------
A0A0P0CSF9      YTV-GNPI---------------------------------TVSGSTFSINPV-------
A0A3M9MNC3      HAV-GVPF---------------------------------ALSGSTITVNSL-------
A0A2M6GH67      YKV-GEPI---------------------------------NKKEIYLVLNRT-------
A0A127B287      HTV-GSPI---------------------------------SLSGNNINVLTN-------
A0A369QP10      HTI-GEPV---------------------------------QKPGFTFTLKLT-------
A0A418R9X5      LKF-GQPI---------------------------------DIAGFTLYMYKT-------
A0A428JSJ3      LTF-GQPF---------------------------------QAAGFTLRVYKT-------
A0A428KI59      LSY-GQPI---------------------------------EAAGFTLQVYKT-------
W8F1I6          LSY-GQPI---------------------------------EAAGFTLQVYKT-------
A0A246FQC0      YRF-DEPF---------------------------------TAAGFRLVISKA-------
A0A372E5P8      HTF-GQPF---------------------------------TAAGFRLTIRQT-------
A0A1H3EMW1      HSF-GQPF---------------------------------TVAGFRLTVRPT-------
A0A1H9ZSN3      HTF-GQPF---------------------------------TVAGFRLTIRKA-------
A0A0M3RW20      KVV-GSAI---------------------------------IQPGINLQLNLT-------
A0A1S9B3W0      YRF-GQPI---------------------------------TTPGFTLELQPT-------
A0A1W1VRL3      YSV-GQPL---------------------------------NLAGLDLRLTTH------G
A0A1M6R305      HTV-NQPF---------------------------------RIGGMTLRLRPT-------
A0A2M9B9H9      YTL-GQPV---------------------------------VVPGMTLVVTAT-------
A0A126PDF2      YDL-EKQV---------------------------------SLPGLDLKVTPT-------
A0A2Z3GKA1      YNL-GQQV---------------------------------SLPGLDLKVTPT-------
A0A328BL48      YSF-GETL---------------------------------TTPGFTLTLVRT-------
A0A3S0QKV1      YQL-EQPV---------------------------------TTPGFNLRLVPT-------
A0A3R9P8H7      HTI-GTPF---------------------------------TAGGFRMEVRKT-------
A0A212UCJ7      AIL-GNQI---------------------------------ETLGFWFRIYPT-------
A0A238WIA7      TGF-DAPV---------------------------------ETTGFRLRLYRT-------
A0A0W8EDI5      GVF-NQPL---------------------------------KIGNSFIVLKPT-------
A0A3B7RBP8      GKI-NQTL---------------------------------NIEGSSISVYST-------
A0A1I5WSL8      YAL-GQTI---------------------------------DLSGITLQIVGT-------
A0A0U3JVM7      YSL-GQEI---------------------------------KLPGITLAVLGT-------
A0A1G1SSV2      YAL-GQQI---------------------------------TFPGIQLQVLET-------
A0A1G1SXV7      YAL-GQQI---------------------------------KFPGIQLQVLGT-------
A0A243WHR7      YRF-GQPI---------------------------------VTPAMELVLAST-------
A0A076HRT9      YAL-NQPI---------------------------------RLGGMTLRILPE-------
A0A1M6DHW8      YSL-GQPI---------------------------------VLPGMELLFIGT-------
A0A3D1KEX9      VSY-GQSF---------------------------------NSPAGNIRISQA-------
A0A358Y7S2      LKP-NSRF---------------------------------KNPQFDIMFKVK-NIDELK
A0A1X7J248      QKF-GQEF---------------------------------IVDGCKYKLEIT-------
E4TQD2          QKF-GEYF---------------------------------TFNGCGYKLETT-------
A0A2J6HHN3      FQP-YESV---------------------------------VLPKVIFSVEPV-DTVNFM
A0A1Y3WMT8      GFF-TTLA---------------------------------ETEATSFPIRVDYGEGIVI
A0A1Y4GQU1      GFF-ETLA---------------------------------ETEATSFPIKVDYGEGIVI
A0A1V5W8T5      IKR-NEWT---------------------------------QIQGLKLYVNII-NVEQIL
A0A2T8HKA9      IKL-REET---------------------------------TTPIGKLTISSN-------
A0A3B8INU3      HRF-GETL---------------------------------SVPHLDLRLEST-------
A0A098LL25      HYF-GEKI---------------------------------STDNYSFTLYPT-------
A0A1Q3Q573      IKP-EQKL---------------------------------KTPYFQATISLK------P
A0A357YNR3      NKN-NFHY---------------------------------NLSPGDSTLKFPFGEIEVA
F4KK08          ATL-GDTI---------------------------------ATPIGKVVVEAT-------
A0A3N2N6F7      VTL-GDTV---------------------------------STSFGRMVISAG-------
A0A419VXB7      GVF-GEKF---------------------------------ENRYFSFTLQKK-------
A0A2V1ILM4      VNI-GDTV---------------------------------ATSFGPITINPG-------
A0A3N2L0E8      VNI-GDTV---------------------------------ATSFGPITINPG-------
A0A3N2LFC5      VNI-GDTV---------------------------------ATSFGPITINPG-------
C3J7R8          VQI-GVPQ---------------------------------DTPMGRVLVTATEHFPSSE
A0A0B0BTJ4      ITG-AFGE---------------------------------TIRDTVGVFRLE---RAVA
A0A3B9CNN6      ITG-AFGE---------------------------------TIRDTVGVFRLE---RAVA
R5X290          ITG-AFGE---------------------------------TIRDTVGVFRLE---RAVA
A0A1Q6E6I7      ITG-AFGE---------------------------------TIRDTVGVFRLE---RAVA
A0A2G2F510      GYV-NEHL---------------------------------KNEDFDVVVKVI-SDDALR
A0A316JZ08      GPL-NKHV---------------------------------TNDDMNVVVKSA-NPKVFR
A0A1I1FXP9      FNF-DKTY---------------------------------ENQDVKFKIT---KTPFYK
A0A3B9FXJ0      LEY-NKPY---------------------------------STPAFSISVSRNGKGKVLA
R5GSU5          VAY-GQRI---------------------------------ATPAGNVYLTRKMNLEGLE
A0A2P8EAX2      FNF-GDKI---------------------------------KTEFGVFSLEKKSEEDAIS
A0A3N4H5N3      FEF-NEKI---------------------------------RTNFGVFSLVKKEEEGERL
A0A2A3UE91      FAL-NSWL---------------------------------KTADFDINIYLN-PNIQAS
A0A0A2G557      SSA-PKMI---------------------------------VSLGETIETPIG-SFFLTS
A0A2N2WFW8      FRF-HETV---------------------------------SLPQVNFLLT---PVAGDA
A0A1F3IU95      FRF-HEPV---------------------------------SLPQVNFVLT---PINNDA
A0A3D0VUF6      FRF-HEPV---------------------------------SLPQVNFVLT---PINNDA
A0A1T4PT95      SPL-SDRV---------------------------------VLFGETIETPIG-SFVLTG
A0A3Q9FR88      GKS-GQRF---------------------------------SLGGRPIIIRSK-------
A0A150ADJ9      GIS-GKPL---------------------------------FFEGADIIIEPN-------
A0A1B1FWQ4      GSS-GESI---------------------------------ILGGQSLIITPK-------
A0A1S1Z228      GKS-GEQI---------------------------------ILGGQPLIVTPK-------
A0A1F3SJM1      GNL-NEHF---------------------------------VNDDMDVVIKST-NKQLFI
A0A2G2EB96      GKL-NERI---------------------------------KNEDFDVVVKAT-DPHSFY
A0A2G6PRA9      GML-NEHI---------------------------------QNSDFDIVVKAA-DPDNFH
A1ZKR2          YRF-DQPI---------------------------------VTSYYSFKVI---KTSFYK
A0A1Q3GX01      YKF-DQTI---------------------------------NHSGLSFKVI---KTPFYK
A0A349DQI4      YKF-NQTV---------------------------------KYPGFSFKVI---KTPFYK
A0A2N3IIZ0      GKF-GEWL---------------------------------KNKDVELLITQKMPLSTYS
A0A2A4PYG9      IXI-GXWX---------------------------------ALEHLEVKIDVT-DFSLIS
A0A2A5FYT6      API-NEII---------------------------------ILPHVNLRIKDV-DFIQIT
A0A2E6SYP1      VPV-NTWT---------------------------------DFEGLALKINIS-NINQNK
A0A2E5RLE8      IPV-NKWV---------------------------------SIDGLELKINIS-NRKLNE
A0A2E7TQF6      IPV-NKWV---------------------------------SIDGLELKINIS-NRKLNE
A0A2E6GVY9      IPV-NKWI---------------------------------SINGLELKINIS-NRNLND
A0A350JJ90      FAE-EDTI---------------------------------QTPHFSFTIV---RLDEAQ
A0A3M1CDV2      FHI-NTWT---------------------------------KHEWLDFFIRLN-EKRDTT
A0A2E2TFD1      FKI-DGDI---------------------------------ELPFVTLSIKIL-DFDIIK
A0A2E4ELE6      STN-KWE----------------------------------DLGFVELKFIII-DFDIIK
A0A2E3XZI5      IEA-NKFF---------------------------------SSKYISGILKIDWELEEFK
A0A2M7NLQ9      YKF-NTRI---------------------------------KNQYFKLIISLS-DTFDKL
I4AFR0          YKF-NTRI---------------------------------KNQYFTLIISLN-NTFDKL
A0A2N2Y3E5      IKT-GEWL---------------------------------NFYGSWLRIEIR-DTAALL
A0A2D9D7T6      GEL-NKPI---------------------------------KTKSFEIIVKAK-NKFGIT
A0A1F3PPL5      LSV-GKWE---------------------------------NINGIDVKVTIT-NYKGIE
A0A357QK06      LSV-GKWE---------------------------------NINGIDVKVTIT-NYKGIE
A0A2A5B3B0      FNV-NETI---------------------------------NHPKVELKISLL-DKDLYV
A0A0F2NS19      FSS-NVPI---------------------------------ELKEVTLRIVFD-NYNEFG
A0A2A5H8X6      FSS-NVPI---------------------------------ELKEVTLRIVFD-NYNEFG
A0A2H0GAU8      FEV-DTPI---------------------------------KLKQVDLKIQID-EYESLK
A0A2M8FTK1      FEV-DTPI---------------------------------KLKQVDLKIQID-EYESLK
A0A0S2HYK8      GEA-GKWT---------------------------------DLGILSCKAEIL-RYNVIK
A0A2N5ZWN6      IEI-NEWN---------------------------------ELGYFKIFVTIN-NFAAIQ
A0A2E0FJ09      ESL-NESF---------------------------------STEHFICSIQIS-DLNRFY
A0A1F3FZ62      FYF-NETV---------------------------------KLPEMEFVLKLN-PKSSIK
A0A1F3K211      FYF-NETV---------------------------------KLPEMEFVLKLN-PKSSIK
A0A1F3KLL5      LKP-DRWN---------------------------------KINKTEIKININ-NIDDLL
A0A359D1M1      LKP-DRWN---------------------------------KINKTEIKININ-NIDDLL
A0A2E7CT70      IKP-GDFF---------------------------------SSNYISGKLIID-DIPTFS
A0A2D5V560      ILP-NKFF---------------------------------SSEFISGKLKFS-S-NNWK
A0A2D7K5A8      ILP-NKFF---------------------------------SSKFISGKLSFS-N-GNWK
A0A2E1XQ82      ILP-NKFF---------------------------------SSKFLSGKLSFS-N-EDWK
A0A1V6I2U9      IQP-EELQ---------------------------------TIYGMDIYVHFP-SKKDLE
A0A1F3C1M2      FTI-GEWI---------------------------------DLDLIEFKLTVN-NYNAIL
A0A1F3DS87      YTI-GEWI---------------------------------DLSLVELKLTVS-NYTAIL
A0A2H0B957      LKS-NAWT---------------------------------DIGGFEIILNIT-DLAAIR
A0A1F3CFW6      IKK-NKWT---------------------------------DINGLEIKIEVT-DIDAIR
A0A2M7E2T8      IIK-NQWT---------------------------------DINGLEIKIEVT-DIDAIR
A0A2M7NC69      IIK-NQWT---------------------------------DINGLEIKIEVT-DIDAIR
A0A1F3K695      IYS-NVWS---------------------------------NIGLAEIKLKID-DTSQIQ
A0A353KZR1      IYS-NVWS---------------------------------NIGLAEIKLKID-DTSQIQ
A0A2N2WYB5      IEL-NQWT---------------------------------AIQGGEIKVSIL-NIDDIE
A0A1F3K4G0      IEI-GKWS---------------------------------AIRADSIRCTVS-DYLTIE
A0A356H8Y3      IEI-GKWS---------------------------------AIRADSIRCTVS-DYLTIE
A0A351HSA6      IEI-GKWS---------------------------------AIRADSIRCTVS-DYLTIE
A0A1F3Q014      FIS-NKWM---------------------------------KFPEMDLFISIK-NFTEIA
A0A2A4YXP3      YQT-NTTI---------------------------------HLPKVDLKITLL-RKE---
A0A2D5KD44      FYA-GKSC---------------------------------HLPFAEVIVTVT-DYSRIK
A0A1F3R158      FSD-REKI---------------------------------QTNLAEFTVIFN-NYEEAK
A0A2M8ADX2      FIN-NQDI---------------------------------KLSKVDFKISID-GYEELK
A0A1J5B2H0      FGL-TEKI---------------------------------VFQDVDLDVKVT-NPEVVF
A0A1V5N756      FSI-LDTL---------------------------------KTEYFDMFVTLK-DPG-YF
                                                                            

A0A1I3J6V0      ------------------------------------------LD----------TVIIHV
A0A1H4ADG3      GSQ----------NIKMDVSSINAVADGFKENINAEI-----SD-------KQ-TSIINL
A0A3D5KRY6      DEE-----------YVLIFNDLSRMALAYKEKLVVKALSAIDPT-------IN-SNMITL
A0A1V5IPN7      ------------------------------------S-----SK-------RD-TDILNL
A0A1V3WH52      GGE-----------FTVTKFSTLGMINNLQNNLTVTE-----NG-------KD-TGVLSM
A0A2K8Z965      IKK-----------MIVQVSKQTSAAKSYLSNLHVIP-----TG-------KG-STVILI
A0A418M8U8      TNQ-----------VLVQAMKRPAAVNGYLRTLQAEP-----TS-------KA-STVVVL
I2GTA4          TNQ-----------VLVQAMKRPAAVNGYLKTLQAEP-----TS-------KA-STVVVL
A0A2K8ZAJ2      LKP-----------IFATVSLHNDAVEGYLGNLKIGS-----TT-------ML-STVLVM
A0A368JPA3      NEP-----------LVVQVMSPAQTIRYYQSKLTVAP-----SG-------KE-STVLVL
A0A3P1BT12      NEP-----------LIVQVMEHPQAIRYYLSKLNVEP-----SS-------KT-STVLVL
A0A3P1CI15      NEP-----------ILVQVMTDPQAIRYYLSKLTVEP-----SS-------ST-SSVLVL
A0A1Q3PII2      HYL-----------YSFKISTEESVLDLYTRVLNIYA-----PN-------KT-ASLVNL
A0A351BXT2      ------------------LISVSSLADILSQIVKIDQ------K-------RG-LDVVDI
A0A3D0MYJ7      ---------------TYNLINEDGLRKRLEGMASITA-----P--------KN-LNIIDI
A0A3D3LS70      -------------------ILQDELTELLGGIVSISQ------K-------RG-LDIISI
A0A1G7ZF38      HYQ-----------YSFKISATETILDHYDRVLRIQA-----PN-------KA-ASLVNL
C6VS52          LYQ-----------YSFRTLAKETVVDHYARTLSIQA-----PN-------KI-ASMVNL
A0A1G1TM36      GGE-----------VRIRTSSPEAVVQAYQKLLDIEL-----IN-------KV-APAIRL
A0A1V3WH27      GTQ-----------FSLKSLTRLETINALKKRLTVAE-----SE-------KQ-SGIITL
A0A0D3L8Q3      M------------TVRVHFNNIQRLASNYSDRLVVEK-----DK-------LAWSSALIL
A0A0K8QSK7      IRVKENAPSGLSGTYAIEFNTVQQTGKLYASRLTVAQ-----SN-------RQ-TSILTL
A0A1V6CN82      INLNEGFFPPVTDYFFFRFHTPDELINAYRSRMTVSL-----RD-------WE-TSIVDI
A0A1M4XZ45      ILLNEKFNPNAANSYKFRFNTKKSLVDKYRKSLEVTL-----SG-------KE-TSILNL
A0A399D319      ILLNELFDSNASNNYKFRFNSKKALLKRYREQLDVTL-----ND-------KE-TSILNL
A0A0P7X1V8      ----------------------DTVFARLYGNLTFTR-----AD-------RN-SNLLRV
A0A3B0C2S4      I------------QFRVVLKSVKDAVFALSEKLQVQP-----TD-------KR-SEVLSL
A0A416GA42      REL----------EIEVLKSTVRNTGNALVARLGVAK-----AS-------KE-SSMIQL
A0A3N2M1H3      GLPITESI-----ELKVVKKPMQTTVENYGEKLNGDL-----VN-------QD-AEIIGL
A0A1T3IYP5      DYYGT--------DVFVAKYPREVIMSQFVANLKIKQ-----ME-------ED-ASLLQV
A0A212K7W5      VYYNQQ--------ILFVKSNLRSIVNHYTNALNVGL-----SN-------ED-ATIIDI
F5IU11          GYYDQK--------ILFTKFNLRGIVNNYTNALNVGL-----SN-------EN-ATIINI
A0A352Z1R7      ----GD-------NFRLKLLPLQNIAVSLKGGFKATE-----VG-------NR-TNIVRI
A0A0A2F501      DKSKTRPS-----QIYVSYQNLYNVQELYSSGLKASI-----NN-------DK-ASIIDI
R5B7P0          -EAMKK-------PVNVRKSGQRGVTQSYLNRLQVNL-----AD-------KN-ADVISL
R5B0L5          ---SGM-------TIYVTKMPLQTAASIFSGRLTVAL-----KE-------KL-GNTINL
A0A374THP7      FVKNGDAP-----VLYVSRSNIYAMTDRIKGSLAASL-----SE-------EK-STVIDL
A0A3R5XWG1      FIKGGDAP-----ALYVSHTDLYSMTNRILGSLTVGL-----NE-------EK-TTIVNL
A0A414YFM3      FIKGGDAP-----ALYVSHTDLYSMTNRILGSLTVGL-----NE-------EK-TTIVNL
A0A0A2EVS5      EKSIQTPM-----TIHVSRSNLSTTMAECQKRLQVGL-----IN-------DK-TSILEL
A0A1T4NAJ7      EMSIQTPM-----TIHVSRSNLSTTMAECQKRLQVGL-----IN-------DK-TSILEL
A0A2V1IJY1      --GEAV-------ELNVVKAPVSATAGGYESRMVIAM-----SG-------DK-SSVINL
A0A3N2KCL3      --GEAV-------ELEVVKAPVSATAGGYGSRMVIAM-----SG-------DK-SSVINL
A0A255T941      -DFIGE-------KITYSKQNIDDLADALSTKLVAEL-----DN-------KE-GTVITL
A0A1Y4CHN5      --TFDS-------DVYVSRSTIYGAVQSYSQRLSVGL-----AN-------ED-ATIINL
A0A1Y3V692      -SFVGT-------SIRYNKGSVRAVTDYYATALRADL-----GN-------ED-ATIINL
A0A174TYU6      -SFVGT-------SIRYNKGSVRAVTDYYATALRADL-----GN-------ED-ATIINL
A0A1M6I2S6      -SFVGT-------SIRYNKGSVRAVTDYYATALRADL-----GN-------ED-ATIINL
F3PXM2          -DFMGT-------SIHYGKQSVQAVTDYYTGALRAEL-----GN-------ED-ATIINL
A0A3E4ZNL4      -SFIGS-------TIHYSKNSADKVADNYAQALRAEL-----GN-------ED-ATIINL
A0A174AHH7      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A174JCE8      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A3E4JMC4      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A412SND6      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A414IEQ9      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A415UKN5      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A0M1W8D8      -SFTGS-------TIQYSKEPADAVADSYTQKLRADL-----GN-------EN-ATIINL
A0A3R6GKX5      -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A7V4S1          -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
B0NU19          -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
D4V601          -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A0A397WLT5      -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A0A3R6GM96      -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A0A015XH67      -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A0A078RZN2      -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A6L0K5          -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A7ACT5          -FFTGS-------TIQYSKEPADMVADSYTQKLWAEL-----GN-------ED-ATIINL
A6KY94          -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
A0A173UQR8      -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
A0A3R6HK75      -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
A0A412B7D1      -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
A0A412VNY9      -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
A0A414LTU9      -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
I9Q4U4          -SFTGS-------TIRYSKESADMMADSYTQKLRAEL-----GN-------ED-ATIINL
A0A373ISF0      -ACIGT-------SIRYAIGKADGAADRYLNALRVEL-----GS-------KE-ATIINL
U6RF62          -ACIGT-------SIRYAIGKADGAADRYLNALRVEL-----GS-------KE-ATIINL
A0A073I794      -SFVGT-------SIRYGKGDVRAITDYYTTALRAEL-----GN-------ED-ATIINL
A0A108TH71      -VFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
I8VXH0          -VFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
A0A412S0N6      -VFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
A0A412IIJ0      -AFIGT-------SIRYVRGSMRAAVDTYSNALVAEL-----GN-------ED-ATIINL
A0A0P0FM97      -AFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
R6KTP3          -AFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
A0A139LU87      -AFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
A0A1C6B3Y5      -AFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
E2NMQ4          -AFIGT-------SIRYVRGSVRAAVDTYSNALVAEL-----GN-------ED-ATIINL
A0A412YDB9      -AFIDT-------PIQYVRGSVSAAADTYANTLVAEL-----GS-------DD-ATIINL
R7DY01          -AFIDT-------PIQYVRGSVSAAADTYANTLVAEL-----GS-------DD-ATIINL
A0A414LGK8      -AFINT-------PIQYVRGSVSATADTYANALVAEL-----GS-------DD-ATIINL
A0A016E4F9      -SFVGT-------SIHYNKGSVNAVTDYYTQNLRAEL-----GN-------ED-ATIINL
A0A413PP50      -SFVGT-------SIRYGKGGVRAVTDYYAAALRADL-----GS-------ED-ATIINL
A0A3A5TI83      -SFVGT-------SIRYRKGNVCAVTDYYTAALHAEL-----GN-------ED-ATIINL
A0A415NEB6      -SFVGT-------SIRYRKGNVCAVTDYYTAALHAEL-----GN-------ED-ATIINL
A7AJ60          -SFVGT-------SIRYRKGNVCAVTDYYTAALHAEL-----GN-------ED-ATIINL
A0A015UXN7      -SFVGT-------SIRYRKGNVCAVTDYYTAALHAEL-----GN-------ED-ATIINL
A0A395YYT3      -SFVGT-------SIRYRKGNVCAVTDYYTAALHAEL-----GN-------ED-ATIINL
A0A415IPQ4      -AFTGT-------SILYSRGSVRAAADTYANALVAEL-----GN-------ED-ATIINL
A0A3E5BRW7      -ALTDT-------PVRYARRSVRDVADAYTRELVAEL-----GN-------ED-ATIINL
K9DXS6          -ALTDT-------PVRYARRSVRDVADAYTRELVAEL-----GN-------ED-ATIINL
A0A1M6KFV3      -AFMGV-------PIRYVRRNVRSVSDAYAKELVAEL-----GN-------ED-ATIINL
A0A1Q6G7L3      -AFMGV-------PIRYVRRSVRSVSDAYAKELVAEL-----GN-------ED-ATIINL
A0A413H235      -AFMGV-------PIRYVRRSVRSVSDAYAKELVAEL-----GN-------ED-ATIINL
A0A1M5B2J8      --GQET-------EIEVIRSTIKGAVGDASSRLSVVQ-----ND-------EK-SNIISL
A0A255RCT5      --GQEA-------DVEVLRSTLKEAVAGASSRLTVSQ-----DD-------EK-SNIISL
A0A1Y4GLF5      --A-PC-------TLYVDRSTLYSAVNAYSANLSVSL-----NN-------EK-ASVIDL
A0A1H3XSC0      --KEPY-------TLYVFRSSLHGTVGQYSSNLSVAL-----SS-------EK-TSIVNL
B3JI46          --GEAY-------TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A174UR09      --GEAY-------ILYISKSSLYNAVNSYSSNLSVSL-----NN-------EK-ASVIDL
A6LE40          --GEAY-------ILYISKSSLYNAVNSYSSNLSISL-----NN-------EK-ASVIDL
R6NN15          WQKSSE-------PLTVSRSGLNSAVSRYSAGLSVAL-----QS-------EK-TTIVDL
A0A358R8U0      --DRGC-------QLKVSRTGLYGAVGSYSGNLTVTL-----SD-------KK-ASAIDL
R6WSB6          --DRGC-------QLKVSRTGLYGAVGSYSGNLTVTL-----SD-------KK-ASAIDL
A0A401LPX7      --KTES-------TIYVTRQSLSAASAGCSANLTISQ-----ND-------EK-SNIITL
A0A3A5Z900      --KIES-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A3R6I893      --KTVS-------TIYVTRQSLSAASVGCSARLNISQ-----ND-------EK-SNIITL
A0A3R6EGW5      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A285TGL6      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A3A5RFX4      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A1Q6IUW9      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A3R6NPG7      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A413XDP6      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
K6AP24          --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A076IQN8      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A078RYI7      --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
C7XEQ8          --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
D7INX6          --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
K5ZG55          --KTVS-------TIYVTRQSLSAASAGCSARLNISQ-----ND-------EK-SNIITL
A0A3N2N9B8      ----KQPI-----ALKVNRLPLDAARASYSSRLSVTQ-----GS-------DN-SSLIRL
A0A3N2NMI0      ----GTAI-----ELEVNKIPVKTAQAIYSSHLGVSQ-----SG-------EN-SSVIRL
A0A359I8H7      GKKNKPVT-----KIIVERDGMQSTVETYGGLVKADL-----AD-------KD-ADVIDL
A0A3N2KA63      GKKNKPVT-----EIIVERDGMQSTVETYSGLVKADL-----AD-------KD-ADVIDL
A0A3B9FAU3      FVT-HTKD-----PILVTRTDLYTKTEGVQRNLSVEL-----TD-------KM-STLVRI
A0A3C1E5L7      FVT-HTKD-----PILVTRTDLYTKTEGVQRNLSMEL-----AD-------KM-STLVRI
A0A354SN68      ---AFITS-----TICVRKCNITSATERVQRMYLATG-----RE-------DG-SSVVNI
A0A0A2DUD9      ----DLVN-----GLIIKRSSLYDAVENLGKNLTVNL-----AD-------EK-STILSL
A0A3N2N595      ----GDLI-----DLEIDKKPLGWAVATYLGNLMVSL-----NN-------KE-GTVIDL
R5FHS9          -WPGGLYA-----NLYVTHVPMMSAMSSYQKGLSVSL-----AD-------NK-AAVINL
A0A3P1ZBJ5      -----LKK-----SIQVVKYPLSDVVD-YFGRINVEL-----KE-------KE-STMVDI
A0A413TW79      FVNGYESR-----KLHVTRTNLYAMTDHIKASLSASI-----SE-------EK-ATVIDL
A0A3E5E9M7      FVNGHESR-----KLHVTRTNLYAMTDHIKASLSASI-----SE-------EK-ATVIDL
A0A3E4SK73      FVNGHESR-----KLHVTRTNLYAMTDHIKASLSASI-----SE-------EK-ATVIDL
A0A415GGC6      FVNGYESR-----KLHVTRTNLYAMTDHIKASLSASI-----SE-------EK-ATVIDL
A0A413DBH9      FINGHESR-----KLHVTRTNLYAMTNHIKASLSASI-----SE-------EK-ATVIDL
G9S1S8          ----QFSQ-----PIYVSRSGLYSAVRRYAPNLSVVL-----ND-------EK-STVVDL
A0A354M4S6      ----QFSQ-----PIYVSRSGLYSAVRRYAPNLSVVL-----ND-------EK-STVVDL
R7DH52          ----QFSQ-----PIYVSRSGLYSAVRRYAPNLSVVL-----ND-------EK-STVVDL
A0A396N3D5      ----QFSQ-----PIYVSCSSLYSAVRRYAPNLSVVL-----ND-------EK-STVVDL
A0A415ZDP9      ----QFSQ-----PIYVSRSGLYSAVRRYVPNLSVVL-----ND-------EK-STVVDL
A0A016CWA4      ----GEAY-----TLYVDKSGLYNAVNSCSSNLSVSL-----NN-------EK-ASVVDL
A0A1C6H117      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A415TAH7      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A0M1W0V2      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A139KA16      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A174VQ92      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A1Q6HCG0      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A1Y4JYM9      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3A5QW67      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3A5RQE6      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3A6BP07      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3E5E153      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3Q9IP20      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A412WV15      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A413ICP6      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A414KYB9      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A416X133      ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
E5WX00          ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
K0X3P3          ----GETY-----TLYVGKSSLYDAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3A5Z014      ----GESY-----ILYIDKSSLYNAVNSCSSNLSVSL-----NN-------EK-SSVIDL
A0A1M4YZ07      ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A078S3Q8      ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A069SJV7      ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3E5DXI5      ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3E5EM98      ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3E5F453      ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
I9T3G6          ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A0P0FQW1      ----GEAY-----TLYIGKSSLYNAVNSYSSNLSVSL-----NN-------EK-ASVIDL
C3RFN5          ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A3E4SYU0      ----GESY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A6LGY1          ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
K5ZSH4          ----GKAY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A078T2W6      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3R6D1V4      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3R6EAF7      ----GESY-----TLYVGKSNLYNAVNSCSSNLSVSL-----NN-------EK-ASVIDL
A0A412MJT7      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3E4WKT5      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVINL
A0A3A5YY33      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A078TAH2      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A1E9CFZ7      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A373FYU5      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3A5TZ72      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3A5XBP2      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3A6MEG9      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3E4JP35      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3E4KP40      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3E4NX82      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A3E4XFU8      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A412RG70      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A412TD37      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A413GAA4      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A414M7I4      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
E5UZA2          ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A069SMG6      ----GEAY-----TLYVGKSSLYNAVNSCSSNLSVSL-----NS-------EK-ASVIDL
A0A1Y4PQK7      ----GTEY-----KVRVVRSGLYGAVRTCSSRLSVAL-----ND-------EE-STVLSL
A0A1Y3ZDB3      ----GTEY-----KVHVVRSGLYGAVGTCSSRLSVAL-----ND-------EE-STVLSL
A0A3A6AAP4      ----GTEY-----KVHVVRSGLYGAVGTCSSRLSVAL-----ND-------EE-STVLSL
A0A1Y4IH41      ----GTEY-----KVHVVRSGLYGAVGTCSSRLSVAL-----ND-------EE-STVLSL
A0A1Y4DYA7      ----FKET------VYISHSGLQATTSVYSGKLTVAL-----KD-------EK-STVINL
A0A1Y3X4I9      ----WKEA------VYVSRSGLQSTAAAYSDKLNVAL-----ND-------EK-STVINL
A0A1Y4FNK8      ----YQEP------VYVTRISYQAATSAYASNLSVAL-----ND-------EK-STVVNL
A0A355FD59      ----ETSP-----LIYVSRTNLYSATNACKEALTISL-----SD-------EK-VTVIDL
A0A359CEZ9      ----ETSP-----LIYVSRTNLYSATNACKEALTISL-----SD-------EK-VTVIDL
A0A353Q7B4      ----ETSP-----LIYVSRTNLYSATNACKEALTISL-----SD-------EK-VTVIDL
A0A1M3KVR9      ----NEMP-----LIYISRTNLYSATDLFKQNLTASL-----SE-------EK-ATVIDL
F8X3A5          ----TEMP-----LIYISRTNLYSATDLFKQNLTASL-----SE-------EK-ATVIDL
A0A3C1ITV0      NFEQ---------AVIVGYERPELTAKSCQARLTAEL-----AD-------KL-ATVINF
R7HN19          NFEQ---------AVIVGYERPELTAKSCQARLTAEL-----AD-------KL-ATVINF
A0A415EEZ4      SYIGQ--------AIYVKHSTVSSVVSSFITPLTVEK-----VD-------DT-ATLLDI
A0A060RD97      KFVGK--------EVNVAVTSVAKAQLDFSSRLTVAR-----AD-------KV-SSVVNL
A0A350IHV0      WHD----------PIVVSWVNAKRLAKAYCKKLNVSL-----SG-------KE-STVLVL
A0A077ENE7      DYYGV--------EIQVAKSPREAVMSNFVGNLSIKQ-----ME-------EE-ASLMQV
T0NN57          DFYGK--------DIQVTKYPREAMMENFKGKMKIAQ-----MD-------ED-ASLLQI
X5K347          DFYGK--------DIQVTKYPREAMMENFKGKMKIAQ-----MD-------ED-ASLLQI
A0A1T5K9D4      HWFGE--------AIYIQKIPVSQAAAAYSSALSISQ-----NN-------SA-ETVLNL
R5RVP0          --WKK--------PMRVSWVNSAKLAKAYCKGVTVAL-----SG-------KE-STVIVL
A0A285T4L1      AWTER--------DIRVSKNPLNAVAGRFQGSMGIRQ-----EE-------DE-SSILVL
A0A3E5BU42      AWTER--------DIRVSKNPLNAVAGRFQGSMGIRQ-----EE-------DE-SSILVL
A0A414ZBF2      EYMGK--------PVYVKKGNRKNVSDNYNANLQVEV-----VD-------K--SSLINL
R5KD55          AVADND-------EIDVRKSDNASATGRFLGGLSVEI-----GD-------KK-STILDL
A0A174QNT3      LYIGK--------DVLVTRSDLETVTNSMMERIQTSA-----MD-------QK-STLVNI
R9I0H0          HYQGK--------EIRVTRSDLESATNAVMARIQTSA-----LA-------SQ-STLVNI
K5BUT9          AYLSQ--------PISVSRISPEIATNIYQSKIATSL-----AG-------ER-TTLVQI
A0A174FPA3      AYLSQ--------PISVSRISPEIATNIYQSKIATSL-----AG-------ER-TTLVQI
R6S9Y6          AYLSQ--------PISVSRISPEIATNIYQSKIATSL-----AG-------ER-TTLVQI
C9KX15          AYLSQ--------PISVSRISPEIATNIYQSKIATSL-----AG-------ER-TTLVQI
A0A3L8AAP1      AYIGK--------PVSVTRISPETAAAIYKGGISTSL-----AG-------KG-TTMVQI
R6DAG6          VYIGK--------PVSVTRISPETAAAIYKGGISTSL-----AG-------KG-TTMVQI
A0A1G8BVM8      GYIGQ--------NIIISKINKMNLAKSLVAKFNIES-----VD-------KQ-SSLVQL
A0A416GGJ1      SWIGQ--------EITVRKNPLESVVSYYSGNFAIRQ-----EE-------DE-SSILTL
A0A3D1NQW3      DYYEKA-------PIRVTKGNLGVVTQFYQHEVKSFV-----AN-------KQ-ASIITI
B0MT10          DYYEKA-------PIRVTKGNLGVVTQFYQHEVKSFV-----AN-------KQ-ASIITI
R7JGW9          DYYEKA-------PIRVTKGNLGVVTQFYQHEVKSFV-----AN-------KQ-ASIITI
A0A0E2M2Y7      SWKGG--------ILYVTKENIRKVIQRYNKDLQISL-----AD-------KN-ATIVNL
A0A0K2J6Z0      SWKGG--------ILYVTKENIRKVIQRYNKDLQISL-----AD-------KN-ATIVNL
B2RKZ8          SWKGG--------ILYVTKENIRKVIQRYNKDLQISL-----AD-------KN-ATIVNL
A0A212GC82      SWKGG--------ILYVTKENIRKVIQRYNKDLQISL-----AD-------KN-ATIVNL
A0A254MU12      SWKGG--------ILYVTKENIRKVIQRYNKDLQISL-----AD-------KN-ATIVNL
R6CQ93          SWVGR--------DIHVSKIPLNAAAGRFLGSMGIRQ-----EE-------DE-SSILVL
A0A3D2BF46      DYFGD--------PISVSKQIVSSVASGYNKRIAIEL-----VE-------KQ-ANAISI
A0A358R538      AYEGV--------PVRVRKRSLGSATSAYRNAVKCDV-----AN-------KQ-ASVVTV
A0A1Y4AAB8      ADEGT--------AIQVAKSSLEAATSAYRAAVKCAV-----ED-------KQ-TSVVGI
A0A1Y3WWY9      KFNGV--------PIRVGKSSLKALTDTYRGAIKCDV-----A--------KQ-GSVVTI
A0A1Y4U5L4      EFNGV--------PIRVGKSSLKALTDAYRGAIKCDV-----A--------KQ-GSVVTI
A0A1Y3VCJ1      SYRET--------PIRVSKGDLKTIANMYRGAVKCEV-----TN-------QQ-ASVVTL
A0A1Y3QTW7      TYVDR--------PITVTKSSPMVTTNAYRATVKSDV-----AN-------KQ-ASIVTI
R6XWY7          TYVDR--------PITVTKSSPMVTTNAYRATVKSDV-----AN-------KQ-ASIVTI
A0A174AVF1      TYVDR--------PITVTKSSPMVTTNAYRATVKSDV-----AN-------KQ-ASIVTI
A0A373HTL7      TYVDR--------PITVTKSSPMVTTNAYRATVKSDV-----AN-------KQ-ASIVTI
A0A1Q6EIY0      TYLKK--------PITVIKNSLAATTNAYRAAVKSDV-----AN-------KQ-ASIVTI
E4M8L3          TYLKK--------PITVIKNSLAATTNAYRAAVKSDV-----AN-------KQ-ASIVTI
I3YQ50          TYLKK--------PITVIKNSLAATTNAYRAAVKSDV-----AN-------KQ-ASIVTI
R5UEY8          TYLKK--------PITVIKNSLAATTNAYRAAVKSDV-----AN-------KQ-ASIVTI
A0A1H4D866      EYTGV--------PIRVVKNSLSRTTNAYRNAVKSDV-----AN-------KQ-ASVVTI
A0A374A9J5      DYIGV--------PIRVTKSSLGRTTNAYRAAVKSDV-----AN-------KQ-ASVVTI
A0A1Q6E9S3      DYIGV--------PIRVTKSSLGRTTNAYRAAVKSDV-----AN-------KQ-ASVVTI
D4IJ36          DYIGV--------PIRVTKSSLGRTTNAYRAAVKSDV-----AN-------KQ-ASVVTI
A0A414Q925      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A415PUS9      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A108TCU0      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A413BA42      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
S3Y344          NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A413MY74      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A412TGL3      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A413VJ33      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A414L0W6      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A412DP39      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A413ZSE8      NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
B0NP84          NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
R6AK43          NSIGK--------TVYVTKGNMKEVAESYNKALNVGV-----AN-------KQ-SSLIAL
A0A412N2D9      SYIGK--------SVYVAKGNLKEVAEEYNKALNAGV-----TN-------KQ-SSLIAL
R6LHA4          SYIGK--------SVYVAKGNLKEVAEEYNKALNAGV-----TN-------KQ-SSLIAL
A0A1Q6FL18      SYIGK--------SVYVAKGNLKEVAEEYNKALNAGV-----TN-------KQ-SSLIAL
A0A1Y4JYS9      SYIGK--------SVYVAKGNLKEVAEEYNKALNAGV-----TN-------KQ-SSLIAL
A0A3E5HPT8      SYFDR--------PIKVTSKSREGMVAFWLSNLTIRQ-----MS-------GD-AALLSM
C6IJ48          SYFDR--------PIKVTSKSREGMVAFWLSNLTIRQ-----MS-------GD-AALLSM
Q8A3U2          SYFDR--------PIKVTSKSREGMVAFWLSNLTIRQ-----MS-------GD-AALLSM
A0A3R6S1H6      MYYSV--------PVTVTKYNLLQVAKACNAGLRAYL-----AD-------KK-ASIINL
A0A3R6SD81      MYYSV--------PVTVTKYNLLQVAKACNAGLRAYL-----AD-------KK-ASIINL
A0A413VXJ7      NFYEK--------PISVTKSNMERVVDAYQSSMEVSL-----AS-------KT-ATIINL
I9RSN9          NFYEK--------PISVTKSNMERVVDAYQSSMEVSL-----AS-------KT-ATIINL
U6RJK5          NFYEK--------PISVTKSNMERVVDAYQSSMEVSL-----AS-------KT-ATIINL
A0A1Q6GA32      NFYEK--------PISVTKSNMERVVDAYQSSMEVSL-----AS-------KT-ATIINL
I9RPU6          AFYGK--------PVNVVKSNLESVIEGYRGRLKVSL-----AS-------KT-ATIINL
I8Y597          TYYGK--------PVYITKSNMEKVVEGYLRRINISL-----AS-------KT-ATIINL
I8YFS5          TYYGN--------PVFVTKANMEKVVEGYQSKMKISL-----AS-------KT-ATIINL
A0A1Q6GBF5      VFYDK--------PVHVTKSNMESVVENYRNRLKVSL-----AS-------KT-ATIINL
I8YFZ3          VFYGR--------SVNVVKFNMESVVESYRNKLKVSL-----AS-------KT-ATIINL
A0A1Q6GDH2      AFYGK--------PVNVVKSNLESVIEGYRGRLKVSL-----AS-------KT-ATIINL
U6RSB0          VFYGK--------PVNVIKSNLESVIEGYRARLKVSL-----AS-------KT-ATIINL
I9SIK1          VFYGK--------PVNVVKSNLEGVIEGYRGRLKVSL-----AG-------KT-TTIINL
I9GXM2          VFYGK--------PVNVVKSNLESVIEGYRGRLKVSL-----AG-------KT-TTIINL
I9TP59          VFYGK--------PVNVVKSNLEGVIEGYRGKLKVSL-----AG-------KT-TTIINL
A0A0J6CIR2      KYFGK--------AVTISKRNREEIALTYSNSLQVAL-----AS-------KT-ATIINL
A0A3D8HG59      AYFGT--------PVRVTKSDLDETVLHFNRILQVAL-----AS-------KT-ATIINL
A0A3R6S408      AYFGT--------PVRVTKSDLDETVLHFNRILQVAL-----AS-------KT-ATIINL
A0A354WXN6      RYWNK--------DISINKRAASAVTNAYQAALNASL-----AS-------KT-STIINL
R5IP14          KFKKK--------VITVNKRRLKDATTRYRRAVSVSL-----ES-------KN-GGALNI
A0A316SZX7      --WKN--------EIKISKNPVKAVAASYKGRMNVSL-----IG-------KT-TSSVSI
A0A1Y4AIY1      TYYNK--------EVHVRKSNLKGIATGYQNALVSEL-----VA-------EY-ATIIKL
F3ZRU7          AYEGE--------TIQIHHRGLKNVTLGYGNAIQIAL-----AD-------KK-ATIINL
A0A1C5Q1F3      DYYQV--------PVTVNKMNLEKVGMAYNAALQSMV-----AS-------KT-SSIIHL
R7A239          DYYQV--------PVTVNKMNLEKVGMAYNAALQSMV-----AS-------KT-SSIIHL
A0A1M6K7I9      EYYGD--------KILVQKFVTERVVDDCMATLSVSL-----AS-------KM-ATIIDL
A0A3R6HIK7      NYYNI--------PIQVTKSRLKSVAKRYQSALQSTL-----AD-------KM-STIINL
K5ZVW7          NYYNV--------PIQVTKSRLKSVAKRYQSALQSTL-----AD-------KM-STIINL
A0A1Y4D5Z0      LCYGK--------SITVRKSNLSNVARAYLNKLQSTV-----AS-------KT-ATIINL
R5S343          NDLNR--------TVMIEKNIVSDVVDAYRERMRIEL-----AD-------KS-TTIIYL
A0A3R5ZMK1      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AS-------KT-ATIINL
A0A3E4ZTK7      KYFNT--------TVQVTKSPLQNVAIGFQANLQATL-----AS-------KT-ATIINL
A0A1Y3ZIA4      KYFNT--------TVQVTKSPLQNVALRFQSGLQATL-----AS-------KT-ATIINL
K5Y1A4          KYFNT--------TVQVTKSPLQNVALRFQSGLQATL-----AS-------KT-ATIINL
A0A3R6K8X4      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A1Q6I3T6      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A414XX40      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A412DM15      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A7AEU7          KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A415BDM7      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A3R5ZYK4      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A414GI87      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A3R6BKI7      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A414LPI6      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AN-------KA-STIINL
A0A412M2W1      KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AS-------KT-ATIINL
K5ZX55          KYFNT--------VVQVTKSPLQDVALRFQGGLQATL-----AS-------KT-ATIINL
K5ZBN2          LYYGS--------EITVSKSNQDRVALDYNESLQVVL-----AS-------KT-ATILNL
A0A0J6CKW3      LYYGS--------EITVSKSNQDRVALDYNESLQVVL-----AS-------KT-ATILNL
A0A0F5IQM7      LYYGS--------EITVSKSNQDRVALDYNESLQVVL-----AS-------KT-ATILNL
S0GLB0          LYYGS--------EITVSKSNQDRVALDYNESLQVVL-----AS-------KT-ATILNL
A0A3R6NLC1      LYYGS--------EITVTKSSRDWVALNYNEALQVAL-----AS-------KT-ATILNL
A0A416WYC9      LYYGS--------EITVTKSSRDRVALNYNEALQVAL-----AS-------KT-ATILNL
A0A0F5IT40      KYFGK--------AVTISKRNREEIALTYSNSLQVAL-----AS-------KT-ATIINL
S0GSI7          KYFGK--------AVTISKRNREEIALTYSNSLQVAL-----AS-------KT-ATIINL
K5YB65          KYFGK--------AVTISKRNREEIALTYSNSLQVAL-----AS-------KT-ATIINL
A0A0F5IWP9      KYFGK--------PVAVVKKNRVDVALGYSNTLQVAL-----AS-------KT-ATIINL
A0A0F5IZT8      KYFGK--------PVAVVKKNRVDVALGYSNTLQVAL-----AS-------KT-AAIINL
A0A417LKQ2      KYFGK--------PVAVGKKNREDVTLSYSNALQVAL-----AS-------KT-ATIINL
A0A416TME1      KYFGK--------SVVVGKKNREDVALNYSNALQVVL-----AS-------KT-ATIINL
A0A416XPE8      KYFGK--------SVVVGKKNREDVALNYSNALQVVL-----AS-------KT-ATIINL
L8JI02          NELYAPKENT---RYYFVIHDLSEVIETYQTELEVYP-----IS-------RE-SNIVEL
A6EBM4          RNTAQAAPSS---SYLFRFNTPEDFLDRIREGLRIGE-----AG-------KN-SNILSL
A0A2N3U785      APGFSTTNYS---EVLVEFKDYRRVANYYRNALSIYP-----IN-------KE-TKVIAI
A0A0E3ZG78      DSGLTASSKSIGSKLTVKFKNVQQLAEHYSQAIQIGP-----VN-------KS-ASVLWV
A0A1I6BRK6      AGG----QYNVGTKIIVYFQDIYQVANHYSQAINIKP-----VG-------KT-TNVLNI
A0A243WAB1      ASG----GNTADRKVIVSFQDIHQVADHYNKAIAVQP-----VG-------KS-ASVLSL
A0A399SH26      NDHQSSQAKE---QLYFQLLPLKAVTASLLNNLQVNA-----AN-------KL-STVVNL
A0A0E3ZGV6      NEKQTSTTTN---PLYFSIISPTRAANQLSGSIFIES-----AG-------KL-SSVVNL
A0A1I2N4S1      NLLQNGSAQH---PLFFSINNPKAVAKQLISRIYVES-----PG-------KA-SSVVNL
A0A2T5YE44      NLLQNGSAQN---PLFFSINNPKAVAKQLISRIYVES-----PG-------KA-SSVVNL
A0A1M4YED3      NDKANAAPQG---ALKLFLYNPESLASSYANRVSIPP-----NP-------KS-STVLTL
A0A3P1Z8V4      KGTPIVVHHY---SNEIAARIYKKALTAAEYS-------------------KE-SSLLLL
A0A2L2WX98      TGETVTVTRL---PKKMAAASYCKQFSAGEYDK------------------KE-SSLIIL
G5GD56          VGKTIQIHHL---PIEMAAKIYQEKIKASAYD-------------------KE-TSLVVL
R6A0L2          -DETIEVDRL---SKEKAAARFLKMLSASEYD-------------------KE-TSLIVL
R7LG80          -DEEITVNRN---SVSATADALRKRMDVAQIE-------------------KE-ASLIGL
A0A1M6XHU0      ----PSIREI---AFRL-----RERVRFRPL--------------------SD-QDMIVI
D0MHQ9          ----PSIREI---AFRL-----RERVRFSPL--------------------SD-QDMIVI
G2SF81          ----PSIREI---AFRL-----RERVRFSPL--------------------SD-QDMIVI
A0A2H3NSN0      -----TDSEA---MIRL-----FDMVDFAAE--------------------AD-QGLIRI
A0A2P6C324      ----YTQYAA---ILRL-----QEMVSFVPD--------------------QQ-QGLINI
A0A126PFG0      ------PAGS---RLRIVARDPDLVVTAYQKALEVDL-----IN-------KI-SPAISL
A0A3M1N7Z3      DCDPNCPSEG---QYEVVVFAPQATTFAWQRRVSV-I-----PK-------RG-TTILQV
R7PCR1          -----SITRI---SVKDAAKIYVKRISATPVD-------------------KQ-SSLIQL
A0A2A8CVM9      -----STNEV---MSHM-----MQRVSFVPM--------------------QS-QSMIQF
A0A3C0ZQC7      EDILLTASEI---AKRL-----MTAVEFEPI--------------------RD-SDVIKV
A0A2E3R1D0      ----LTVQEV---AFRL----QRGSIKSTMET-------------------GG-ADAIRV
A0A2T2USC0      -----TVSEI---AGDLVSQGGKATMSASAAGGNLAG-----QY-------ES-ADAINI
A0A2T2V0F3      -----TVGEI---AGDLVAQGGKATMSAAAAGENLGN-----QY-------ES-ADAIRI
A0A2T2S682      -----SRAVL---AGLL-----RRRVRAQSAG-------------------RE-VDAIRI
D5H561          DTTQLSPASV---APAL-----AGRVRFSRAG-------------------AE-TNVIQI
A0A2H3NWA9      -----SAQQL---AGRL-----MGRVQASPGG-------------------EE-IDAIRL
A0A2A8CVB6      -----SQNQI---AHRV-----RGSIRAGTYG-------------------EQ-FDAIRI
A0A2P6C1S6      -----SISAV---AGQV-----QNMISAQPSG-------------------EE-TDALYI
A0A2T2UTM4      -----STAEV---ANQV-----KGMISAQPSG-------------------EK-TDALYI
A0A1T5MMH4      ----FLDENDIDLFFI--INSPDALLGYLISGLSVEP-----LN-------YA-AQTIRI
A0A2W4R1L8      ----FTSESGLNCFFV--INSPEVLMNYLMRNLTVEP-----IN-------FN-ANTIRI
A0A2E5CV79      ------------------EHYTEPYSDAIGEKFSQNV-----MNGISIKRRNA-TGVLEI
A0A2A4G4B1      GQS---------YQIY--CTPISKTVNQIINNLQINP-----LS-------DK-THGLTL
A0A2D4ZVH1      ------------------STSIDTVAMRYRELIRFSE-----PD-------PE-ADIVSI
A0A0E3V905      ----QTFDSENPYSIQ--VTKRATSVKNYLTNLHAIP-----TG-------KG-STVILL
A0A1M6GR99      ENDSLLSSDNRRFAFK--LSTIKQLVSHYEQKLEFNI-----PD-------RL-GTFIEI
A0A1M5BA90      ----LKTASTNPLYFS--LNNPKMVLNSLVTNLRVIA-----AS-------KL-STVIDL
A0A1V9F098      ----QTEAPGGPLFFR--LSKPKNVAPGYIASLEVKS-----SS-------KL-SSTINL
A0A1V9FHD0      ----QTTDSTGQLYFD--LYKTKNLAPTISLNLVVTS-----EN-------KL-SSTMDL
A0A1T5CS78      NDN-VNKKASNPLFFY--LLNPKIISTSLLDELDIST-----SN-------KL-SSVVNL
A0A0Q9Z8F1      NDH-VNKKASNPLFFY--LLNPKMISSELIDELDIST-----SN-------KL-SSVVNL
A0A2N0U0M7      NDN-VNKNASDPLFFY--LLNPKMISSELIDELDIST-----SN-------KL-SSVVNL
A0A1M6TTV4      SNF-ASQKNLVEFYFI--INSEDALINYFQKNIVVEP-----IN-------FN-ANTIKI
A0A1Q6IT42      DKT-QFYEPGKKLKFVAHVNGYDGEAEILEKRLDIDL-----SN-------KK-ANGISL
K0X1U5          DKT-EFYKPGKKLKFVAHVNGYDGEAEILEKRLDIDL-----SD-------KK-ANGISL
A0A416XAH0      DKT-QFYEPGKKLKFVAHVNGYDGEAEILEKRLDIDL-----SD-------KK-ANCISL
R5EXK3          DKT-QFYEPGKKLKFVAHVNGYDGEAEILEKRLDIDL-----SD-------KK-ANCISL
A0A401UAP7      ----YTYEPKNTYSFM--LNDAQALRAYFTERLMVTP-----KN-------YN-ANTIRI
A0A1W2GF52      NFF-DDQKNLIDFYFV--LNSKESLINYLESHVTVEP-----IN-------FN-ANTIKI
A0A2G5L7B8      IFF-KEQQNLIDFYFV--INSREALIDYFQQNIIVEP-----IN-------FN-ANTIKI
A0A0D3LFR6      EGT-TGDAINSNYYFI--INSDQSLIDYLSTNLTVTI-----LN-------PN-AKTIKI
M7N6D4          NGI-NKDIPESRYYFI--INSDNALINYFRQNLSVSI-----LN-------PS-AKTIKI
A0A364XUP5      PNF-KESDEEIEFFFI--INSRDVLMNYLIANLTVEP-----LN-------FY-AKTIRV
A0A1M5RLA9      EAF-RKGD-EIGYFFV--LNTRDALLGYLLRSLTAEP-----LN-------YN-AHTLRI
A0A385SFR9      EAF-KKGD-EIGYFFV--LNTRDALLGYLLRNLTAEP-----LN-------FN-ANTLRI
L8JW09          -NY-FDPKGDKNFFFI--INSKAAQIKYLGSNLTVEP-----LN-------LN-ANTIRI
A0A1Q3ZMZ7      KES-FSSSRDNDLYFI--IQDPGLLTRQMMSSLKIIP-----LN-------PE-AQTIEI
A0A2D8JJW3      PVSNQKKHDLVNYTFK--DGDIRAAVERLQESLNINH-----VK-------ET-SHLV-I
A0A2W2AFF7      ----LVKADEEEYRVD--VQSTDEAVEDYRKALTANV-----VN-------KQ-VTLINL
A0A2N5YXE2      MEFELNPDNKSQYFFT--INNTKTVLTNIASNLEIQV-----LN-------EN-AGTILI
A0A2I0QZ80      QEL-KTDAETNQLYFV--FNDLNTVSSRFHDDLSIRP-----ID-------QK-AKTVEI
A0A2U2XBJ3      SQF-VLNSTSNKLYFE--LNDKSTMSRRLRPGLTVTP-----VD-------AN-ARTVQI
A0A3E1F1A3      NQF-KTNSSNNKYYIV--LNEDKVLANNLHSGLSVSL-----VD-------NN-AKTVEV
A0A1V9F383      ----QTTAPVGPLFFE--LNKPKDVAPGILLNLQVNS-----PN-------KL-STTIDL
G8TRZ6          ----QTSKPVGPLFFN--LNKTKDVVPGLLLNLLVVS-----PN-------KL-SSTIDL
A0A2W1NDY9      KVF-KADLEKDDLFFK--INNYKTLTNVLIHSLIVNI-----EN-------AD-ANTIKV
A0A1G0CI31      ENL-RSDDEQNELYFT--FNNKKTLVTRLLPNLEITP-----AD-------IE-AKTILI
F2IKD6          QSL-KQEDVSNDLYFT--FNNQKNLAARLISNLEVNP-----VD-------AN-AKTIEL
A0A1I7BM74      EVL-KRDINDNELYFV--FNNTQSLMARLHGDLTIAP-----LD-------VK-AKSILI
A0A2G2FJ17      ESF-VTDAETNVLYFH--FNSEDNLASKYLSGLAVSP-----VD-------IQ-AKTIEI
A0A416X8R7      PDK-ISAYYNVPVEVS--RIDLNTAANIYHSFISTSL-----AG-------ER-TTLVQI
K0XJ09          PDK-ISAYYNVPVEVS--RIDLNTAANIYHSFISTSL-----AG-------ER-TTLVQI
R5EUZ0          PDK-ISAYYNVPVEVS--RIDLNTAANIYHSFISTSL-----AG-------ER-TTLVQI
W0EQS0          PEY-LPAYYNIPVEVS--RISLDAASGMYHA--SASL-----AG-------ER-TTLVQI
A0A1Y3WE15      PEF-LPNYYTLLIEVS--RMDLNTAANIYHSLISAAL-----AG-------ER-TTLVQI
A0A1Y4GUK3      PEF-LPAYYNVPVEVS--RMDLNTAADIYHSLISAAL-----AG-------ER-TTLVQI
A0A2U1FKU2      PFF-VAAWKGQVVYVV--KEDMRKVVERYNQELQVAL-----AD-------KK-STIVRL
A0A0A2F954      LFF-ADSWKGEVLYVK--KENTRKVAERYNQDLQVSL-----AD-------KK-ATIVNL
A0A0A2FW91      LFF-ADSWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
A0A2D2N2N1      LFF-ADSWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
Q7MWZ2          LFF-ADSWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
T2NDT6          LFF-ADSWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
W1R7P9          LFF-ADLWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
A0A1R4AFZ0      LFF-ADSWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
A0A1R4DVZ7      LFF-ADSWKGEVLYVT--KENTRKVVERYNQDLQVSL-----AD-------KK-ATIVNL
A0A1G9E2A9      RFF-TVPGSIRRYYFV--INSRGALISYLAENLTVNV-----VN-------AN-ASTIRI
A0A2T2YJE8      VPL-SADVIAQKYYFI--VNSNAAIRQYLTSNVAVNI-----VN-------LD-ASTVEI
A0A3M9N829      SSF-SSAKVGETYYFI--VHSSQRLKRYIDENLSTAI-----LN-------PE-SKTIQI
A0A0P0CSF9      NNF-SSSNVGIVYYFI--VNSDQRLKGYIDTNLTTAI-----LN-------PE-SKTIQI
A0A3M9MNC3      PSF-TSVNVGETYYFI--VHSNQSLKGYIDNNLTTAI-----LN-------PE-SKTIQI
A0A2M6GH67      PNF-NPFVLEQNYHFV--INSDGALNNYFRSNLAVEI-----IN-------PS-ANTISI
A0A127B287      PSF-SANHIGESFYFI--VHSSGALKRYLNDNLSVAV-----LN-------PE-AKTISI
A0A369QP10      APL-NSDILAQKYYFT--INSTGAIRQYLTSNVAVNI-----VN-------LD-ASTVDI
A0A418R9X5      AQY-EGANRDANYSFI--INDQNAINGYLNQNLSVDI-----IN-------PD-ASTISI
A0A428JSJ3      AQY-TSADRDATYSFV--IQDGGTVNAYLTQNLAVDI-----VN-------PD-ASTISI
A0A428KI59      PQH-ASADPDANYSFV--INDDGTVNGYLNQNLAVEI-----VN-------PD-ASTISI
W8F1I6          PQH-ANADPEANYSFV--INDDGTVNGYLNQNLAVEI-----VN-------PD-ASTISI
A0A246FQC0      ANY-NESVLEEQYSFR--INSNSALNEYFDTNLLVDI-----VN-------LD-ANTISI
A0A372E5P8      KDY-NLAALDGQYSFV--INSAGALGNYFNTNLLVDI-----VN-------LD-ANTISI
A0A1H3EMW1      REY-SPEALDGEYSFM--INSPGALSNYFNTNLLVDI-----VN-------VD-ANTISI
A0A1H9ZSN3      ADS-GAAAPEGQYSFM--VNSPGALSNYFNSNLLVDI-----VN-------VD-ANTISI
A0A0M3RW20      PQF-SSDVIGKDYHFV--VKDNGAINQYIDQNLTVEI-----IN-------PE-ANTIGI
A0A1S9B3W0      KHF-NPQDTEGAYYFI--IKDPGSINGYLGSNLGVSV-----IN-------PD-ASTIGI
A0A1W1VRL3      TYF-DANALDAQFYFV--ILDEGTLNTYLNTNLSVQI-----VN-------PD-ANTVQI
A0A1M6R305      AYM-GATTLDNNYHFT--INDEGTINSYLDRNLLVEI-----VN-------PD-ANTIQI
A0A2M9B9H9      PLL-DEEALEKNYHFV--INDDGAVNNYLNTNLSVDI-----VN-------PD-ANTIQI
A0A126PDF2      QYF-GPASLIAKYHFT--IQDQGTVNAYLEKNLAVDI-----SS-------AD-ANTIQI
A0A2Z3GKA1      RYF-GPATLTAKYHFT--VQDEGTVNAYLEKNLAVDI-----SS-------AD-ANTIQI
A0A328BL48      RFF-NEQTPETKFFFV--INTPEAINGYLAQNLTVSV-----IN-------PD-ANTIGI
A0A3S0QKV1      KYF-SGQLADATYYFT--INDAAAINGYLSANLTVSV-----IN-------PE-ASTIGI
A0A3R9P8H7      PQF-NDKAFEGEYFFT--INSNGALNAYFNKNLLVDI-----VN-------VD-ANTISI
A0A212UCJ7      SLF-RPSDTERNFYFV--IRDEGFINQYLSSNLQVQI-----IN-------PD-ANTISI
A0A238WIA7      AFY-QPSDLERNLFFI--IHDEGTINGYLSQNLQVQV-----VN-------PD-ANTISI
A0A0W8EDI5      E---QAIQPNIPYYFI--IHDNSSVWSYIDQGLTVEI-----IN-------PE-ANTIAI
A0A3B7RBP8      N---KSPQAGVNYYFV--IHDDATVWGYIGENLTVEI-----IN-------PE-ANTIGI
A0A1I5WSL8      PAL-KGDVQDENYHFT--ILSDGAVNQYLDKNLAVEI-----VN-------PE-ANTIQI
A0A0U3JVM7      NEL-TNAAQDASYHFT--ILDDRTVNEYLDKNLTVEI-----VN-------PE-ASTIQI
A0A1G1SSV2      ESFAANNTADASYHFT--IQDDRSVNAYLDKNLTVEI-----VN-------PE-ANTIQI
A0A1G1SXV7      KNLVTDTPDDASYHFT--IQDDYTVNAYLDKNLTVEI-----IN-------PE-ASTIQI
A0A243WHR7      PWM-NESVVGKKYFFV--INDDGTISNYLNKGLNVQV-----VN-------PD-ANTIQI
A0A076HRT9      GKI-DASVIERNYFFT--INDEAAINAYLDRNLLVEI-----VN-------PD-ANTIQI
A0A1M6DHW8      SFL-NAEALDKKYHFV--INDEGTLNAYLSSNLSVDI-----IN-------AD-ANTIQI
A0A3D1KEX9      -EF-DPEFVGKIIHVT--RIKKEDAITKFNKAVTASE-----VN-------KE-ASLISL
A0A358Y7S2      EHC-AENE----VYFE--FIQREKLIEEIKEKLTVIA-----VN-------PE-AKTIEI
A0A1X7J248      ----PHFFNTESLTFT--ISTPESLMSYVESNLSVAP-----EN-------LN-ANTIKI
E4TQD2          ----PHFFNTERLFFT--ISTPESLINYVESNLSVAP-----EN-------LN-ANTIKI
A0A2J6HHN3      QKF-KNRE----FIVV--FNNIDNLVYKYSRKINISV-----VS-------DA-AKTIRI
A0A1Y3WMT8      DTT-RYYNPDKKLRFVAHINGYDTQTELLEKRLEIDL-----SD-------KK-ANGISL
A0A1Y4GQU1      DKT-SYYKPGEKLRFVAHINGYDVQTELLSKRLEIDL-----SD-------KK-ANGISL
A0A1V5W8T5      ENK-GNK-----FYFR--ILDDKGAFAEHITGLDVSI-----LN-------FD-AKTIRI
A0A2T8HKA9      KLY-KPSIFGEEITVT--KIPRETMVSYFLSRMKIVQ-----IE-------DD-AGLLQL
A0A3B8INU3      SHL-NSSYLGEPMYFV--INSNGALLNYIGAHLAVTP-----LN-------LN-ANTIRV
A0A098LL25      TFW-STNETGAKYFFT--MNSKEALVKNLMDNVSVSI-----LN-------LD-ANTILL
A0A1Q3Q573      DKL-SDGSFNSLYFVK--FNDKQTIINDINSKITIEP-----IE-------AG-NNTLAI
A0A357YNR3      TTP-IIHSRNMMVEID--IYRPADVANMYLGNLTVEL-----TS-------KT-SSVADV
F4KK08          PYY-SNFPNYEVLKVQ--KDNFNAVVRNYMKALQVSL-----QQ-------KD-ASVIKL
A0A3N2N6F7      -PN-FSPDFDHDIRFS--YWPMPTAISKYQAKLTETL-----SN-------ED-ASVIDF
A0A419VXB7      -----VLPTEGDYYFE--FNDLEKLTLSYLRQLQVST-----VN-------KD-ADVISL
A0A2V1ILM4      -PA-YAKRFGNTIKIF--RYSISDAIEAYKARLSENL-----AD-------DN-STVIDF
A0A3N2L0E8      -PA-YAKRFGNTIKIF--RYSISDAIEAYKARLSENL-----AD-------DN-STVIDF
A0A3N2LFC5      -PA-YAKRFGNTIKIF--RYSISDAIEAYKARLSENL-----AD-------DN-STVIDF
C3J7R8          ASF-S-------LEVE--KNTRERSIRSFSHIFNVSS-----AS-------KQ-GSIITL
A0A0B0BTJ4      TAG-YNPKAANSLRIY--VRPVRNAAEAYAKALHVAQ-----AQ-------KF-SNIVNV
A0A3B9CNN6      TAG-YNPKAANSLRIY--VRPVRNAAEAYAKALHVAQ-----AQ-------KF-SNIVNV
R5X290          TAG-YNPKAANSLRIY--VRPVRNAAEAYAKALHVAQ-----AQ-------KF-SNIVNV
A0A1Q6E6I7      TAG-YNPKAANSLRIY--VRPVRNAAEAYAKALHVAQ-----AQ-------KF-SNIVNV
A0A2G2F510      DAS-TINE----LYFT--FNSIESVTERLRKGLKVVP-----VE-------VG-AKTISI
A0A316JZ08      KMA-SENE----LYFT--FNSRQGLVERLHGGLDVIP-----MD-------PN-ARTIQV
A0A1I1FXP9      PDV-INYE----YFFT--INSRNKLLMQMFFNTSAYI-----LN-------QS-ANTIRI
A0A3B9FXJ0      ES----------YELI--IRNKLTVAKAMEKRIRIDA-----EN-------TY-GGKIVI
R5GSU5          PTT-VTVSRLPVF----------TATEMYRSKLSCGE-----ID-------KE-SSLIVL
A0A2P8EAX2      FPF-ST------FVVR--LENPIVKTERYAKALNFEQ-----SS-------VK-SSTLFI
A0A3N4H5N3      ESV-SS------FVLN--FVNPVLITEQFSKSLTLEQ-----PS-------IK-SSTIYL
A0A2A3UE91      VIN-EIVKDNKGFYFI--VHDVDAVTAQLQAKVELKL-----LN-------EL-AKTILI
A0A0A2G557      NTI-ATSKKEP-IEII--VNSKEKTVADLSKKLTISQ-----SG-------KQ-SSVIDL
A0A2N2WFW8      KSF-FAANNGKQFLIV--FNSVKDLANSYSQKINIAV-----LN-------DV-AKTIRI
A0A1F3IU95      HAF-FKSNRNKQFIVQ--FNNLTDIAAQYSQQVNIAV-----IN-------DV-AKTIRI
A0A3D0VUF6      HAF-FKSNRNKQFIVQ--FNNLTDIAAQYSQQVNIAV-----IN-------DV-AKTIRI
A0A1T4PT95      NPS-TEVEDKE-IKIT--ISSREEIISDLAKRLTIAQ-----SS-------KG-SSIIDL
A0A3Q9FR88      ----SPNVDNNKYSFQ--FNSKSSITNFIRKNISVLI-----FD-------PK-ANTIQI
A0A150ADJ9      ----SKSTINNTFSFV--VNSRPSLVKFLKKNISVQV-----FN-------PK-ANTIQI
A0A1B1FWQ4      ----NKILETNKYSFT--FNSKASIIGFLKRNLSVMI-----YD-------PK-AKTIQI
A0A1S1Z228      ----NKILETNKYSFT--FNSKSRIIGFLKANLSVMI-----YD-------PR-AKTIQI
A0A1F3SJM1      STS-QNDD----LYFI--FNSVQSVAERMRNGVTITP-----ID-------VA-AKTISI
A0A2G2EB96      QVS-KENE----LFFI--FNGREQLSNRLIQDLSVSS-----ID-------PY-AKTISI
A0A2G6PRA9      KVS-KEND----LFFI--FNGREQLSNRLIKDLSVAA-----ID-------PN-AKTISI
A1ZKR2          PAF-RQIP----FYFK--INSRQALISYLNNNLQVGI-----LN-------KS-ARIIGI
A0A1Q3GX01      KRF-HNIP----FYFK--LNSRQTLIDYLNKNLQVGI-----LN-------RS-ARIIGV
A0A349DQI4      KRF-HNIP----FYFK--LNSRESLIRYLNTNLQVGI-----LN-------RS-ARIIGV
A0A2N3IIZ0      EN----------IYFV--LNSKGKSMNYLANNLEAFI-----LN-------PQ-AKIIAI
A0A2A4PYG9      TQQ-NQFAQNP-YFFI--VNNTAAEIDKYYHLIDVRI-----LN-------QA-AKTIQV
A0A2A5FYT6      TSK-KQLKQND-YFFI--INDVNQITEQYHHRLRVEL-----LN-------AA-AKTIKI
A0A2E6SYP1      LSD-QNLK----FLFM--INNEKQIVNHFSKGLDVSI-----FN-------VR-AKTIKI
A0A2E5RLE8      LNN-SGKK----FLVK--IVDKNQLISKYSKGLQVNI-----EN-------TR-ANTIKI
A0A2E7TQF6      LNN-SGKK----FLVK--IVDKNQLISKYSKGLQVNI-----EN-------TR-ANTIKI
A0A2E6GVY9      LND-SGKR----FLVK--IVDKSQLINNYSKGLSVNI-----EN-------SR-ANTIKI
A0A350JJ90      AQS-SGLTEDR-KYFI--LNSAPTLVQKLSKNYSVRI-----QS-------AA-AKTVQI
A0A3M1CDV2      SIR-KDLYNNQRTFII--IQSKDAVASYLQKKLEVKP-----LN-------DL-AQTISI
A0A2E2TFD1      NDQ-ETGTRND-VFFT--LNNNASIVNRYSKSLDLKV-----LS-------QS-AKSISI
A0A2E4ELE6      SEQ-TDLSNND-FYFR--LNSDAEIISKYSKSLKVKL-----LN-------QA-ANSVEI
A0A2E3XZI5      KNL-EKSN----FYFI--IPTIKQIKKELLGGLEVNI-----ID-------RS-AHTINI
A0A2M7NLQ9      KST-SDS-----YFFT--LNSPEYQIAYIASSLRANV-----LN-------PK-AYTIQV
I4AFR0          QSP-SSN-----YFFT--LNSHEYQINYIASSIKANV-----VN-------PK-AYTIQI
A0A2N2Y3E5      EYE-NMLKKDG-LFFI--VNNPETQLNKIIQNLVVGV-----LN-------FE-AQTIQI
A0A2D9D7T6      EIN-KNNR----LYFV--FNKKYDVMRSLKKNLTVSA-----ID-------PS-AKTIQI
A0A1F3PPL5      ELH-KSLNHES-FFFI--LKNPTTLLNEHISKLEIKL-----QN-------PE-ANTIEI
A0A357QK06      ELH-KSLNHES-FFFI--LKNPTTLLNEHISKLEIKL-----QN-------PE-ANTIEI
A0A2A5B3B0      TPQ-GGD-----LFFK--INDYDKLTFAYIGKLAVFP-----LN-------NA-AKTINI
A0A0F2NS19      ADK-NNS-----MFFA--INDLEALTNKYIQQLGVFP-----LN-------PS-AKTISI
A0A2A5H8X6      ADK-NNS-----MFFA--INDLEALTNKYIQQLGVFP-----LN-------PS-AKTISI
A0A2H0GAU8      DVK-NNK-----MLFV--INNIDDLTSRYISQLNIFP-----LN-------PS-AKTINI
A0A2M8FTK1      DVK-NNK-----MLFV--INNIDDLTSRYISQLNIFP-----LN-------PS-AKTINI
A0A0S2HYK8      SMY-ESAKQNS-YYFV--IYNDEQIFTEHSKKLNIKL-----LS-------SS-SNSIEI
A0A2N5ZWN6      SMY-EKESQNS-YYFI--ISNMDQIYSEHSAKLTIRL-----LN-------SS-SNSIEI
A0A2E0FJ09      AQQ-NDGE----FYFL--YSDLEKLASEFSAMLEVSI-----AN-------SN-ANTIGL
A0A1F3FZ62      TDL-NADE----YYFI--INNPDLIVNEHINQIDVSI-----LN-------VL-AQTVLI
A0A1F3K211      TDL-NADE----YYFI--INNPDLIVNEHINQIDVSI-----LN-------VL-AQTVLI
A0A1F3KLL5      ADK-QNLKQNS-FYFI--INNPTYLLQAYKANLLVEV-----LS-------DE-AKTISI
A0A359D1M1      ADK-QNLKQNS-FYFI--INNPTYLLQAYKANLLVEV-----LS-------DE-AKTISI
A0A2E7CT70      ESL-DKFN----YFFK--IPFFQEKRNEIINDLEISI-----ID-------PA-ANTIGI
A0A2D5V560      DNL-NSMSTNERLFFR--IPSXNELKNSILNGLTINI-----KN-------QS-AHSXQI
A0A2D7K5A8      DLL-SSLSSNERLFFK--IPTKKEVINILKNSLTITI-----QD-------QS-AHSIKI
A0A2E1XQ82      DFL-SSLSSNERLLFK--IPNKKEVINIIKNSLTITI-----QD-------QS-AHSIKI
A0A1V6I2U9      QEL-DPQNKSQ-YFFT--INNPNTTLKNLSKRLNVQI-----LN-------ET-AGTIKI
A0A1F3C1M2      EEH-DELTKNN-YFFI--INNPINIIKDNLLKLKVNI-----LN-------PS-AQTVDI
A0A1F3DS87      EEH-DELKKNN-YFFI--IKNPANIIKENLDKLKISI-----LN-------PS-AQTVDI
A0A2H0B957      EQS-NKIKTDS-YYFT--LNDSETVYQKYSSRLEVSL-----LN-------QE-ANTISI
A0A1F3CFW6      TQI-NKIKNDS-YYFI--INDTESVYKKYSSQLEVSL-----LN-------QE-ANTIQI
A0A2M7E2T8      TQI-NKIKNDS-YYFI--INDTESVYKKYSSQLEVSL-----LN-------QE-ANTIQI
A0A2M7NC69      TQI-NKIKNDS-YYFI--INDTESVYKKYSSQLEVSL-----LN-------QE-ANTIQI
A0A1F3K695      AQL-SDLKQNS-FYFI--IKNPNNVYLDHFSRLEVAV-----QN-------QL-AQTIEI
A0A353KZR1      AQL-SDLKQNS-FYFI--IKNPNNVYLDHFSRLEVAV-----QN-------QL-AQTIEI
A0A2N2WYB5      SQQ-EYYKSNR-YYFI--INNPQTLVDLHLQTLQVAL-----QN-------RS-AQTIQI
A0A1F3K4G0      SQK-ENYKGNR-FYFV--ISNPKNIVENHLQNLDIFL-----LN-------RS-AQTIQI
A0A356H8Y3      SQK-ENYKGNR-FYFV--ISNPKNIVENHLQNLDIFL-----LN-------RS-AQTIQI
A0A351HSA6      SQK-ENYKGNR-FYFV--ISNPKNIVENHLQNLDIFL-----LN-------RS-AQTIQI
A0A1F3Q014      NEQ-NVVKKNA-YYFT--LNDLDAIVNESYPKVEVKL-----LN-------DQ-AKTILV
A0A2A4YXP3      -NY-EILKEGN-LYFR--INSYEEMTNAWDYKLSVFP-----LN-------NA-AKTINI
A0A2D5KD44      KEV-EAVKGIE-YHFV--LNNPQSLVKGILSRLEIVI-----LN-------PN-AKTLQV
A0A1F3R158      NAQ-SDIKNTL-LFFT--INDIESLTNSYISSLNVFP-----LN-------PL-AKTISL
A0A2M8ADX2      KSQ-SDIKGTS-IFFT--INDIENLTNNYISKLNVFP-----LN-------PM-AKTISI
A0A1J5B2H0      NKS-GILNSDN-YYFI--INNPSTNLSNYVRPLNISI-----IN-------EA-AKTVSI
A0A1V5N756      KNI-SFIDKDD-YFFV--LKKPSDILSSYIPNLSVFV-----VN-------EN-SQSIMV
                                                                           .

A0A1I3J6V0      SASAGSPEEARDLAEAWIR-----------------------------------------
A0A1H4ADG3      SLNTTIPEQGIDIMNGLIHVYQLSNIEDNNRITDSTIEFLNNRLFTVGAELDSIEGNIQH
A0A3D5KRY6      ELKTNQLERDVDFLDQLSKMYIQYGLEKKNRKASNTITFIDNQIAGVNYSLQSAGNMFTN
A0A1V5IPN7      SFESTNRGEAMAAVNAIADAVQQQNTQMARLEFTTIREFLGEQLDLISRRLQISEDDLRA
A0A1V3WH52      TFTGEDKDQIRDILNSITRNYLEQNVERKSAEAAKSLAFLSKQLPEVRARLDDAENKLNA
A0A2K8Z965      SLEDGVPSKGEAVINQLITEYDQAAIMDKNKVAANTLKFIEDRLNIVSGELSSVEKNVQS
A0A418M8U8      TLEDAVPEKGEAVLNQLIDEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTTVEKEVER
I2GTA4          TLEDAVPEKGEAVLNQLIEEYNQAAIIDKNKVAANTLRFIEDRLAILSGELTAVEKEVER
A0A2K8ZAJ2      NLQEAVPSRGEAILNQLISEYNKEAVVDKNNQASSTLNFIEDRLALISGELSNVEKEVES
A0A368JPA3      TIEDAVATKGEAILNQMIANYSSASTTEKNRAVANTLSFIQTRLKLVSAELATLEKSIET
A0A3P1BT12      TIEDAVPAKGEAILNQMIANYSSAATDDKNRVVASTLSFIQTRLKLVSGELAGLEKSIET
A0A3P1CI15      TIEDAVPAKGEAILNQMIVNYNSAATVDKNRVVASTLSFIQARLKLVSGELAALEKSIEN
A0A1Q3PII2      SWQDVLPRKGEAILSQLIARYMKASIAEKNKVADNTIAFINQNLQRISSELAEVETSIEH
A0A351BXT2      IVESPAKYEAMLIANLYSKVYQSFSLDLSREELTSLTGYLREEKENKFKDLAVAEGELED
A0A3D0MYJ7      SVKSTSFPEASLISIIYANSYLSYSLELSKSELTLKRKFLENEKEKKFNELSIAESNLEN
A0A3D3LS70      DVDSPSRTEARLIANVYAAAYLNYNLEFSRKGVKNVGDYLFEIKNKKLNDLNNSEAALQD
A0A1G7ZF38      SIQDVLPRKGEAILNQLIERYQKASIQEKNKVADNTIAFINSNLTHISSELTQVETNIEQ
C6VS52          SIQDVLARKGEAILKQLIVRYQKASIDEKNKVADNTIAFINHNLERVSAELASVETNIEG
A0A1G1TM36      QIKDQVPQRGIDVLNQLIAAYNNASATEKNKLTANALQFIDSRLGSLRGELNQAESAVTG
A0A1V3WH27      TLTGEDPDSIARVLNAIAENYLQQNIARQEAQDSRSLDFLQAQLPKISADLDQAEARLNA
A0A0D3L8Q3      SLVDPVPEKGKDILNKLIEVYNKEAVEDKNVIAANTIEFINERLQFLTEELTDVEKDVEE
A0A0K8QSK7      TVQDHNSAKGNDFLNKLVEVYQRDNLNQKNEVANRTINFIHSQLGEISDSLSISETEMLQ
A0A1V6CN82      DLKDYHPQKAVDFLNKLVEVYRIDNVEKKNQYADQTINFIEYLLEGVSDSLAVAEGELLS
A0A1M4XZ45      TLRDYNVSKGVAFLNKLTEVYQLDNLEKKNENANRTIHFISSQLQSISDSLSVSENRMET
A0A399D319      TLRDFNVKKGVDFLNKLTEVYQLDNLEKKNENANRTIQFISSQLQSISDSLSISESRMET
A0A0P7X1V8      SYRSPSPYEASRVVDLAIETYTDVSTRINRSQARNAIDFLDSELDKVSMQLNYSEEQLRD
A0A3B0C2S4      SIKGQSPERSETVINELINKFNQDGIIDRQLISKRTLEFIDERFAYLSGELDSIEVGKED
A0A416GA42      NITDPVPQRAEDILNTLVDAYKEDIVNDKNTVARNTERFVVDRLAILEKELGNVDNQIAS
A0A3N2M1H3      TIRDVSVQRAEDILNTVLLVYNENWIEDKNKMAVATSAFIDERLRLIQQELGDVDSNIAK
A0A1T3IYP5      SMEDQSPERAADVLTALINVYNEVYLQDKNKIAENTANFIKDRLEIIEGELGSVESNIED
A0A212K7W5      SLNDVSAQRAEDILDTLITVYNKNWIQERTQIAVNTSSFIEERLNVIEKELGGVEDSISR
F5IU11          SLNDVSAQRAEDVLDTLITVYNKNWIQDRTQIAVNTSSFIEERLNVIEKELGGVEDSISR
A0A352Z1R7      SYSSTDPVQARDLVNTLVQVYLGQNIELKTEEASRTVSFIENQLKGLRGELEGAEQDLET
A0A0A2F501      AYQDRSIQRAEDFLNMLINVYNESWVKDKNQVAISTSLFINERLSVIEQELGHVDKDISS
R5B7P0          SIKDVSTQRAQDILNTLIAVYNENWVRDKNQIANSTSVFINDRLRVIEGELAGVDSDISA
R5B0L5          SVMDYSPERAVDLLNGVIAVYNEKWLADKNQVSVSTASFINERLAVIENELGHVDSDIAS
A0A374THP7      TYKDVLPKRAEDVISTIISVYRKNWLEDKNQMTISTSHFITERLGVIERELGDVDKNISA
A0A3R5XWG1      TYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISS
A0A414YFM3      TYTDVQTKRAEDILNTIIAVYRKNWLDDKNQMTVSTSRFITERLGVIEHELGDVDKDISS
A0A0A2EVS5      SYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISS
A0A1T4NAJ7      SYTDVSIERAEDFLDTLISVYNENWVKDKNKIAVSTSQFINERLSVIEQELGAVDSDISS
A0A2V1IJY1      TVTDQSTQRAQALLSTLIGVYNEYWIRDKNQIAVSTSNFINERLGVIESELGNVDSDISS
A0A3N2KCL3      TVTDQSTQRSQALLNTLIGVYNEYWVRDKNQIAVSTSNFINERLGVIESELGNVDSDISS
A0A255T941      TTEATSPKKAEDILNTLIEVYNENWILDKNQIAISTSQFIGERLGVIEGELGHVDANISS
A0A1Y4CHN5      SITDVCIQRAEDVLNTLIAVYNENWLKDKNQIAVSTSMFINDRLKVIENELGTVDADIAS
A0A1Y3V692      SIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAG
A0A174TYU6      SIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAG
A0A1M6I2S6      SIDDVSIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAG
F3PXM2          SIDDSSVWKAEDILNTLIEVYNEYWIRDKNQIAVSTSQFIGDRLGVIENELGHVDANIAG
A0A3E4ZNL4      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGERLGVIENELGHVDENISN
A0A174AHH7      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A174JCE8      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A3E4JMC4      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A412SND6      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A414IEQ9      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A415UKN5      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A0M1W8D8      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A3R6GKX5      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISS
A7V4S1          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISS
B0NU19          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISS
D4V601          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISS
A0A397WLT5      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISS
A0A3R6GM96      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISS
A0A015XH67      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A078RZN2      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A6L0K5          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A7ACT5          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A6KY94          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A173UQR8      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A3R6HK75      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A412B7D1      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A412VNY9      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A414LTU9      SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
I9Q4U4          SIDDASVQKAEDILNTLIEVYNEKWIQDKNQIAVSTSRFIGERLGVIENELGHVDENISN
A0A373ISF0      SINDTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISS
U6RF62          SINDTSIARAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGHVDENISS
A0A073I794      SIDDASIQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIEGELGNVDENISS
A0A108TH71      SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
I8VXH0          SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A412S0N6      SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A412IIJ0      SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A0P0FM97      SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
R6KTP3          SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A139LU87      SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A1C6B3Y5      SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
E2NMQ4          SINDTSIRKAEDILNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A412YDB9      SISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAG
R7DY01          SISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAG
A0A414LGK8      SISDASIRKAEDLLNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIENELGHVDENIAG
A0A016E4F9      SIDDASIPKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAG
A0A413PP50      SIDDASIQKAEDILNTLIEVYNEKWIQDKNQIAVSTSQFIGDRLSVIESELGNVDENIAG
A0A3A5TI83      SINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAG
A0A415NEB6      SINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAG
A7AJ60          SINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAG
A0A015UXN7      SINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAG
A0A395YYT3      SINDASIQKAEDILNTLIEMYNEKWIQDKNQIAVSTSQFIGDRLSVIENELGNVDENIAG
A0A415IPQ4      SINDASIQKAEDILNTLIEVYNENWIQDKNQIAVSTSQFISDRLGVIESELGHVDENISS
A0A3E5BRW7      SISDASIRKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISS
K9DXS6          SISDASIRKAEDLLNTLIEVYNENWIRDKNQIAVSTSQFISDRLGVIENELGHVDENISS
A0A1M6KFV3      SINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLDVIENELGHVDENISN
A0A1Q6G7L3      SINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISN
A0A413H235      SINDASTRKAEDILNTLIEVYNENWIQDKNQIAISTSQFISDRLGVIENELGHVDENISN
A0A1M5B2J8      SFQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISS
A0A255RCT5      SFQDVSIQRAEEVLNTLISVYNENWVKDKNQIAVSTSMFINERLGVIEGELGNVDNDISS
A0A1Y4GLF5      SFKDLSTQRAEDVLNTLISVYNENWVKDKNQVAVSTSMFINERLGVIEQELGNVDEDISS
A0A1H3XSC0      TFRDHSIQRAEDILNTLISVYNENWVKDKNQIAVSTSMFINERLRVIERELGNVDEDISS
B3JI46          SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A174UR09      SLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A6LE40          SLKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
R6NN15          TFKDVCIQRAEDILNTVIAVYNENWIKDKNQIAVSTSMFINDRLGVIESELGHVDENIST
A0A358R8U0      TFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENIST
R6WSB6          TFRDVSTQRAEDVLNTMISVYNENWVRDKNQIAVSTSMFINERLGVIERELGNVDENIST
A0A401LPX7      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A3A5Z900      SFQDVCTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A3R6I893      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A3R6EGW5      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A285TGL6      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A3A5RFX4      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A1Q6IUW9      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A3R6NPG7      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A413XDP6      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
K6AP24          SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A076IQN8      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A078RYI7      SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
C7XEQ8          SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
D7INX6          SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
K5ZG55          SFQDVSTQRAEDVLNTLISVYNENWVRDKNQIAVSTSMFINERLGVIEGELGNVDDDISS
A0A3N2N9B8      TLSDRSIERADDVLSTLIDVYKDAWIRDKNEIAVSTSQFINDRLGVIESELGNVDQDISS
A0A3N2NMI0      TLSDRSIQRADDVLATLIDVYKDSWIRDRNEIAVSTSQFINERLNVIEGELGNVDNDISS
A0A359I8H7      SMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFD
A0A3N2KA63      SMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIERELGNVDNEIFD
A0A3B9FAU3      SYKDKEPYRADDIINTLITVYKESWVREKNMLTIATTKFINERLAIIERELSGIDSDISS
A0A3C1E5L7      SYKDKEPYRADDIINTLITVYKESWVRDKNMLTIATTKFINERLAIIERELSGIDSDISS
A0A354SN68      TCNGEHIGMLNDILNAVIKAYNKKWVEDRNQVALNTSKFINERLKVIEKDLGLVDEDISS
A0A0A2DUD9      SLLDRSQERADAILNTLVATYNESWLADRNLSAVSASLFIDERLGLIEKDLGEVDKNITK
A0A3N2N595      TLNDRSTQRAQDLLNTLIGVYNEYWISDKNQVAVSTSNFINERLGVIEGELGHVDSDISS
R5FHS9          EMQDVNIQRAEDILNTIIAVYKDRWVRDKNQVAVATSAFIDDRLKKIELELGNVDNSISS
A0A3P1ZBJ5      SINDVSVERAEDVLKTLIDVYNQNWVEDKNQVAVNTSKFINERLRVIESDLGNVDKNISS
A0A413TW79      TYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISS
A0A3E5E9M7      TYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISS
A0A3E4SK73      TYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISS
A0A415GGC6      TYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISS
A0A413DBH9      TYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIERELGDVDKDISS
G9S1S8          SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISS
A0A354M4S6      SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISS
R7DH52          SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISS
A0A396N3D5      SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISS
A0A415ZDP9      SFKDVSIQRAEDILNTLIAVYNENWVKDKNQIAISTSMFINERLGVIEKELGSVDEDISS
A0A016CWA4      SFRDNSIQRAEDVLDMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A1C6H117      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A415TAH7      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A0M1W0V2      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A139KA16      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A174VQ92      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A1Q6HCG0      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A1Y4JYM9      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A3A5QW67      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A3A5RQE6      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A3A6BP07      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A3E5E153      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A3Q9IP20      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A412WV15      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A413ICP6      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A414KYB9      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A416X133      SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
E5WX00          SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
K0X3P3          SFRDNSVQRAEDVLSMLISVYNENWVKDKNQIAISTSMFINERLGVIEQELGNVDEDISS
A0A3A5Z014      AFKDNSIQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A1M4YZ07      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A078S3Q8      AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A069SJV7      AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A3E5DXI5      AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A3E5EM98      AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A3E5F453      AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
I9T3G6          AFKDNSTQRAEDILSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A0P0FQW1      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
C3RFN5          SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A3E4SYU0      AFKDNSTQRAEDVLSMLISLYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A6LGY1          SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
K5ZSH4          SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDEDISS
A0A078T2W6      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3R6D1V4      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3R6EAF7      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A412MJT7      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3E4WKT5      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3A5YY33      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A078TAH2      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A1E9CFZ7      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A373FYU5      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3A5TZ72      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3A5XBP2      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3A6MEG9      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3E4JP35      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3E4KP40      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3E4NX82      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A3E4XFU8      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A412RG70      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A412TD37      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A413GAA4      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A414M7I4      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
E5UZA2          SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A069SMG6      SFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIERELGNVDEDISS
A0A1Y4PQK7      SYRDVSPARAEDILNTVISVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISS
A0A1Y3ZDB3      SYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISS
A0A3A6AAP4      SYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISS
A0A1Y4IH41      SYRDVSPARAEDILNTVIAVYNENWVKDKNQVAVSTSLFISDRLAVIEGELGNVDENISS
A0A1Y4DYA7      SIEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLEVIEQELGHVDENISS
A0A1Y3X4I9      SLEDVCIQRAEDVLNTLIAVYNENWVKDKNQIAVSTSMFINERLGVIEQELGNVDENISS
A0A1Y4FNK8      TFTDVCTQRAEDVLNTVIAVYNENWIKDKNQIAVSTSAFISDRLGVIEQELGNVDENISS
A0A355FD59      SYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISS
A0A359CEZ9      SYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISS
A0A353Q7B4      SYNDVSTQRAEDVINTLIAVYKENWIKDKNQITVSTSMFINDRLKVIATELGDVDEDISS
A0A1M3KVR9      SYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISS
F8X3A5          SYKDVSTQRAEDVLNTLISVYKENWVKDRNLITVSTSLFITDRLSGIERELGDVDEDISS
A0A3C1ITV0      SYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIER
R7HN19          SYTDASEKRAEDVLNTLLDAYNEEWIRYTNKSTDNTAKFIDERLMSIERELGNVDSDIER
A0A415EEZ4      TYKDMNQDRSAAIIETLIEAYNDDATQDKNQILFNTSLFIDDRLQIINKELGLVDGDIEK
A0A060RD97      SFIDQSPQRATAVLNTLIAEYNTESIMDKNRIARNTDIFIMERLAKLSKDLEGVDTDIAD
A0A350IHV0      SLEDTFPRRAEDILNTLIDVYNEQWVANKNRSARNTTAFINDRLVVIENELGGVEESLKQ
A0A077ENE7      TMTDDSSERAADILTSLITVYNDVYLQDKSKIAENTADFIKDRLAIIEGELGAVESNVEN
T0NN57          TMEDQSPERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIEN
X5K347          TMEDQSPERAADIITMLITVYNEVSLEDKNKIAVNTASFIKERLAIIESELGAVESDIEN
A0A1T5K9D4      SIQDFSLQRANDILTAIVYRYNEEAVKEKNKVAVNTAEFIDSRIKIIRKELSDVEDMMSG
R5RVP0          TMKDRFPSRADAVLRTLIDVYNEHWVENKNRSARNTTAFINDRLIVIEKELGGVEENLKD
A0A285T4L1      SLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIERELGGVETELEA
A0A3E5BU42      SLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIERELGGVETELEA
A0A414ZBF2      TIEDENIGRAEDVLNTLIEAYKNDAIEDKNKVVINTANFIKDRLTIIEADLGVIDTEIED
R5KD55          SYNDVSGKRAEDILSAVIDIYNKVWMKNRNEVSAGATKFLDERLAIIERELDNVDNDISR
A0A174QNT3      VYQDVNIARADAILATILQVYNETIVEDKNRIASNTARFIDDRIVIISHELGEVEDQLTI
R9I0H0          ICQDVNIARADAILTSILQVYNETIVEDKNRIASNTARFIDERIVIISRELGDVENKLTT
K5BUT9          TCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTD
A0A174FPA3      TCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTD
R6S9Y6          TCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTD
C9KX15          TCSDTNISRADAILAALVKVYSETIIEDKNRIAANTAKFIDERISIISRELSDVEEDLTD
A0A3L8AAP1      TCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTD
R6DAG6          TCTGDNVSRADAILNALINVYNETIIEDKNRIAVNTAKFIDERIAVIGKELGDVEEELTD
A0A1G8BVM8      SIIDTHPQRAEDIINTLVTVYEKNAIDNKNQVLSKTVDFITDKTTILENELRSIDSDIEQ
A0A416GGJ1      ALRDFSPERAEELLNTMINVYNEEAIEDKNQVAINTANFINERLIIIEKDLGVVESDLET
A0A3D1NQW3      SMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEK
B0MT10          SMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEK
R7JGW9          SMKSSVPKKAEDVINTLIAVYEKDAIDDKRGIAESTGQFIDNRLEIISEELSEVDRNIEK
A0A0E2M2Y7      SMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
A0A0K2J6Z0      SMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
B2RKZ8          SMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
A0A212GC82      SMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
A0A254MU12      SMKNEDMDCAKDFLNVLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
R6CQ93          SLKDDSPLRAEDVLNTLVNVYNEEAVNDKNLVAVNTSKFINERLIIIQRELGGVETELES
A0A3D2BF46      SLDDNIPRRAEDVINTLIARYNDESINDKNRIADYTADFIDKRLRIIGSELDAVDRKIST
A0A358R538      TMSNTVPRRAEEVIDALVAVYNEDAVEDKRRISVVTSDFIRARLDVIGRELGDVDRGIEE
A0A1Y4AAB8      AMNDAVPKRAEDVINTLITVYNNDAIADKRRISEETADFIHSRLEIIGSELNDVDRDIEN
A0A1Y3WWY9      SMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIEN
A0A1Y4U5L4      SMSNSVAKRAEDVINTLIDVYEKDAIDDKRRVSVTTAEFIKSRLEVIGRELGDVDRDIEN
A0A1Y3VCJ1      SMNNAIPKRAEDVLNTLIEVYEQDAINDKRRVSVSTAEFIKSRLEVIGRELGEVDRDIEN
A0A1Y3QTW7      SMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEG
R6XWY7          SMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEG
A0A174AVF1      SMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEG
A0A373HTL7      SMNSSVPKRAEDVINTLIAVYEEDAIADKRQVSVVTNAFIKERMLAIGRELGVVDSEIEG
A0A1Q6EIY0      SMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIED
E4M8L3          SMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIED
I3YQ50          SMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIED
R5UEY8          SMNNSVPRRAEDVINTLIAVYEEDAIADKRQLSVVTADFIKERMQVIGRELGDVDRDIED
A0A1H4D866      SMNNSVPRRAEDILNTLISVYNEDAIDDKRRVSVTTAEFIKARLAVIGRELGDVDRDIED
A0A374A9J5      SMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIED
A0A1Q6E9S3      SMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIED
D4IJ36          SMNNTVPRRAEDVINTLIEAYNEDAIEDKRRVSVATGKFIKARLDVIGRELGDVDRNIED
A0A414Q925      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A415PUS9      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A108TCU0      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A413BA42      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
S3Y344          SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A413MY74      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A412TGL3      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A413VJ33      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A414L0W6      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A412DP39      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A413ZSE8      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
B0NP84          SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
R6AK43          SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTARFIGERLEIIEADLAAVDAEIEN
A0A412N2D9      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIEN
R6LHA4          SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIETDLATVDAEIEN
A0A1Q6FL18      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIEN
A0A1Y4JYS9      SIEDENVQRAEDLLNTLIEVYKNDAIEDKNRIVINTAKFINDRLEIIEADLATVDAEIEN
A0A3E5HPT8      TMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIED
C6IJ48          TMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIED
Q8A3U2          TMNDLSPTRAADILDMLITVYNEEAIKDKNRISVNTAEFIKERLQIIEHELGSVETDIED
A0A3R6S1H6      AIEDVSKARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIET
A0A3R6SD81      AIEDVSKARAEDIINTLIVVYNEDAINDKNQVAINTSNFINERLIIIEQELGGVESEIET
A0A413VXJ7      TLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEA
I9RSN9          TLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEA
U6RJK5          TLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEA
A0A1Q6GA32      TLKDVSIARAEDVINMAIAIYNEDAINDKNQIAVNTSNFINERLIIIERELGGVDANIEA
I9RPU6          VLDDVSTARAEDVLNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
I8Y597          VLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIES
I8YFS5          VLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIERELGSVDANIES
A0A1Q6GBF5      VLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
I8YFZ3          VLDDVSIARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIEN
A0A1Q6GDH2      VLDDVSTARAEDILNMLISVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
U6RSB0          VLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
I9SIK1          VLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
I9GXM2          VLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
I9TP59          VLEDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINERLIIIERELGSVDANIES
A0A0J6CIR2      TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIET
A0A3D8HG59      TLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIES
A0A3R6S408      TLQDESIQRAEDIVNTLIAIYNEDVINDKNQITVNTSDFINDRLIIIEKELGNVDSHIES
A0A354WXN6      TLQDRSIPRADDVLNTLIAVYKEDVINDKNQVAVNTSNFIAERLLIIEKELGSVDANIES
R5IP14          TMNDTDIKRAEDVINTLIAKYNEDAIADKNRLAVNTARFIDDRLEIISQELGDVDSQIET
A0A316SZX7      TLQDPNPKRAEDVINTLIDVYNLDGTNDKKKVAESTANFIDERLLIIGKELGEVDSEIAN
A0A1Y4AIY1      SLSDVSASRAEDVLNTLIAVYNEDAIEDKNRITVSTSEFIAERLVIIEQELGSVDTDIET
F3ZRU7          SLRDEVPQRAEDILNTLIDVYNEEAINDKNQMAMNTSEFINERLIIIEKELGGVDTQIET
A0A1C5Q1F3      SISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIAD
R7A239          SISDVSPRRAEDILNTLIDVYNQDAIDDKNRIAVNTANFINERLIVIEQELGGVESQIAD
A0A1M6K7I9      EYKDESIARAEDILNTLISVYNEDAINDKNQIAVNTSNFINERLIIIEKELGTVDADIES
A0A3R6HIK7      SLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIET
K5ZVW7          SLSDVSIARAEDVLNTLIAVYNEDAIEDKNRVTVSTSEFIADRLVIIEQELGSVDANIET
A0A1Y4D5Z0      SLSDVSISRAEDVLNTLIAVYNEAAIDDKNKVTISTSDFIADRLVIIEQELGDVDANIEA
R5S343          TLQDVSVARAEDVINTLIEAYNEDAVNDKNQIAINTASFINERLKIIDRDLGLVDSSIAS
A0A3R5ZMK1      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A3E4ZTK7      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGSVDSDIES
A0A1Y3ZIA4      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
K5Y1A4          TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A3R6K8X4      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A1Q6I3T6      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A414XX40      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A412DM15      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A7AEU7          TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A415BDM7      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A3R5ZYK4      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A414GI87      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A3R6BKI7      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A414LPI6      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
A0A412M2W1      TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
K5ZX55          TLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIEKELGDVDSDIES
K5ZBN2          SLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEV
A0A0J6CKW3      SLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEV
A0A0F5IQM7      SLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEV
S0GLB0          SLQDVSASRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGNVDAEIEV
A0A3R6NLC1      SLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEV
A0A416WYC9      SLQDASVSRAEDVLNTLIAIYNEDAISDKNQVMVNTSNFINDRLIIIEKELGSVDAEIEV
A0A0F5IT40      TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIET
S0GSI7          TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIET
K5YB65          TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIET
A0A0F5IWP9      TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIET
A0A0F5IZT8      TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSDFINDRLIIIEKELGSVDADIET
A0A417LKQ2      TLQDVSIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEKELGSVDADIET
A0A416TME1      TLQDVSIPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIET
A0A416XPE8      TLQDVSIPRAEDILNMLIAVYNEDAINDKNQVTVNTSNFINERLIIIEKELGSVDADIET
L8JI02          SMRGSVPHKTARFLDQLLHIYLQNELHKKNQLGVKTIQFIDSQLSGVSDSLKRVEGWLEN
A6EBM4          QQTDVNPRFAADILNAILQEYLDYDKLQKTQSATQMIGFINEQLKHLSSAVSGAEKSLET
A0A2N3U785      ELTEPVPEKGIDLVYHLISLYNKDKANDKKASAVNSLSFLDERIKFLSSELTDVEENVER
A0A0E3ZG78      GLTDPIPEKAKDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGVEKDVEQ
A0A1I6BRK6      SLIDPMPERAKNIVDKLMQVYNDEAIDDKKQLGTSALKFLDERLKFVTTELSTVEKGVAS
A0A243WAB1      SLVDPIPEKAKDILDKLMEVYNDEAVVDKNLMATSTLKFLDERLKYITAELSGVEKGVEK
A0A399SH26      QLKDAVPERGEAILNLLVHNYNQASVVERNILAENTLAFIEDRMQKVEKELDKLESRVQK
A0A0E3ZGV6      YLEDKVPERGEDILNALIHAYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNLEDKIVK
A0A1I2N4S1      YIEDNVPERGEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVK
A0A2T5YE44      YIEDNVPERGEDILNALIDAYLQAAQVDRNALVSQTLAFVEDRIQLIEKELKVLEEQIVK
A0A1M4YED3      YFQDESAYRAKDVLNELMNVYTINGLSEKDALAANTLATIEKRLTFVAKDLDSIERTIQQ
A0A3P1Z8V4      TCTDINKHRAEDVLNEVCNIYKKDIVDNKNRVAQRTAEFIDERLTLISRELSDVEHRLAT
A0A2L2WX98      GCEDINETRAEDIINVVFDAYKRDIVANKNRVANNTAIFIDERIRIIDGERIASRDQMAK
G5GD56          SAQDINTARAEDLLNTVYEAYKHDVVDNKNRVASSTANFIDRRVALIGQELTQVENRLAS
R6A0L2          NCNDTNIERADQVLATLYDTYKEDVVENKNRVALNTAKFIDDRIQIIGRELSSVENQLAS
R7LG80          TFQDINPKRAVDVLNTLYNTYKEDVVENKNRVALNTARFIDERLKLIGTELSDVENNLAS
A0A1M6XHU0      TAESTTPEEAAVIANRYAEEYEKYSRERSRESLAAAREFVEKQVEQRRQELEALERQWEA
D0MHQ9          TAESTTPEEAAVIANRYAEEYERFSRERSRESLAAAREFVEKQVEQRRQELEELERQWEA
G2SF81          TAESTTPEEAAVIANRYAEEYERYSRERSRESLAAAREFVEKQVEQRRQELEELERQWEA
A0A2H3NSN0      VARSQYPEEAAAVANTYADAYRAYSRESARAGVAAAREFLETQLDRREEDIEEVENEWQQ
A0A2P6C324      RVESQDPAEAALIANSFAQQYRLFSREMARAGVVAAREFLETQLEKRKDDIRAIENEWEA
A0A126PFG0      QIKDEVPQRGMDVLNQLMAVYNGAATAAKNKLTANTLHFIDSRLASLRGELSQAEADEAG
A0A3M1N7Z3      SVTDISPVRATRFLNALIEQAREHERSIRQLQYTKALGYIDTLVNFFQNQLLVA------
R7PCR1          VCQDVNKKRAEVLLSTLLDVYREDIIESKNRVAENTSKFIEERIGLIEQDLIKVEGSLAR
A0A2A8CVM9      TVESGVPEEASTVANLYSSQYEIFSREKARASVTAARDFLETQAEKRREEIRELEQQWET
A0A3C0ZQC7      TARSVQPKEAALIANTFAEAYYDRNLFSSRSRSRAAREFLDTQLKVRKSSLDESEGTLQK
A0A2E3R1D0      NAVSTDPQEAALISNTYAEAFAQLTQDQSRSGASASREFLEDQVETQNDRLQETDAAVEQ
A0A2T2USC0      SVKGVSASEAALIANLYAQEYINYNERKSKESARSTRKFLEQQSKKFRNRVNRAEQRLEK
A0A2T2V0F3      SVRGVSASEAALIANLYSQAYIDYNQRKSQESARSTRKFLEQQASKFKNRVDRAEQELES
A0A2T2S682      TAQGPVPAEAALIADQYAAAYLQRTREKSRESLRAKRDFLDQQSDKFATQVQQADRALAK
D5H561          VAQDETPAVARRLANLFTEAYIELTQKSSRERVKASRTFLEQRSQELERELETIEQRIQR
A0A2H3NWA9      SATSTDPQEAALLVNLFSEEYVEFSRDRSRQSVQATYDFLKEQSESLRVDMEEAEQNLVD
A0A2A8CVB6      VATGRDAADVALVANIYADEYIRRTKEKARESLQASRDFLERQAEKLKAEVQAAEGEIEN
A0A2P6C1S6      SASSHHPNEASLVANLYAEEYIQRTQERSREDLRASRQFLEEQADTLRQDVQAAEQKIEE
A0A2T2UTM4      SAKSHHPYEVSLIVNLYAEEYIQRTKEKSREDLKASREFLEEQADTLRQEVQAAEQKIEN
A0A1T5MMH4      AFQDNNPLKAHAIVDAINKTYLHYSYEQKKLTTKQKIDWLNNELQQIELKMEGFEDYFER
A0A2W4R1L8      SFKDHNPLKAQTVVNKIDSLYLIFSNEQKTLANRQKITWLTNELKQIEEKMSQYENYFED
A0A2E5CV79      TFQSVFADEARRISDGIAQVYKNLEKTIGNEDATLRVEFMDDLVNQQEGKLLLAEDSLKQ
A0A2A4G4B1      TMEVEQAERGQLILEELVATYNKLEQDDKNLISENTAAFIDSRLKGITKELVMVEGHLES
A0A2D4ZVH1      SFESPLPTEASSIINMTMDTYSALSTEQNRTMAVSALEFLRTERTKLESELVSTEDSLQN
A0A0E3V905      SLEDAVPAKGEAILNQLIREYNEAAIMDKNKVAASTLKFIEDRLNIVSGELASAERNVEQ
A0A1M6GR99      SMKTNSVQLGEDIINELIQVYSESNLEKKNHLANMTLEYIDEQLDEVSASLNLTENNLQK
A0A1M5BA90      AIMDEVPERGENILNTLIQAYYRSAAKEKNVLAANTLSFIEGRISNVAKELDSIENRLQK
A0A1V9F098      TFRDEVRDRGEDVVNKLLVAYNRLSIEEKKGTAANTLEFIETRLAKVEKELDSIEQRIQT
A0A1V9FHD0      TYSDAVPQRGEDIMNHLLLAYNQLSIDEQRGTAANTLAFIETRLKSVRHELDSIEGKIQT
A0A1T5CS78      SIKDEVPERAENILNRLIYQYNQKIIKDQNELALSTMTFIDERIENVEEELDELEYKIQQ
A0A0Q9Z8F1      TIRDAVPERAENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEAELDELEYNIQE
A0A2N0U0M7      TIRDAVPERAENILNRLILEYNRKIIKDQNELAASTMTFIDERIENVEADLDELEYKIEE
A0A1M6TTV4      ALSDPNKYKAKSLLQAIDTIYLNFTKAAKNLAVEQKISFLDRQMKKTQVELEQYEDYFEK
A0A1Q6IT42      KIRESNKQRGKDMLSTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHDAENIVER
K0X1U5          KIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVEEELHEAERIVER
A0A416XAH0      KIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVER
R5EXK3          KIRESNKQRGKDILNTLIECYNEDAVLNKNLKAQNMLSFIDERLITVKEELHEAERIVER
A0A401UAP7      SFKEFSAEKAMDIVNKIVNIYLGFSNEQKNFANKHKIDWVNNELEQIEEKMSQYEDYFKD
A0A1W2GF52      SLSDFNQTKARNLLQAIDTIYLAFTKNAKNQAVEQKIRFLETQMAKTSKELVEYEDYFEK
A0A2G5L7B8      ALADPNKYKARSLVQAIDTIYLNYTKAAKNQAVEQKISFLETQMYKSQIELEQFEDYFEK
A0A0D3LFR6      SLTDYNPYKARVVVDAVSNMYLTYKEEEQIKANNQKIAFLNTLVEDAESKLEGYETYFED
M7N6D4          SLSDHNPFKAKVLVDVLSNMYLGYTEEEKIKSNSKRIAFLDEQVEETEAKLEDFESYFEN
A0A364XUP5      AFKDNNPSKARAILQVIDDVYLKYSHEQKNLANKQKIDWLNNELQQIEEKMEGYENYFKH
A0A1M5RLA9      SFKDNNPTKATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFEN
A0A385SFR9      SFKDNNPSKATAILNKIDSIYLHYSYEQKNLANKQKIDWVSNELVNIEHKMEDFENYFEN
L8JW09          AFKDYNPLKARDLVNAIDTLYLKYSEEEKNLENKQKIEWLNSELRQIETQLEGYEHYFEN
A0A1Q3ZMZ7      KFESHNANLSRDVVNVIIDEFFAFDEMLKKQSSENVLNFLNNQLDSLAIELNKSRDSIVF
A0A2D8JJW3      TVESLDSKEAANIVSCLIDSYVEEEKKHANQKTSDQIIFLKNQILSNSDSLLKMKDEIQK
A0A2W2AFF7      SLQSNIPHQGEDALNKLINVYLQANVDDKNKIADSTMRFIDDRVALVGEELTGIEKKIEA
A0A2N5YXE2      TYNDYNARKSAEITNTIAEKFIEFDENKKKESANNIITYIDQQMENVFLQLTNTEQNLHD
A0A2I0QZ80      SYRSHSPTFAKDIITALTKSFFKYDEGLKKESAENVLGFIASQLDSLTRELSISKDSVMR
A0A2U2XBJ3      SFRSHSPLLAKEMIQSLTANFFKYDENIKKESADNVLEFIAVQLDSLTRELKMAKDSIMV
A0A3E1F1A3      AYRSSSPQLATDMVKSLVSNFFNYDEDLNKESADNILDFINQQLDSLTQELSVSKDSIMY
A0A1V9F383      TLRDPIPRRAEDILNKLLIAYHLQSIEEKKGMAANTLEFIEARLLKVERELDSIESVVQT
G8TRZ6          TLRDEIPKRGEDILNRLLTDYTQQSIDEKQDQATNTLNFIEVRLGKVERELDSIESVVQT
A0A2W1NDY9      SFRSNNNVLAQDMVREVVETFFTYDLEKKSKSSESILSFIDEQLDTVYNSLKFSENSIQS
A0A1G0CI31      RYQGYNAELCHDITNAVAEAFFTYDEEVKRKSAENILQFINKQLDSISGELQISKDSLTL
F2IKD6          RYTGNNPELCRDIIKSVSLTFFNYDEEMKRKGADNILAFIQIQLDSISGELKDSKDSLTD
A0A1I7BM74      SYRSNNAHLSQDICNAVGESFFDYDDHLQQESSEKILKFINAQLDSLNKELILSRNALTE
A0A2G2FJ17      SYRNTNANLAQDITKAIGDAFFEYDERYTKESAENILSFISLQLDSLRKELSASKDSIMY
A0A416X8R7      NCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTD
K0XJ09          NCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTD
R5EUZ0          NCVDSNISRAEAILNALIDVYRETIIEDKNRIATSTAKFINERVEIISKELGDVENELTD
W0EQS0          NCVDSNISRADAILSTLIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTD
A0A1Y3WE15      NCIDSNTSRAEAILNTLIDVYRETIIEDKNRIATSTAQFINERVEIISRELGDVENELTN
A0A1Y4GUK3      NCVDSNISRAEAILMALIDVYRETIIEDKNRIATSTAKFINERVEIISRELGDVENELTD
A0A2U1FKU2      SLNNTDLDRAKDFINTLISSYNDDVMNDKKSVAVSTATFIDERLAMIGGELGSVDTEIET
A0A0A2F954      SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAISTASFIDERLAMIGGELGSVDTEIET
A0A0A2FW91      SLKNEDLDRAKNFVNTLISSYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGSVDTEIET
A0A2D2N2N1      SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
Q7MWZ2          SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
T2NDT6          SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
W1R7P9          SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
A0A1R4AFZ0      SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
A0A1R4DVZ7      SLKNEDLDRAKNFIDALIASYNDDVMNDKKSVAVSTAAFIDERLAMIGGELGTVDTEIET
A0A1G9E2A9      AFKDYTPEKARDIVNKIDSIYLVQTIENKNLATEQTLKFLDDQLDSTAQKLAQQEESIED
A0A2T2YJE8      SFTDHNPFKAHEIVNSIDSVYLEQKIALKDLATRQTLSFLDEQLKETNENLGNSEIQMEN
A0A3M9N829      SFKDFNRYKARDIVNNIDTVYLQHKLERSNQASRQTLNFLTEQLKETENSLKKVEDEIES
A0A0P0CSF9      AFKDFNRFKARDIVNNIDTVYLQYKLERSNQASKQTLNFLNEQLKETEDSLRKAENDIER
A0A3M9MNC3      SFKDFNRYKAHDIVTNIDAVYLQHKIERSNQASRQTLTFLNDQLKETEDSLRKAENDIER
A0A2M6GH67      SFTDFNPRKAQDIINRVDSAYLVQKLLVKNQATQQQLKFLDEQIQATKDDVTRYEKAMQD
A0A127B287      SFKEFNREKARDVVNKIDTVYLQQKLARSNQASQQTIDFLSNQLQETQDNLQKAEIDMEY
A0A369QP10      SFTDHNPFKAHEIVNSIDSVYLEQKIALKDMATRQTLSFLDEQLKETNENLGNSEIQMEN
A0A418R9X5      SFTDYNPSKASDIVNYVDSVYLVEKILRKQETMARATNYIDRQLGVNSDKLSQAEAKMQD
A0A428JSJ3      SFADHNPVKASDIVNKIDTVYLVEKLLRKQETMARATSYIDQQLGINDNKLGQAESNMQD
A0A428KI59      AFTDHNSVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQD
W8F1I6          AFTDHNPVKARDIVNKIDSVYLVEKLLRKQETMARATNYIDKQIDINDNKLGQAESNMQD
A0A246FQC0      SFTDHNPAKAQAIVNGIDSVYLVEKLVRKQEQATRAMGYINDQLGDNNQKLNQAEEAMQS
A0A372E5P8      SFTDHNPAKARDIVNAVDAVYLEEKLTRKREQAARALRYINEQLGSNNQSLSQAEENMEA
A0A1H3EMW1      SFTDHNPAKARDIVDAVDAVYLEEKLVRKREQSARALRYINEQLSNNNESLGQAEENMQS
A0A1H9ZSN3      SFTDHNPAKARDIVNAVDAVYLEEKLARKREQSARALRYINEQLGSNNQSLSQAEEAMEA
A0A0M3RW20      SFADHNPLKAKDIVNRIDTVYLVEKLAKNSQGQQQTLQYLDEQLDITRDSLQRAELALQR
A0A1S9B3W0      SFTDNNPAKARDIVNKIDSVYLQVKLARTNQATQQTLTFLDGQLVENRDKLQNAEEALQN
A0A1W1VRL3      SFKDFNPAKAQDIVNKIDTVYLQEKLAQKKKASDQSLQFLSEQADAFNNKLQLAEDNLQS
A0A1M6R305      SFQDFTPAKARAIVNKIDTVYLQEKIAQKQAATAQTLQFLQQQLAENRQNLAVAEENLQS
A0A2M9B9H9      AFTDFNPAKARDIVNKIDTVYLQEKLAKKQEATAQTLQFLDKTLTENQQKLQSAEENLQA
A0A126PDF2      SFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQG
A0A2Z3GKA1      SFTDFNPKKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNYDNLERAENRYQG
A0A328BL48      SFTDYNPAKARDIVNKIDSVYQQVKLARNYQSTQQSMAFLDSQLNGNRDSLQKAENALQA
A0A3S0QKV1      SFSDNTPQKAQAIVNKIDSVYLNVKLDRSSQATQQTLAFLQGQLLDNRAKLQDAEKALEE
A0A3R9P8H7      SFTDHNPTKARAIVNKIDSVYLVEKLLRKQEQAARAMSYINEQLGENNQKLGQAEENMQA
A0A212UCJ7      SFTDNNSLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLADQSNDNRQLLRQAEEQLQE
A0A238WIA7      GFTDYNPLKAHDIVNKVDTAYLVEKIQRKQEQSAKTLRYLAEQSEENRRLLRQAEEQLQD
A0A0W8EDI5      SFKDHNPKKARDIVNKIDTLYLQEKLAKNTQATQQALAFLEGQLDQNSQRLQGAEEALQE
A0A3B7RBP8      SFKDHNPGKARDIVNKIDTLYLQEKLAKNSLATQQTLAFLEGQLDENRNKLQGAEVALQE
A0A1I5WSL8      SFNDFNPTKAQDIVNKIDSLYLVEKVTRKNEATRNQLKFLDQILDENGQNLERAEDRLQS
A0A0U3JVM7      SFNDFNPSKAQDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERAEDRLQN
A0A1G1SSV2      AFNDFNASKAQDIVNKIDSVYLEEKLAQKSESTISKLRFLDQILDQNGQNLEDAEDRLQK
A0A1G1SXV7      AFNDFNPSKAQDIVNNIDAVYLEERLAQKQESTISKLRFLDQILDQNGQNLEDAEDRLQN
A0A243WHR7      SFTDFNPSKAQAIVNKIDTVYLQEKLAQKQEVTQRQLKFLETQIVENKDSLQGAEKNLEK
A0A076HRT9      SFQDFSPSKARAIVNKIDTVYLQEKIAQKQTATAQTLQFLDQQLTENRQSLAQAEENLQD
A0A1M6DHW8      AFTDFNPAKAQDIVNKIDTVYLQEKLTQKQQATAQTLQFLEKTLSENRKQLQLAEENLQS
A0A3D1KEX9      TCKDNNKDRAEAILTVLMDLYKRDIVESKNSVAANTAKFVDQRIDLIGSELNDVENKLAK
A0A358Y7S2      TYENSNAKLSYDITKTLIEQYLFFQEEMNIKNAKKTIDFIDYQLDSLSRVLEISKEDLAN
A0A1X7J248      TFEDYNPYKVQEIVETVSELYTEYSKEQKNKANQLKIQFLNKQLKQTESELANYETYIED
E4TQD2          TFEDYNPYKVQAIVEQVSELYTKYSKEQKNKANQLKIEFLNKQLKQTENELSNYETYIEE
A0A2J6HHN3      SLRDINASKATDIVNAITTEFELFEIEEQKQSSESILEFIDGQLGIVEENLTESEDSLYK
A0A1Y3WMT8      KIKDSNRKRGQDILDTLIECYNEDAVLNKNLKAQNMLSFIDDRLATVENELHEAERVIEQ
A0A1Y4GQU1      KIEDSNRRRGQDILDTLIECYNEDAVLNKNLKAENMLAFIDDRLITVENELHEAERVIEQ
A0A1V5W8T5      YYTSNNAQKTSDLVNTISEDFLTYNIEKKQERAEKVLAFIEEQMSVVYNKLDESEKQLDQ
A0A2T8HKA9      TLEDHSPKRATDLIKTLIEVYNEQTVEEKNRVAVSTADFIRERIAIIERDLGTVETDLER
A0A3B8INU3      SFQEYNRQKAQDMVGAITSIYQTYTKDQKKQANQQKIEFLDDQLMQTEERLDRYDKYFEN
A0A098LL25      SYKNHNYSKATDIVNTIDSVYLEQTLENKSKSHEQTIKFLEASLLKTEENLAKAEKDLET
A0A1Q3Q573      TYADQNPEKAKDIANALATEFIDYDLNKKREGMGNILRFIDGQIDSFSREQQAIQDSVAQ
A0A357YNR3      SLICSNVALGRDFLVKYIQTYNEKGIADQIELADKTSRLIDDQLSKLSGELSDVENQVQI
F4KK08          TIQAGNPLLAEDFLSTLILVYTELERSDKVKIAESTQRFVDDRLAIISSELGQVDAEIED
A0A3N2N6F7      AIKDDNVQRGDDFLSALIDIYNEKWVEQKAQMAVATSEFINERLNVIEKELGHVDDNIAT
A0A419VXB7      QLTGQNPDQKISYLNELSRVYIQYGLQQKNQISDNTIHFINQQLKDIVDTLKSTSNEFTK
A0A2V1ILM4      TFKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIAD
A0A3N2L0E8      TIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIAD
A0A3N2LFC5      TIKDVSIQRADDFLNTLIDIYNEKWVDDKAKMAKSTSRFIADRLRVIEQELGNVDSDIAD
C3J7R8          TMQHQNPEVAEDFLNTLVQIYNENSRMEKVRVAQKTEHFIDGRLAIIGGELGSVDTEIEQ
A0A0B0BTJ4      SISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEK
A0A3B9CNN6      SISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEK
R5X290          SISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEK
A0A1Q6E6I7      SISDHNPQKAAALTNKLIEVYNEDAINSKRRTAEATMRFIDERLQAVEGELSDVDTAIEK
A0A2G2F510      SYRGYTPQLCKDITLAISNSYISFDEDMQRKGSENILGFIDSQLDSLSNELKSSKDSLMI
A0A316JZ08      SFKGHNARMCRDLSLAIAEAYQEYDEEINRKSSENVLSFINNQLDSLYFELQSSQDSLAD
A0A1I1FXP9      IIKDHHPQKAHDIMVTIDSVYLEQTLEQKNKVNEQTLAFLNSQLDTTAQKLAMSEKEVER
A0A3B9FXJ0      EYTDVNDQRAKDVVNTIADAIVTNGLERKSVSANSIISFIQSQIDSLENELYIQENILKD
R5GSU5          TFQDTNKKRAEDFLNVLLDVYKEDIIDGKNRIAESTAIFIDSRIKIIGDELNDVEGSLAR
A0A2P8EAX2      RLLDSSPTRGKQILNSLIEGYNTSNQNQKNEVALKTIKFLDEKLFLAKKELDSLEMYVER
A0A3N4H5N3      TMLNTSPARGKDIMSSVINGYNFLNLNQKNEVALKTINFIDERLALAREELNQVERDAEQ
A0A2A3UE91      RVKDVNAAKSSDIVNAITEEYLAFDVERKSESSRNIISFIDSQLGNVYDALKDTEGDLQK
A0A0A2G557      RFKDENTDFAEDFLNTLISQHDATSRSEKLKIAHNTEAFINDRITIISKELGDVDQEIER
A0A2N2WFW8      SIRDMNPRKAADLVNKVAEEFAAFEVEYQKESSNSILDFIDTQLGLVEDNLDQTEDSMRQ
A0A1F3IU95      SLKDYNPRKAADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQ
A0A3D0VUF6      SLKDYNPRKAADVVNSVAKEFATFEVEYQKNSSNSILEFIDSQLGQVEENLDQTKDSLQQ
A0A1T4PT95      RFRDENPHLAEDFLNTLINEHDTTSRLEKLKIARSTEAFINDRITIISKELGDVDHEIER
A0A3Q9FR88      SFKAANREKAVAVLKAINTAYSQLSRESKALVYERALTYLFKQIDTTKDSLALQEKKMRA
A0A150ADJ9      SFTAGNREKAIAILQSINLAYSQLSREGKALVYERALDYLYNQADLTRDSLSLQEKKLRE
A0A1B1FWQ4      SFTARNRKKAERVLEAINKAYSQLSREGKALVYERALEFLYSQIDITKDSLNNLETKMRE
A0A1S1Z228      SFTARNRKKAEAVLEAINKSYGQLSREGKALVYERALGFLYSQIDITKDSLNNLEKTMRE
A0A1F3SJM1      SFRGHNAQLCHDVTLAISKAFQEFDEESKRQGADNIIRFIDNQLDSLRKELKSSKDSLMF
A0A2G2EB96      SFRGYNAVLCRDVVNAVSKSFIEYDEEQKRKSSDNIISFIDDQLDSLSSEVRIAKDSLIR
A0A2G6PRA9      SFRGHNATLCRDVVQAVSESFIEYDEEQKRQSSENIISFIDAQLDSLSSEVRIAKDSLIE
A1ZKR2          NFRDHHPQKARDIVHVIDTIYLHKTLENKKRANTQQKAYLNRRLGEIEDSMRTYEAKIQS
A0A1Q3GX01      NFRDYNPLKASNIVHVIDTIYLQKTLENKKRANIQQKEYLNRRLNEIEDSMRNYEGKIQA
A0A349DQI4      NFRDFNPLKAKHIVHVIDTTYLQKTLENKKRANIQQKKYLNRRLNEIEDSMRNYEAKIQG
A0A2N3IIZ0      SFKDHNATKARDVLKSISEVYRVKSVEIKNRANRQKKEYLDAQIEKTEKELNAYEAEMER
A0A2A4PYG9      TVRENNPQKAADIVNSMASEFVEYDVEKKAQSATKILEFIDSQLLQVYDKLRSSENKMQG
A0A2A5FYT6      SFTDHSGKKAKDISEAIAEGFINIDVERKSQSAEKVLNFIDTQIESVYGRLRTSETSMQS
A0A2E6SYP1      GYSGDHPEKCADIVNSLASAFLISNISKKKESANQMIKFTDDQVVKINKRLEYYRKLLKP
A0A2E5RLE8      SYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQP
A0A2E7TQF6      SYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQP
A0A2E6GVY9      SYTGNHPKKCADIVNSLSSLFLISNISKKKESANQMIKFTNDQILKINQKLEYYQKLLQP
A0A350JJ90      VVTDNNPAKASAICEQIAQTYLVFDHERKSESANQVLEFINQQIEEVYSKLKISEDLMSE
A0A3M1CDV2      SIKDVNPQKTTDIVNTIAEEYLIYDVERKSESSKNILNFINAQLSVVYEELKNSETKLNE
A0A2E2TFD1      SFTDPNPRKAADLANAISTGFIDYDLTRKIYSSTQVIEFIDSQISEVYGRLKESEVSIQE
A0A2E4ELE6      SFSDYNPRKAADLSNAISGGFIDYDLQRQITSSNQILEFIDHQSSEVFTRLKSSEVSIQE
A0A2E3XZI5      IHKHSNTFFSKDICNSLAEIYIDYDLERKQLSSEKIVKFINNRKDSVQKKLILNEKKIRD
A0A2M7NLQ9      SFTDNNPYKAAIVTNTVVDIYFEKTLENKNKVYRQTINYLEDQVRIVQDSLERIEKRIDN
I4AFR0          SFTDNNPYKAAIITNTIVDIYFEKTLENKNKVYKQTIDYLDAQTTIVQDSLEQVEKRMDD
A0A2N2Y3E5      TYTDFNPQKTSEIVNTISEQFLKYDVEKKKESADKILDFIENQSDLIYDELDKIEEQLIL
A0A2D9D7T6      TFDHYNPELTRDMTQAIMDVFFLYEEEISKKNTDKILAFVDTQLDSLSTLLQKSKDSITS
A0A1F3PPL5      SYVDNNALKTSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHS
A0A357QK06      SYVDNNALKTSEVVNTIAEEFRKYDVERMKESAESILAFIEEQLEAVYKKLSETERQIHS
A0A2A5B3B0      SFQDNNGEKAKEIITAVANEYIDYDIEERSKSSKKALQFIDQQLDKYYNRVKGAENRIQE
A0A0F2NS19      SFNDNNALKTSDVITSLANEYILYDIEERSKSSKKIIQFLDDQLDKYYNKVKLSENRIQD
A0A2A5H8X6      SFNDNNALKTSDIITSLANEYILYDIEERSKSSKKIIQFLDNQLDKYYNKVKLSENRIQD
A0A2H0GAU8      SFQDNNSTKAKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQD
A0A2M8FTK1      SFQDNNSTKAKDIVTSLANEYILYDLEERSKSSKKVIEFLDDQLDKYYNRVKLSENKIQD
A0A0S2HYK8      SYQSHNSQQAADLVNAVAREFQRFEVEKKKESIQNILAFIERQLKNVYKTLDTTESKLQE
A0A2N5ZWN6      TYESNNSQQAADVVNKIAQEFQLFDVEKKKESVKNILDFIERQLKNVYQTLDNTENKLQQ
A0A2E0FJ09      SFTHPNQVLTKDVLGALIENFDQFDSIKRSESSNRIVEFIAMQKDSVSKKLKESERMLKD
A0A1F3FZ62      NVTNQNATKSADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDM
A0A1F3K211      NVTNQNATKSADIANAIADEFILYDIERKAESANNILKFVDDQLGLVYDQLYKTESDLDM
A0A1F3KLL5      KYSDYNAQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHD
A0A359D1M1      KYSDYNAQKTTDIVNVIAEELLKYDVEKKKESAMKILDFIDEQLQSVYLQLDENEKKIHD
A0A2E7CT70      TYSHTNPKFAQDVCNTISKVYIDYDLKKKALSSINIVQYINAQKDSVDKRLKLSEQEIQI
A0A2D5V560      SHQHTNPHFSKDICNSIVKNYMDYEIDKKQKSTDNIVSFITRQKDSVRKRLIRNEKDLRI
A0A2D7K5A8      SHLHTNPHFSKDVCNSFVKIYMNYEINKKQKSTDKIVAFIKIQKDSVKNRLIKSEKDLRI
A0A2E1XQ82      SHQHTNPHFSKDICNSIVEIYMNYEINKKQKSTDKIVAFIETQKDSVKNRLIKSEKDLRI
A0A1V6I2U9      TYQDFNARKSTEITNTIAEKFIEFDEAKKKESATNIIKYIDQQMENVFTQLNATEKDLHN
A0A1F3C1M2      SFTDNNATKTSDVVNTISEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTEREIHD
A0A1F3DS87      SFIDNNATKTSDVVNTIAEEFLKYDVEKKKESDQQILAFIEDQESLLLKNIDQTERELHD
A0A2H0B957      SITDNNARKTSEIVNAIAEQFIKYDVEKKKESSQKILDFIEVQNNLIYQQLDSIEQLLIK
A0A1F3CFW6      SFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQ
A0A2M7E2T8      SFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQ
A0A2M7NC69      SFKDNNAQKTSEIVNTIAEEFIKYDLEKKKESSQQILNFIENQNNLIYQQLDSIEGLLMQ
A0A1F3K695      AFSDNNPLKTAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHD
A0A353KZR1      AFSDNNPLKTAEIANVIAEEFLTYDVEKKKESANQILSFIEEQESTFVKNIDETEKALHD
A0A2N2WYB5      TYSGYNPEKAADIVNTIAEEYLKYDVESKKESAESILAFIEERLKLVYQNLDETEKQLHE
A0A1F3K4G0      SYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVA
A0A356H8Y3      SYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVA
A0A351HSA6      SYSGYNAEKASDIVNTIAEEYLKYDVEIKKESAANILAFIEERLKQVYHSLDETEKELVA
A0A1F3Q014      SYKGFNPQKAADIVSKMTEEYSNFDIERKGESSLKVIEFIDHQIDIVYEQLKSSETSIQE
A0A2A4YXP3      SFEDHNPKKAVDIVTAVANEYIIYDIEERSRSSKNALQFIDEQLDRYYNKLRLSEDKIKD
A0A2D5KD44      GISDNNRLKAFDIVNGLIDEFKLYNVEKKKQSSKQILDFLNAQIESVYEKQKVYERQIQR
A0A1F3R158      SFQDNNAVKTADILTSLANEYIIYDIEERSKSSKNVIEFLDDQLDKYYNKVKLSENSIEE
A0A2M8ADX2      SFQDNNATKTADIITALANEYIVYDIEERSKSSKKVIEFLDDQLDKYYNKVKLSENSIEE
A0A1J5B2H0      TFRDENAQKTSDIVNTIAEEFVIYDIEKKAESTNKIIEFIDNQINRMYDTLAKSENQLER
A0A1V5N756      MYSDRNPVKAADIVDTIISEFNLYDVEKQAMSTDKILKFIDEQLEIFNQKLFETKNDIQE
                                                                            

A0A1I3J6V0      ------------------------------------------------------------
A0A1H4ADG3      FKQHNELADLPTQSQ-----SLIANAGENAK-----ELAAQQVQLSI-------------
A0A3D5KRY6      FRAENRTVDLGREAS-----LVVENLKKVEA-----DRANLDLRLES-------------
A0A1V5IPN7      FKNENKLIEISETTR-----KWIEQTTQVES-----QYEAALTEQAV-------------
A0A1V3WH52      YRQDKDSVDLPLEAK-----SVLDSMVNIDA-----QLNEL-------------------
A0A2K8Z965      YKSHQGITDLSVQAQ-----SFLETVQQNDA-----SLIQVNVQLAA-------------
A0A418M8U8      YKATQGITDLSTQAA-----SFLQAIQQNDG-----LLNQVNIQLSA-------------
I2GTA4          YKATQGITDLSTQSA-----SFLQAIQQNDG-----LLNQVNIQLTT-------------
A0A2K8ZAJ2      YKSTHGITDLSVQAE-----KFLTTVKDNDL-----QLNDVNMRLGA-------------
A0A368JPA3      YKAVNGISGIGSGAQ-----SLLSSLQSNDA-----QLNRVAIQLST-------------
A0A3P1BT12      YKSANRISGIGSDAQ-----ALLSTLQNNDA-----QLNQVAIQLST-------------
A0A3P1CI15      YKSVNRITGMGSSAQ-----ALLSNLQSNDA-----QLNQVAIQLSS-------------
A0A1Q3PII2      FRKHHRVIDATEDGR-----QILERFHANAS-----EEKELAVRMKI-------------
A0A351BXT2      YQKNGGLILLDAQVK-----NVVENISVLEA-----QQNAARIELNS-------------
A0A3D0MYJ7      FQKQNGIVDVQQNVS-----ELLGKSSEVEN-----IKNLGKIELNA-------------
A0A3D3LS70      FQQRGGIVFLDDQAK-----SIVEQIATLEA-----QKNASEVELIT-------------
A0A1G7ZF38      FRKRHRVIDMAEDGR-----QALQQYHSNAS-----DEKQLAMHLKI-------------
C6VS52          LRKQHKLIDIAEDTR-----QALQKLAANTS-----EEREWATHLKI-------------
A0A1G1TM36      YRSQQGLADVASQSQ-----IVLENTQANDT-----RLNTAQVQLAV-------------
A0A1V3WH27      YRAQRDSVDLSLEAK-----SVLDQ-----------------------------------
A0A0D3L8Q3      YKRERRLTNVGTEAQ-----LYLQGRTGYDQ-----QLSEYELQLEI-------------
A0A0K8QSK7      FQSDNRVIDLSAQSQ-----QLLQQMSELDN-----QRVVLESQLKY-------------
A0A1V6CN82      FQSRNRIFDIGSQSG-----QLLSEMSELDS-----KKQELETQNKY-------------
A0A1M4XZ45      FQSENQVLDISMQSQ-----QLLEQMRDLDQ-----QRVALETQNKY-------------
A0A399D319      FQSEHQVLDISMQSQ-----QLLEQMRELDE-----ELVTLETQNKY-------------
A0A0P7X1V8      FMNQNQLVQLDAQAQ-----QLIETLSTLEA-----ESQGIQVKLVA-------------
A0A3B0C2S4      FKRLNNLSYIESDVD-----FSLQRKAVAQD-----EVTNLETQISL-------------
A0A416GA42      YRSANQLID-GTQSG-----LYLQRADQFQN-----EAVQLQTELEL-------------
A0A3N2M1H3      YQTTTGSPDLIASAQ-----ASMEKESNLEQ-----SILNIENQLSI-------------
A0A1T3IYP5      LKIANQGIDIATAGG-----TFLTEKNQYRS-----EGAKVETDIRL-------------
A0A212K7W5      FKSQNLIPDIQAASN-----MYMARSNENDT-----KIQALSTQHTI-------------
F5IU11          FKSQNLIPDIQAASN-----LYMVKSNENDT-----KIQALNTQYTI-------------
A0A352Z1R7      YKSSSGMFKLDSEAQ-----EVVKNLSETEK-----LRAEVIFQKKQ-------------
A0A0A2F501      FKSANLIPDLKETTR-----IYLDQTSEAEA-----QLLDLSNQLYM-------------
R5B7P0          YKSENMIPDVGAAAT-----MYMQQSTVLNQ-----QLQDVSNQLYM-------------
R5B0L5          YQSEHLIPNVQQAAS-----MYMTESQVVST-----QMLELNNQLQM-------------
A0A374THP7      FKSSNLLPDVEAAAQ-----QYMQKSTEVDK-----QIMDLNSRLAI-------------
A0A3R5XWG1      FKSANLLPDVETAAQ-----QYMQKSSDLSK-----QIMDLNSRLSI-------------
A0A414YFM3      FKSANLLPDVETAAQ-----QYMQKSSDLSK-----QIMDLNSRLSI-------------
A0A0A2EVS5      FKSKNLIPDVRTASE-----MYMTQAGEAGT-----QILALNNQLYM-------------
A0A1T4NAJ7      FKSKNLIPDVRTASE-----MYMTQAGEAGT-----QILALNNQLYM-------------
A0A2V1IJY1      YKSQHLIPDVSAASS-----MYMSQNQQISQ-----QIMDLRNQLKQ-------------
A0A3N2KCL3      YKSANLIPDVSAASS-----MYMSQNQQISQ-----QIMDLKNQLKQ-------------
A0A255T941      FKSANLLPDVQAASA-----LYMNQSAESKK-----AILELNSQLTT-------------
A0A1Y4CHN5      YKGENLLPDIQAASS-----MYMSQSQETNA-----QILELSMQLSM-------------
A0A1Y3V692      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A174TYU6      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A1M6I2S6      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
F3PXM2          YKSEHLLPDVQAASS-----LYLMQSAENKK-----ELLALNNQLST-------------
A0A3E4ZNL4      YKSEHLLPDVQTASN-----LYMNQSAENKK-----EIQALSNQLST-------------
A0A174AHH7      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A174JCE8      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A3E4JMC4      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A412SND6      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A414IEQ9      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A415UKN5      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A0M1W8D8      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLTT-------------
A0A3R6GKX5      YKSEHLLPDVQAASN-----LYMSQSAENKK-----EIQALTNQLTT-------------
A7V4S1          YKSEHLLPDVQAASN-----LYMSQSAENKK-----EIQALTNQLTT-------------
B0NU19          YKSEHLLPDVQAASN-----LYMSQSAENKK-----EIQALTNQLTT-------------
D4V601          YKSEHLLPDVQAASN-----LYMSQSAENKK-----EIQALTNQLTT-------------
A0A397WLT5      YKSEHLLPDVQAASN-----LYMSQSAENKK-----EIQALTNQLTT-------------
A0A3R6GM96      YKSEHLLPDVQAASN-----LYMSQSAENKK-----EIQALTNQLTT-------------
A0A015XH67      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A078RZN2      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A6L0K5          YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A7ACT5          YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A6KY94          YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A173UQR8      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A3R6HK75      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A412B7D1      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A412VNY9      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A414LTU9      YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
I9Q4U4          YKSEHLLPDVQAASS-----LYMSQSAENKK-----EIQTLTNQLAT-------------
A0A373ISF0      FKSEHLLPDVQAASS-----LYMAQSAENKK-----ELLTLNTQLST-------------
U6RF62          FKSEHLLPDVQAASS-----LYMAQSAENKK-----ELLTLNTQLST-------------
A0A073I794      YKSEHLLPDVQAASN-----LYMTQSAENKK-----ELLALNSQLST-------------
A0A108TH71      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
I8VXH0          YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
A0A412S0N6      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
A0A412IIJ0      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
A0A0P0FM97      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
R6KTP3          YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
A0A139LU87      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
A0A1C6B3Y5      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
E2NMQ4          YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSTLNNQLST-------------
A0A412YDB9      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSALNNQLST-------------
R7DY01          YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSALNNQLST-------------
A0A414LGK8      YKSEHLLPDVQAASS-----LYMAQSAENNK-----ELSALNNQLST-------------
A0A016E4F9      FKSEHLLPDVQAASS-----LYMAQSAENKK-----ELLALNSQLST-------------
A0A413PP50      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A3A5TI83      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A415NEB6      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A7AJ60          YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A015UXN7      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A395YYT3      YKSEHLLPDVQAASS-----LYLSQSAENKK-----ELLALNSQLST-------------
A0A415IPQ4      YKSEHLLPDVQAASS-----LYMAQSAENKK-----ELSALNNQLST-------------
A0A3E5BRW7      YKSEHLLPDVQAASS-----LYMTQSAENNK-----ELSALNNQLST-------------
K9DXS6          YKSEHLLPDVQAASS-----LYMTQSAENNK-----ELSALNNQLST-------------
A0A1M6KFV3      YKSEHLLPDVQAASS-----LYMAQSAENKK-----ELSALNNQLST-------------
A0A1Q6G7L3      YKSEHLLPDVQAASS-----LYMAQSAENKK-----ELSALNNQLST-------------
A0A413H235      YKSEHLLPDVQAASS-----LYMAQSAENKK-----ELSALNNQLST-------------
A0A1M5B2J8      YKSQHLLPDVQAAAN-----MYMAQASEANA-----AIKSLNNQTYM-------------
A0A255RCT5      YKSQHLLPDVQAAAN-----MYMAQASEANA-----AIKSLNNQTYM-------------
A0A1Y4GLF5      YKSEHLLPDVQAASN-----MYMMQSSETNS-----QILALNNQLYM-------------
A0A1H3XSC0      YKSEHLLPDVQAASS-----MYMAQSNQTNA-----LILTLNNQLYM-------------
B3JI46          YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A174UR09      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILSLNNQLYM-------------
A6LE40          YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
R6NN15          FKSENLLPDVQAASQ-----LYMTERSQAQS-----QILTLNTQLSM-------------
A0A358R8U0      YKSENLLPDVQAASS-----LYMAQSSETNA-----QIMALSNQLYM-------------
R6WSB6          YKSENLLPDVQAASS-----LYMAQSSETNA-----QIMALSNQLYM-------------
A0A401LPX7      FKSEHLLPDVQAAAS-----MYMTQANEANT-----AIRELNNQAYM-------------
A0A3A5Z900      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQTYM-------------
A0A3R6I893      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A3R6EGW5      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A285TGL6      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A3A5RFX4      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A1Q6IUW9      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A3R6NPG7      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A413XDP6      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
K6AP24          FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A076IQN8      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A078RYI7      FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
C7XEQ8          FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNDQAYM-------------
D7INX6          FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
K5ZG55          FKSEHLLPDVQAAAN-----MYMTQANEANA-----AIRELNNQAYM-------------
A0A3N2N9B8      YKSAHLIPDVQAASS-----MYMSENRQIAS-----GIMDINNQLQM-------------
A0A3N2NMI0      FKSEHLIPDIAAASS-----MYMSQNQQIAS-----EILAINNQIQM-------------
A0A359I8H7      FKRDHRVPNLEEAAK-----TQMKQSVEMSN-----KMLEVTNQMSM-------------
A0A3N2KA63      FKRDHRVPNLEEAAK-----TQMKQSVEMSN-----KMLEVTNQMSM-------------
A0A3B9FAU3      YKSSNLLPSVQAASQ-----MSMQQSQESQK-----QVLALNTQRSM-------------
A0A3C1E5L7      YKSSNLLPSVQAASQ-----MSMQQSQESQK-----QVLALNTQRSM-------------
A0A354SN68      YKSMNYVPNIGIATG-----MVMSQENSLDN-----TIVSTNNKIHM-------------
A0A0A2DUD9      YKSQHLLPDVQTASN-----LFLNQAAQVDN-----QIVELRSREYM-------------
A0A3N2N595      YKSENLIPDVDAAST-----LYMGESQRISQ-----EIMGLRNQLQM-------------
R5FHS9          FKSKNLITDVDAVAT-----SYLDQSTAANA-----KLLDLNTQRAM-------------
A0A3P1ZBJ5      YKSSNLLPDVESASK-----LYMQKTSANDD-----KLMELNNQLYM-------------
A0A413TW79      FKSRNLLPDVETAAQ-----QYMQKSGDVDK-----QILELNSRLSM-------------
A0A3E5E9M7      FKSRNLLPDVETAAQ-----QYMQKSGDVDK-----QILELNSRLSM-------------
A0A3E4SK73      FKSRNLLPDVETAAQ-----QYMQKSGDVDK-----QILELNSRLSM-------------
A0A415GGC6      FKSRNLLPDVETAAQ-----QYMQKSGDVDK-----QILELNSRLSM-------------
A0A413DBH9      FKSRNLLPDVETAAQ-----QYMQKSGDVDK-----QILELNSRLSM-------------
G9S1S8          YKSEHLLPDVQAASS-----MYMAQVSETDA-----QLLALNNQLYM-------------
A0A354M4S6      YKSEHLLPDVQAASS-----MYMAQVSETDA-----QLLALNNQLYM-------------
R7DH52          YKSEHLLPDVQAASS-----MYMAQVSETDA-----QLLALNNQLYM-------------
A0A396N3D5      YKSEHLLPDVQAASS-----MYMAQVSETDA-----QLLALNNQLYM-------------
A0A415ZDP9      YKSEHLLPDVQAASS-----MYMAQVSETDA-----QLLALNNQLYM-------------
A0A016CWA4      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A1C6H117      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A415TAH7      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A0M1W0V2      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A139KA16      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A174VQ92      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A1Q6HCG0      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A1Y4JYM9      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A3A5QW67      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A3A5RQE6      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A3A6BP07      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A3E5E153      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A3Q9IP20      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A412WV15      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A413ICP6      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A414KYB9      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A416X133      YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
E5WX00          YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
K0X3P3          YKSEHLLPDVQAASS-----MYMAQSSQTNA-----QILALNNQLYM-------------
A0A3A5Z014      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A1M4YZ07      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A078S3Q8      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A069SJV7      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A3E5DXI5      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A3E5EM98      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A3E5F453      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
I9T3G6          YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A0P0FQW1      YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
C3RFN5          YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A3E4SYU0      YKSEHLLPDVQAASS-----IYMAQSSQTNA-----QILALNNQLYM-------------
A6LGY1          YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
K5ZSH4          YKSEHLLPDVQAASS-----MYMAQSSATNA-----QILALNNQLYM-------------
A0A078T2W6      YKSEHLLPDVQAASS-----MYMAQSSEANA-----QILSLNNQLYM-------------
A0A3R6D1V4      YKSEHLLPDVQAASS-----MYMAQSSEANA-----QILSLNNQLYM-------------
A0A3R6EAF7      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A412MJT7      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3E4WKT5      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3A5YY33      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A078TAH2      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A1E9CFZ7      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A373FYU5      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3A5TZ72      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3A5XBP2      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3A6MEG9      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3E4JP35      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3E4KP40      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3E4NX82      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A3E4XFU8      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A412RG70      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A412TD37      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A413GAA4      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A414M7I4      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
E5UZA2          YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A069SMG6      YKSEHLLPDVQAASS-----MYMAQSSAANA-----QILSLNNQLYM-------------
A0A1Y4PQK7      YKSEHLLPDVQTASN-----LYMAQNSQISS-----QILALNTQLSL-------------
A0A1Y3ZDB3      YKSEHLLPDVQAASN-----LYMAQSSQTSS-----QILALSTQLSM-------------
A0A3A6AAP4      YKSEHLLPDVQAASN-----LYMAQSSQTSS-----QILALSTQLSM-------------
A0A1Y4IH41      YKSEHLLPDVQAASN-----LYMAQSSQTSS-----QILALSTQLSM-------------
A0A1Y4DYA7      YKSENLLPDVQAAAN-----MYMTQSNATNS-----QILVLNTQLAM-------------
A0A1Y3X4I9      YKSENLLPDVQAAAS-----MYMTQSSETSS-----QILALNTQLAM-------------
A0A1Y4FNK8      YKSEHLLPDVQAAAS-----MYMAQSSETNA-----QILALNTQLSM-------------
A0A355FD59      FKSKNLLPDVEAASG-----MYMEQSRETSN-----LLLSLKSQLSM-------------
A0A359CEZ9      FKSKNLLPDVEAASG-----MYMEQSRETSN-----LLLSLKSQLSM-------------
A0A353Q7B4      FKSKNLLPDVEAASG-----MYMEQSRETSN-----LLLSLKSQLSM-------------
A0A1M3KVR9      YKRQNLVPDVEAASS-----MYMAQSRETSN-----LMLDLNTRLSM-------------
F8X3A5          YKRQNLVPDVDAASS-----MYMAQSRETSN-----LMLDLNTRLSM-------------
A0A3C1ITV0      FKSSNRLLDMNAETA-----QVTQESSKYSE-----QAFLANNQLAV-------------
R7HN19          FKSSNRLLDMNAETA-----QVTQESSKYSE-----QAFLANNQLAV-------------
A0A415EEZ4      YKKKNGLTNLSSEAS-----LYLNNNNANRQ-----EIIQLTNQMEL-------------
A0A060RD97      YKQQSNVLDFSAAAN-----MYMQTSNEIRR-----DAAEVENQIAM-------------
A0A350IHV0      YKETHKITDIASISE-----AYLKESTDYSA-----KSFEVNNQLAI-------------
A0A077ENE7      LKIANQGIDVATAGS-----LYLNEKNQYKS-----EGTKIETDIRL-------------
T0NN57          LKIANKGVDVEAAGG-----MYLSESNQYKT-----EKTKIETDIRL-------------
X5K347          LKIANKGVDVEAAGG-----MYLSESNQYKT-----EKTKIETDIRL-------------
A0A1T5K9D4      YRSTKKLLDANADAA-----EYLSESRSYGS-----DISQVETNLSI-------------
R5RVP0          YKSSHKITDIRSLSA-----AYLEESTEYKA-----KSFDVNNQLAI-------------
A0A285T4L1      FKQSNQLMDIGSLAG-----QYMGEAQTYSA-----DALEQETQLKL-------------
A0A3E5BU42      FKQSNQLMDIGSLAG-----QYMGEAQTYSA-----DALEQETQLKL-------------
A0A414ZBF2      YKRENKLTDVTSESA-----LLLQNSSRLGG-----ESLSIENEVVM-------------
R5KD55          YKSKNLLPDVEKAYS-----LSMERADKNSA-----ILLDLNTKLSV-------------
A0A174QNT3      FKQEHRIVDINANAN-----IYLQEGSKAKE-----ESIQLEAQLNV-------------
R9I0H0          FKQEHRIVDINSNAN-----LYLQEGSKAKE-----ESIQLEAQLNV-------------
K5BUT9          FKQRNQIVDMSANAT-----QYLAESSKVKE-----ESAQLETELSI-------------
A0A174FPA3      FKQRNQIVDMSANAT-----QYLAESSKVKE-----ESAQLETELSI-------------
R6S9Y6          FKQRNQIVDMSANAT-----QYLAESSKIKE-----ESAQLETELSI-------------
C9KX15          FKQRNQIVDMSANAT-----QYLAESSKVKE-----ESAQLETELSI-------------
A0A3L8AAP1      FKQRNRIIGSEGNGS-----QFLAESSRMKT-----ENLQMETELSI-------------
R6DAG6          FKQRNRIIGSEGNGT-----QFLAESSRMKT-----ENLQMETELSI-------------
A0A1G8BVM8      YKKEKNLTDIPSVSS-----MYLDASSRINA-----EALGLENQLSI-------------
A0A416GGJ1      FKSSNQLMDVSSTAG-----MYMSESQKYGA-----DGMELETQLRL-------------
A0A3D1NQW3      FKKDNKIYDIVSEAE-----QTITESAQYKT-----DGLSLENQIRM-------------
B0MT10          FKKDNKIYDIVSEAE-----QTITESAQYKT-----DGLSLENQIRM-------------
R7JGW9          FKKDNKIYDIVSEAE-----QTITESAQYKT-----DGLSLENQIRM-------------
A0A0E2M2Y7      FKKSNNITDISTDVG-----AFLKSNADLQK-----DQLVVERNLSL-------------
A0A0K2J6Z0      FKKSNNITDISTDVG-----AFLKSNADLQK-----DQLVVERNLSL-------------
B2RKZ8          FKKSNNITDISTDVG-----AFLKSNADLQK-----DQLVVERNLSL-------------
A0A212GC82      FKKSNNITDISTDVG-----AFLKSNADLQK-----DQLVVERNLSL-------------
A0A254MU12      FKKSNNITDISTDVG-----AFLKSNADLQK-----DQLVVERNLSL-------------
R6CQ93          FKQSNQLMDIGSLAG-----RYMGEAQTYSA-----DAMEQETQLKL-------------
A0A3D2BF46      YKKDNEMYDITAQAT-----QSLTESSQFKT-----AGLSVENQISM-------------
A0A358R538      LKRSNRMIDLQSEAA-----RNVTESSRYKA-----EGLSLENQIAV-------------
A0A1Y4AAB8      FKRDNRMVDLASEAT-----RNVEESSQFKA-----EGLSLENQINV-------------
A0A1Y3WWY9      LKKDNQMVDIASEAT-----RSVTESSQYKA-----EGLSLDNQINV-------------
A0A1Y4U5L4      LKKDNQMVDIASEAT-----RSVTESSQYKA-----EGLSLDNQINV-------------
A0A1Y3VCJ1      LKKDNRMVDISSEAT-----RSLTESSQYKA-----EGLSLDNQINI-------------
A0A1Y3QTW7      IKKSNQMIDITSEAT-----RSITESSKFKV-----EGLSIENQISV-------------
R6XWY7          IKKSNQMIDITSEAT-----RSITESSKFKV-----EGLSIENQISV-------------
A0A174AVF1      IKKSNQMIDITSEAT-----RSITESSKFKV-----EGLSIENQISV-------------
A0A373HTL7      IKKSNQMIDITSEAT-----RSITESSKFKV-----EGLSIENQISV-------------
A0A1Q6EIY0      IKKSNKMIDITSEAT-----RTITESTRYKA-----ESLTIENQISV-------------
E4M8L3          IKKSNKMIDITSEAT-----RTITESTRYKA-----ESLTIENQISV-------------
I3YQ50          IKKSNKMIDITSEAT-----RTITESTRYKA-----ESLTIENQISV-------------
R5UEY8          IKKSNKMIDITSEAT-----RTITESTRYKA-----ESLTIENQISV-------------
A0A1H4D866      IKKDNQMVDITSEAA-----RSVSESSKYKA-----EGLSLENQINV-------------
A0A374A9J5      IKKDNRMVDITSEAA-----RSVSESSRYKT-----EGLSLENQINV-------------
A0A1Q6E9S3      IKKDNRMVDITSEAA-----RSVSESSRYKT-----EGLSLENQINV-------------
D4IJ36          IKKDNRMVDITSEAA-----RSVSESSRYKT-----EGLSLENQINV-------------
A0A414Q925      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A415PUS9      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A108TCU0      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A413BA42      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
S3Y344          YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A413MY74      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A412TGL3      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A413VJ33      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A414L0W6      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A412DP39      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A413ZSE8      YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
B0NP84          YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
R6AK43          YKKKNRLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A412N2D9      YKKKNKLTDIASESA-----LYLKSSSMLDT-----EGLSVENQLNM-------------
R6LHA4          YKKKNKLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A1Q6FL18      YKKKNKLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A1Y4JYS9      YKKKNKLTDIASESA-----LYLQSSSMLDT-----EGLSVENQLNM-------------
A0A3E5HPT8      LKRANNGVDINTVAG-----MYIQDSRQYES-----SIKELDTQLQL-------------
C6IJ48          LKRANNGVDINTVAG-----MYIQDSRQYES-----SIKELDTQLQL-------------
Q8A3U2          LKRANNGVDINTVAG-----MYIQDSRQYES-----SIKELDTQLQL-------------
A0A3R6S1H6      FKKENLLTDIVSETG-----IYLQNSNLYQQ-----EGLGLENQLSL-------------
A0A3R6SD81      FKKENLLTDIVSETG-----IYLQNSNLYQQ-----EGLGLENQLSL-------------
A0A413VXJ7      FKRENQLTDITSETG-----MYLANTSLYRQ-----EGLSLENQLSI-------------
I9RSN9          FKRENQLTDITSETG-----MYLANTSLYRQ-----EGLSLENQLSI-------------
U6RJK5          FKRENQLTDITSETG-----MYLANTSLYRQ-----EGLSLENQLSI-------------
A0A1Q6GA32      FKRENQLTDITSETG-----MYLANTSLYRQ-----EGLSLENQLSI-------------
I9RPU6          FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
I8Y597          FKRENQLTDITSETG-----MYLQNTSRYKQ-----EGLSLENQLSI-------------
I8YFS5          FKRENQLTDITSETG-----MYLANTSRYKQ-----EGLSLENQLSI-------------
A0A1Q6GBF5      FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
I8YFZ3          FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
A0A1Q6GDH2      FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
U6RSB0          FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
I9SIK1          FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
I9GXM2          FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
I9TP59          FKRENQLTDITSETG-----MYLANTSRYQQ-----EGLSLENQLSI-------------
A0A0J6CIR2      YKRENQLTDISSETG-----MYLQESSQYSK-----EGLGLENQVTL-------------
A0A3D8HG59      FKRENQLTDIVSETG-----MYLKESSEYSR-----EGLSLENQLTL-------------
A0A3R6S408      FKRENQLTDIVSETG-----MYLKESSEYSR-----EGLSLENQLTL-------------
A0A354WXN6      FKRENQLTDITSETG-----MYLQNTSQYNQ-----ESLSLQSQLQL-------------
R5IP14          FKKENELTDITSEAG-----MSLTMKSGYMS-----EGVSLENQISL-------------
A0A316SZX7      FKSTNKLTDISSEAQ-----SQLQQSSAFKK-----EGLSLENQINL-------------
A0A1Y4AIY1      FKREHQLTDITSETG-----MYLQNTSQYRK-----EGLSLENQLSV-------------
F3ZRU7          FKKTEKLTNITSDAE-----MFITETTGLKK-----EELEVLNQLSL-------------
A0A1C5Q1F3      YKSQHNLADISTQTG-----SFMERSNRYQQ-----EGVTLENQRTL-------------
R7A239          YKSQHNLADISTQTG-----SFMERSNRYQQ-----EGVTLENQRTL-------------
A0A1M6K7I9      YKRENQLTDITSETG-----MYLQTTTKYKQ-----EGLSLENQLSL-------------
A0A3R6HIK7      FKRENQLTDIKSETG-----MYLQNTSQYKQ-----EGLSLENQVAV-------------
K5ZVW7          FKRENQLTDIKSETG-----MYLQNTSQYKQ-----EGLSLENQVAV-------------
A0A1Y4D5Z0      FKRENQLTDISSETG-----MYLQNTSKYKQ-----EGLSLENQLAM-------------
R5S343          FKSEHRLTDAGLETG-----VFLQESSLYNQ-----TGLGLDNQLSL-------------
A0A3R5ZMK1      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A3E4ZTK7      YKREHQLTDISSETG-----MYLQTSSRNQQ-----EGLSLENQLSL-------------
A0A1Y3ZIA4      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
K5Y1A4          YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A3R6K8X4      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A1Q6I3T6      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A414XX40      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A412DM15      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A7AEU7          YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A415BDM7      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A3R5ZYK4      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A414GI87      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A3R6BKI7      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A414LPI6      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
A0A412M2W1      YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
K5ZX55          YKREHQLTDISSETG-----MYLQTSSQYRQ-----EGLSLENQLSL-------------
K5ZBN2          FKRENQLTDIHSEAG-----MYLQEGSQYSQ-----EGLGLENQLTL-------------
A0A0J6CKW3      FKRENQLTDIHSEAG-----MYLQEGSQYSQ-----EGLGLENQLTL-------------
A0A0F5IQM7      FKRENQLTDIHSEAG-----MYLQEGSQYSQ-----EGLGLENQLTL-------------
S0GLB0          FKRENQLTDIHSEAG-----MYLQEGSQYSQ-----EGLGLENQLTL-------------
A0A3R6NLC1      FKRENQLTDIHSEAG-----LYLQEGSQYSQ-----EGLGLENQLTL-------------
A0A416WYC9      FKRENQLTDIHSEAG-----LYLQEGSQYSQ-----EGLGLENQLTL-------------
A0A0F5IT40      YKRENQLTDISSETG-----MYLQESSQYSK-----EGLGLENQVTL-------------
S0GSI7          YKRENQLTDISSETG-----MYLQESSQYSK-----EGLGLENQVTL-------------
K5YB65          YKRENQLTDISSETG-----MYLQESSQYSK-----EGLGLENQVTL-------------
A0A0F5IWP9      YKRENQLTDISSETG-----MYLQESSQYSQ-----EGLGLENQLTL-------------
A0A0F5IZT8      YKRENQLTDISSETG-----MYLQESSQYSQ-----EGLGLENQLTL-------------
A0A417LKQ2      YKRENQLTDISSETG-----MYLQESSQYSK-----EGLGLENQRTL-------------
A0A416TME1      YKRENRLTDISSETG-----MYLQESSQYSK-----EGLGLENQRTL-------------
A0A416XPE8      YKRENRLTDISSETG-----MYLQESSQYSK-----EGLGLENQRTL-------------
L8JI02          FRAKSNIQDISYTAE-----NLSKNLDRLES-----EKADLQVKLKY-------------
A6EBM4          YKQQSKVMDISVTSE-----HTLDKVSDLES-----QQSILRIQLIA-------------
A0A2N3U785      YKRSNEVTNLDSDAR-----MYVEKAADYNR-----QISEWQVQIDV-------------
A0A0E3ZG78      YKRQHELTDVNIQAS-----NYLNIASGYNK-----QLSDWAIQIEI-------------
A0A1I6BRK6      YKSTNSLTDIAAQAT-----SYAEQATNYDS-----QIAEWATQSEV-------------
A0A243WAB1      YKSVNGLTDISTQAS-----DYTAQASDYNK-----QLSEWGIQIDV-------------
A0A399SH26      YKTSKGIVDLSEQGR-----TFLQNMSANDS-----KVEDINLQLAV-------------
A0A0E3ZGV6      YKSTQGAVNLNEQGK-----LFLQSVDNNDR-----RLNEINLQLAV-------------
A0A1I2N4S1      YRASNGAVNLNEQGK-----LYLQSVDFNDR-----RMNEINLQLAV-------------
A0A2T5YE44      YRSSNGAVNLNEQGK-----LYLQSVDFNDR-----RMNEINLQLAV-------------
A0A1M4YED3      YKSQKGIVDISEQGK-----EFLRTVSDNER-----QATSINMQVST-------------
A0A3P1Z8V4      FKQNNSIVDLTATAT-----AMTQQSIQARQ-----KTIELETELSV-----ASFLADHL
A0A2L2WX98      FLSDNKLTDFEQSAQ-----MYLTESSAARK-----QRLELETQVAV-----ARYLTQYL
G5GD56          FKQQNRVIDFQQAAG-----TVTAQSADARQ-----QALQLETQLSV-----ARYLQEFL
R6A0L2          FKKRNQLVDFDKTPQ-----AMIDESSTARQ-----QSLQAETQLNV-----AKYLDEYL
R7LG80          FKKRNSVLDFETTAQ-----SITQESSLARQ-----KTLEAETQLNV-----AQYLYNYL
A0A1M6XHU0      FARSRQVVRLGPQGE-----RLVAEVAQLEA-----QRDAARFQLEQ-----EKSALQFI
D0MHQ9          FARSRQVVRLGPQGE-----RLVAEVAQLEA-----QRDAARFQLEQ-----EKSALQFI
G2SF81          FARSRQVVRLGPQGE-----RLVAEVAQLEA-----QRDAARFQLEQ-----EKSALQFI
A0A2H3NSN0      FARRHDVAIDGQDGN-----RVATDYVEMMG-----QRDQLEFQLQE-----EQRTLDML
A0A2P6C324      FARSNAIVTEGLDGQ-----NVAAEYAELQS-----QRDALTFQLEQ-----EKRTLSIL
A0A126PFG0      YRSQQGLTDIASQSK-----VYLENAQANDS-----RLNEAQVQLAV---------VSTI
A0A3M1N7Z3      ---QDTLYRVETKED-----ILFMEARKDRALSLYQDLNKLDKSLSVEYLNAFSEKLRRV
R7PCR1          FKEKYNIVDFQKSAE-----AFLQQQGTARN-----LALDYETQLSV-----ARYLESYL
A0A2A8CVM9      FAQNNQVVTQGIGGE-----RLVAEYTELTA-----RRDALRFELEQ-----EEEALRLL
A0A3C0ZQC7      YMEQKGIVSLDDEAK-----KVIDQLATLEA-----QRDAADIELQA-----LSKTLTSY
A0A2E3R1D0      YMLREGAVALQEETS-----RLVDQIATLDA-----RRDQAQVNLVT-----KRAELAAL
A0A2T2USC0      FMREENAVALDQETQ-----QIVQQISEMQA-----RRDELQIELDM-----ESSALQSL
A0A2T2V0F3      FMQEEKAVALDQETS-----RIVDQIANLQT-----RQDELRIELDM-----KQSALTSK
A0A2T2S682      YMQKEEAVSLDQEAS-----RLVQQLSELEA-----RRDELRIELDM-----AESALNTK
D5H561          FQRSEDAVSLDQRQG-----SLTSRIAETES-----SLEQARIELRM-----EQSSLESL
A0A2H3NWA9      FMQREEAVALDEETS-----STVSRITSLES-----ERAQLRIELEM-----TRARFNAQ
A0A2A8CVB6      YMQREGAIALDQESG-----RIVSDIAQMEA-----EQRQLQIELQL-----ARTSLDEK
A0A2P6C1S6      YMQRENAVSLDQETG-----RVVQQISELEA-----QRAELRIELDM-----QQAALETQ
A0A2T2UTM4      YMQEEKAISLDQETG-----RVVQQISELES-----KRARLRIELDM-----KQATLETR
A0A1T5MMH4      FTLKNKTNDLQEDLR-----KTIESINKIDS-----QRYELSRRLDE-------------
A0A2W4R1L8      FILANKTSNLDEELA-----NTIRLIHEIDS-----QRYQLTTRITG-------------
A0A2E5CV79      FKIENSFFSSDGEAS-----SVARQISALEN-----DIYNTRSELNM-------------
A0A2A4G4B1      FKTQRVLTDLDMESG-----LYLRDNAQSRQ-----EINTLSTQLEL-------------
A0A2D4ZVH1      FMNRTLLIAVDPQTE-----EIISTIANLEV-----EKQKLEVGLVA-------------
A0A0E3V905      YKSHQGITDLSVQAQ-----TFLQTVQQNDA-----LMNQVQIQLAT-------------
A0A1M6GR99      FMSQNKLMNIDEQST------------RLAQ-----QRLDLQNQLAE-------------
A0A1M5BA90      FRNQKGVVDLSEQGK-----LYLQNVGDNDR-----KMTDINMQLAM-------------
A0A1V9F098      FRTDKGVVDLSAQGR-----QYLENVGSNDR-----KMADLSMQLAS-------------
A0A1V9FHD0      FRTNQGVVDLTEQGK-----QYLENVGTNDR-----KIADLSMELAA-------------
A0A1T5CS78      YKSNEGVVDLSEQGR-----LYLQDVGENDK-----QISELELQLAV-------------
A0A0Q9Z8F1      YKSNQGVVDLSEQGR-----LYLQDVGENDK-----QISELELQLAV-------------
A0A2N0U0M7      YKSNQGVVDLSEQGR-----LYLQDIGENDK-----QISELELQLAV-------------
A0A1M6TTV4      FTIQNRTTDLSRDLN-----NTIQLLNQLDS-----QRFKIRNQITA-------------
A0A1Q6IT42      YKRENDLSDIDAEAK-----IILEANSQYRK-----LLLEAETQYSI-------------
K0X1U5          YKRENDLSDIDAEAK-----IILEANSQYRK-----LLLEAETQYSI-------------
A0A416XAH0      YKRENDLSDIDAEAK-----IILEANSQYRK-----LLLEAETQYSI-------------
R5EXK3          YKRENDLSDIDAEAK-----IILEANSQYRK-----LLLEAETQYSI-------------
A0A401UAP7      FTLKNKTQDLTADMS-----RTVEQINALDT-----SSFTINSRLRL-------------
A0A1W2GF52      FTIKNRTTDLSSDLT-----KTIALLNELDS-----QRYNLREHLAE-------------
A0A2G5L7B8      FTIKNRTTDLSQDLN-----YTIRLLNQLDS-----QRFNIRTQIAA-------------
A0A0D3LFR6      FTISQRTTNLNKDIS-----NTILLLESVDS-----QRVATRRQLNN-------------
M7N6D4          FTIDYKTTNLAGDIN-----RTIIMMEAIDS-----QRVQLRKQLSS-------------
A0A364XUP5      FTLQNKTNNLDEDLK-----RTVTAISRLDS-----QRYEFASRMQE-------------
A0A1M5RLA9      FTLQNKTNNLDEDLK-----KTVSAINRLDS-----QRYELTNRIVE-------------
A0A385SFR9      FTLQNKTNNLDEDLK-----KTVSAINRLDS-----QRYELTNKIVE-------------
L8JW09          FTIKNRTSDLNEDLK-----RTIETINALDS-----QRFQLTKRIQA-------------
A0A1Q3ZMZ7      FQQKNKLNNPDNVAD-----QLIQKIDEANE-----ESYLANNNLST-------------
A0A2D8JJW3      FQQAEDILSSDGNAN-----EHVEQFLKLKS-----ERVAQQLK----------------
A0A2W2AFF7      FKKENELTDIGEESK-----ILLGSTSDYMK-----QLTQSEVQLSI-------------
A0A2N5YXE2      FKQQNNIRSNTETLLFNKTNLYTTKMSELES-----KLLNVDFEIMT-------------
A0A2I0QZ80      FQRNENITNPEHLSG-----SISSKIEFLRT-----EERNIIEEIRV-------------
A0A2U2XBJ3      YQRMENITNPEQIAA-----NTSQKIEKLRT-----EIRQGMEELRV-------------
A0A3E1F1A3      YQRRENITNPEYLTS-----SVASKMEKLKA-----EENNALEEMRV-------------
A0A1V9F383      FRTDKGVVDLGEQSK-----MYLENVGDNDR-----KIADLSMQKAA-------------
G8TRZ6          FRTDKGVVDLGEQGK-----MYLDNVGDNDR-----KIADLSMQIAA-------------
A0A2W1NDY9      FTNISKNNNPALYKE-----NLLDQIDQLRT-----EVLQADLEYDL-------------
A0A1G0CI31      FQRSAQLNDPETDGL-----SLTQNMDQFQD-----QLFMLEEERSA-------------
F2IKD6          FQRKSHLTDPEGTGG-----SLSENMDKFQD-----ILFDLENELTT-------------
A0A1I7BM74      FQRRENLSDLENIES-----NLSAKVNTLEN-----ELEKLKIEHQD-------------
A0A2G2FJ17      FQRKENLPDPENLGE-----SIATKLEKYRF-----DKFELQDELNT-------------
A0A416X8R7      FKQKNRIVSIDAAAT-----QFMSESSKMRD-----ELVQLETEYAI-------------
K0XJ09          FKQKNRIVSIDAAAT-----QFMSESSKMRD-----ELVQLETEYAI-------------
R5EUZ0          FKQKNRIVSIDAAAT-----QFMSESSKMRD-----ELVQLETEYAI-------------
W0EQS0          FKQKNRIVSIDAAAS-----QFMSENSQMRS-----ELVQLEMEYAI-------------
A0A1Y3WE15      FKQQNRIVSIDAAAS-----QFMSENSKMRD-----ELVQLETEYAI-------------
A0A1Y4GUK3      FKQKNRIVSIDASAN-----QFMSENSQMRT-----ELVQLETEYAI-------------
A0A2U1FKU2      FKKQNNITDITTDVG-----TYLKNSSDLQK-----DQLIVERNLSL-------------
A0A0A2F954      FKKRNNITDISTDVG-----AYLKSSADLQK-----DQLIVERNLSL-------------
A0A0A2FW91      FKKSNNITDISTDVG-----AFLKSNADLQK-----DQLVVERNLSL-------------
A0A2D2N2N1      FKKRNNITDISTDVG-----TYLKSSADLQK-----DQLIVERNLSL-------------
Q7MWZ2          FKKRNNITDISTDVG-----TYLKSSADLQK-----DQLIVERNLSL-------------
T2NDT6          FKKRNNITDISTDVG-----TYLKSSADLQK-----DQLIVERNLSL-------------
W1R7P9          FKKRNNITDISTDVG-----TYLKSSADLQK-----DQLIVERNLSL-------------
A0A1R4AFZ0      FKKRNNITDISTDVG-----TYLKSSADLQK-----DQLIVERNLSL-------------
A0A1R4DVZ7      FKKRNNITDISTDVG-----TYLKSSADLQK-----DQLIVERNLSL-------------
A0A1G9E2A9      FVRENRTLSISSTIG-----QTLEQIKNLRF-----ERITYEQQLPA-------------
A0A2T2YJE8      FVKENKTYDVRADVS-----KSITKLEELNK-----ERINLHLQISL-------------
A0A3M9N829      FVRQNKSYDIRSSFQ-----EAITEYRELEQ-----KKLEQRFLLTL-------------
A0A0P0CSF9      FVRQNMSYDLKANFQ-----EALAQVQELEK-----EKLELRFQLSL-------------
A0A3M9MNC3      FVRQNKSYDIKSNLQ-----EALAQVQELEK-----EKLELRFQLSL-------------
A0A2M6GH67      FAIQNKTYDVRGEIA-----KSMARLEELYK-----ERSDLGLQINL-------------
A0A127B287      FVKQNKSYDVKAGLE-----GAMTQIQELEK-----EKYDLRFRNSL-------------
A0A369QP10      FVKQNKTYDVRADVN-----KQMTKLEDLNK-----QRVDLRMELSL-------------
A0A418R9X5      FVRKNKVFDVKSEAG-----LVTNQLNMLES-----QQEELQEQADM-------------
A0A428JSJ3      FVKRNRVFDVKSEAS-----LINNQLTTQEA-----EQEKLQEEADM-------------
A0A428KI59      FVKRSRVFDVKSEAN-----LVTNQLTAQEL-----EQEQLQEQADM-------------
W8F1I6          FVRRSRVFDVKSEAS-----LVTNQLTAQEL-----EQEQLQEQADM-------------
A0A246FQC0      FVKRTGSYDVKGDVG-----QITGLLMELEE-----ERTKLQQQADM-------------
A0A372E5P8      FVKRTGSYDVKGEVS-----QLTGLLQTLEE-----ERAKLQEQSEM-------------
A0A1H3EMW1      FVKRTGSYDVKGEVG-----TITGLLQELEV-----ERAKLQEQGEM-------------
A0A1H9ZSN3      FVKRTGSYDVKGEVG-----QITGLMQELEE-----ERAKLQEQGEM-------------
A0A0M3RW20      FVKANKTYDVKADVG-----TLTEKLAEQEK-----ERIELQKRLDL-------------
A0A1S9B3W0      FVKQNKTYDAKSDLG-----AITQELSELQK-----EREKLLRKATV-------------
A0A1W1VRL3      FARENRTYDVRADAA-----TVNGKILAQEE-----KRQNLLQKQGL-------------
A0A1M6R305      FARQNKTYDVKATIG-----DLTGRLEKQEE-----ERLRLVEKIRL-------------
A0A2M9B9H9      FVRQNKTYDVKTEVA-----GITEKLAEQEE-----VRLKLVEKARL-------------
A0A126PDF2      FVEKTKTYDVKSEVA-----ALASRGEDLEE-----QRLKLNQNLVL-------------
A0A2Z3GKA1      FVEKTKTYDVRSEVA-----ALAAKGESLEE-----QRLKLNQNLVL-------------
A0A328BL48      AVKRNRTYDAKGDLA-----TITTQMQELAK-----QREQILRRQGV-------------
A0A3S0QKV1      FVRQSKTYDAKADVG-----TLTTQLSDLRK-----ERETLQRKASL-------------
A0A3R9P8H7      FVKRNGTYDVKGDVG-----QIMTALKEQET-----EREKLQEQVDM-------------
A0A212UCJ7      FMKQNRLFDAETELG-----SLTTILTTQQE-----ERQKLQEQLTL-------------
A0A238WIA7      FMKRNNLFDAESELG-----TVTSAITTQQE-----ERQELQEQINL-------------
A0A0W8EDI5      FVKRNKTYDVKSDLA-----TITEKMEALEE-----EKEQLLRKAGA-------------
A0A3B7RBP8      FVRRNKTYDVKSDVA-----NIAEKMAALQE-----ERVELQRKAGA-------------
A0A1I5WSL8      FVQKTGTYDTRAELE-----AISGKMEKLEA-----ERLKLTDKMIL-------------
A0A0U3JVM7      FVQQTGTYDSKGEFS-----AITEKLEKLEA-----DRLKLTDKINM-------------
A0A1G1SSV2      FVQKTGTYDSKGEFE-----AISGKLEKFET-----ERLKLTDNIAM-------------
A0A1G1SXV7      FVQKTGTYDSKGEFE-----AISAKLEKFET-----ERLKLTDNIAL-------------
A0A243WHR7      FTDRTKTYDVRGDLA-----SISDKLLEQEK-----ERLQLQQQIDL-------------
A0A076HRT9      FARQNKTYDVRASIG-----EITARLEKQEE-----ERLKLSEKIRL-------------
A0A1M6DHW8      FVRDNKTYDVKADVA-----AITEKLAAQAE-----EQQKLAEKARL-------------
A0A3D1KEX9      FKQNNKIVDFTENAR-----TYLQQSALSQQ-----ELNKTQAELSV-------------
A0A358Y7S2      FQKRERLPNIEKIGD-----NLSENLTNYSK-----VILELEEELST-------------
A0A1X7J248      FTIENKTINPSDDVS-----RLIAEMVKMDS-----ILYGINYQLGE-------------
E4TQD2          FTIKNKTVNPSQDVS-----RLISEMVSMDS-----ILYGINYQLAE-------------
A0A2J6HHN3      VSVASPDSLEDKTGL-------KSRMRELDR-----LISKTKYEKEV-------------
A0A1Y3WMT8      YKRENDLSDIDTEAK-----IILEANSEYRK-----LLLEAETQYSI-------------
A0A1Y4GQU1      YKRENDLSDINSEAK-----IILEANSQYRK-----LLLEAETQYSI-------------
A0A1V5W8T5      FKKSNNITGSIFDDK----AAIQNALMDNSQ-----QIKQYDTQLQS-------------
A0A2T8HKA9      IKMDNKGMDVNEAAG-----MYITESREYLN-----ASRELETQLSL-------------
A0A3B8INU3      FTISNQTTDLSSDLQ-----KTIQQIWTLDT-----LLGTARSKQKS-------------
A0A098LL25      FVRNNRTVDVKQDFG-----KSGIKIEELEK-----EKQVLKSRISM-------------
A0A1Q3Q573      FKINNEIFSDDNSSQ-----GILTSANALQQ-----ALIASENQLYL-------------
A0A357YNR3      YKQSQGITDIAAQAN-----LYNNQMANVGQ-----RRMDIESQLSI-------------
F4KK08          FKQSQQIADIQAEAQ-----EYIKGSSEVKT-----RLVELNNSISI-------------
A0A3N2N6F7      FKGEHLVPDVAAASE-----MYMANANENTK-----QQLGVMTQMEI-------------
A0A419VXB7      YRSSNKVFDLSQEAT-----LVTGKLSNLDT-----KRSMAEMQLEY-------------
A0A2V1ILM4      FKGEHLVPDVAAASA-----MYMEDANENTK-----QQMQVSTQIAI-------------
A0A3N2L0E8      FKGEHLVPDVAAASA-----MYMEDANENTK-----QQMQVSTQIAI-------------
A0A3N2LFC5      FKGEHLVPDVAAASA-----MYMEDANENTK-----QQMQVSTQIAI-------------
C3J7R8          FKQNNRIADIQQEAR-----SYITGTAEFAR-----QMTEVNNKLAV-------------
A0A0B0BTJ4      FKSDNSAVDIISETK-----LSLETSRQYED-----DLLKTEIQLEM-------------
A0A3B9CNN6      FKSDNSAVDIISETK-----LSLETSRQYED-----DLLKTEIQLEM-------------
R5X290          FKSDNSAVDIISETK-----LSLETSRQYED-----DLLKTEIQLEM-------------
A0A1Q6E6I7      FKSDNSAVDIISETK-----LSLETSRQYED-----DLLKTEIQLEM-------------
A0A2G2F510      FQRKSNLPNPEEAAS-----NITDNISKLQD-----QLFLIEDELNS-------------
A0A316JZ08      FHSKSSVVDPELSGG-----ELNEKLNDLEL-----QLSDIDKEVAS-------------
A0A1I1FXP9      FIQVNRVIDVRDQVA-----EMITHVEKLKK-----DKIELEIQNSL-------------
A0A3B9FXJ0      FKKDAQLINPSIAEQ-----NLMTKFNELDQ-----NKLDVQLEERS-------------
R5GSU5          FKERNQIVDFEKSAQ-----SALEEQRTLRL-----SMLQAEVQLSV-------------
A0A2P8EAX2      FKQRNRVTDIGLDSR-----IYLESTASTSK-----EISELSNKIEI-------------
A0A3N4H5N3      YKQRNRITDIGLDSR-----IFLESTQEMRK-----EISDISSKIEI-------------
A0A2A3UE91      FKKDKNISEKDKIIT-----TELMRYSTIED-----QMLQAQMEETL-------------
A0A0A2G557      FKQNNQIANIASEAE-----VYIESSKEITK-----QTIEVNNALAV-------------
A0A2N2WFW8      GKNMSFDSTLDRSSL-------QARLFELDN-----LLAANISELES-------------
A0A1F3IU95      SSAPSVDSSLDRTAL-------QSRLFELDN-----LISENSSEVES-------------
A0A3D0VUF6      SSAPSVDSSLDRTAL-------QSRLFELDN-----LISENSSEVES-------------
A0A1T4PT95      FKQNNQIANIESEAE-----IYIESSKEITK-----QTIEINNSLAI-------------
A0A3Q9FR88      ISYGKDLSSYMEAGP------IVGNIQELEK-----SLSSLKNEKKK-------------
A0A150ADJ9      ISYNKDLSSYMDAGP------IVNNIQELEK-----SLNELKGERKK-------------
A0A1B1FWQ4      MSFNKDLSSYMEAGP------IVGNIQELEK-----SLNSLKSEKKK-------------
A0A1S1Z228      LSFNKDLSSYMEAGP------IVGNIQELEK-----SLNQLKSEKKK-------------
A0A1F3SJM1      FQRSANLPDPESISG-----TITENISKLND-----ELYRLEEEQLS-------------
A0A2G2EB96      YQRKSQLSDPENAGI-----SISDNVNKMQD-----QLFELEEEYNG-------------
A0A2G6PRA9      YQRRSQLSDPENVGV-----SINENANKLQD-----QLFELEEEYNG-------------
A1ZKR2          FMLKFKTNDVNKKLE-----ESVKEIEKLIK-----EKIVFNEQLAA-------------
A0A1Q3GX01      FKLKLKTNDVNEKLE-----KSVQEIEELLK-----QKLALSDELAG-------------
A0A349DQI4      FKLKLKTNNINEKLD-----KSVQEIEQLIK-----KKLKFTDELAG-------------
A0A2N3IIZ0      FIIQNKTNNIEGKIS-----ELVNKIQQLTE-----ERYKINAKLQT-------------
A0A2A4PYG9      FKRENKLSQQGDFIT-----VYVXKLDNIEN-----ELMDLELETSM-------------
A0A2A5FYT6      FQKDNRITGNDGFTG-----IYLERLNLLEN-----EVINLELEESV-------------
A0A2E6SYP1      YKELGSSETKDDFDY---NQLTRDLKGKDEN-----EKIELQASLSD-------------
A0A2E5RLE8      YKEIQENNSEYGTDY---GKLALDLAAKDQI-----EKTKTESTLND-------------
A0A2E7TQF6      YKEIQENNSEYGTDY---GKLALDLAAKDQI-----EKTKTESTLND-------------
A0A2E6GVY9      YKDLQKDNQEIKTDY---GKLALDLASKDQI-----EKTKLETTLID-------------
A0A350JJ90      FSQRTKLTKKKGIAA-----TYITRVNVLEQ-----KKVELELKISL-------------
A0A3M1CDV2      FKKQNNIVSTDNNSA--LSTSQSQIYSSVQE-----QLLQIELNEKL-------------
A0A2E2TFD1      FKLSNKVTGSSELTG-----IYLDRLGNLEE-----ELIKQELEQEI-------------
A0A2E4ELE6      FKIDNKVSKTENFTE-----MYIDRLALLEE-----ELIKLELEKDI-------------
A0A2E3XZI5      FKKLNDFENKTTLIE-----NQTKRIEEIEK-----ELTVINSNINL-------------
A0A2M7NLQ9      YKQENGITSQKPEEYQALVQNILNDIRELQE-----KRVEMDNELKL-------------
I4AFR0          YKLENGITSQNPQEYQSLVQNILNDIRDLQA-----KRLDIDNELKL-------------
A0A2N2Y3E5      FRKQNNIKTDDEKDL-ATYRSVIERITRVES-----DLEGIKVEVDT-------------
A0A2D9D7T6      FQKKSKLSNPDNTTV-----ELSSRINSFKT-----RQLENEEELVT-------------
A0A1F3PPL5      FKKENKISPNSDLNL-SAFPIYTSKIHEFDE-----EIMNIEFELVT-------------
A0A357QK06      FKKENKISPNSDLNL-SAFPIYTSKIHEFDE-----EIMNIEFELVT-------------
A0A2A5B3B0      FQEGTNFSTLDR-SS-----IYFDRSSKLEN-----DLFNIDLQKKI-------------
A0A0F2NS19      FQTSKKIGNPNEVSS-----IYLDKINRFEN-----QLIDIDFQTSV-------------
A0A2A5H8X6      FQTSKKIGNPNEVSS-----IYLDKINRFEN-----QLIDIDFQTSV-------------
A0A2H0GAU8      FQSNNKIGNPQEFSS-----IYLDRLNRFEN-----QLIDIDFQRNV-------------
A0A2M8FTK1      FQSNNKIGNPQEFSS-----IYLDRLNRFEN-----QLIDIDFQRNV-------------
A0A0S2HYK8      FKKENNIPSEALERT--PFPIFTAKIEEFEE-----QITTLDFELIT-------------
A0A2N5ZWN6      FKKDNNIPSDAFERS--PFPIFTSKIEEFSE-----QITQLDFEIFT-------------
A0A2E0FJ09      FKDTNKIRQVEGMTD-----SYLSRIEEMES-----ELVKLDVDEEI-------------
A0A1F3FZ62      FKRMNKIPDRLTDMK--SPPTYFSRVNDLQS-----QLLNIEVEEKM-------------
A0A1F3K211      FKRMNKIPDRLTDMK--SPPTYFSRVNDLQS-----QLLNIEVEEKM-------------
A0A1F3KLL5      FKKSNIDSALQNKLS--PLPLFTAKINELQS-----EILKTDFELAT-------------
A0A359D1M1      FKKSNIDSALQNKLS--PLPLFTAKINELQS-----EILKTDFELAT-------------
A0A2E7CT70      FKKAN---NVNSSLM--ANKTQLSKISEVEN-----KLVQNQVDITL-------------
A0A2D5V560      FKKNN---KXNXXLL--NISGIKENXEKIEI-----EIAKXQIDIDL-------------
A0A2D7K5A8      FKKNN---KFKNELI--GITGLKDKAEKIEK-----EIVKIQLDIDL-------------
A0A2E1XQ82      FKKNN---KFKNELI--NINGFQDKAEEIEK-----EIVKIQLDIDL-------------
A0A1V6I2U9      FREQNNILNIKDEYLFNKSNIYSSQISDIES-----KILNVDFEIMT-------------
A0A1F3C1M2      FKQLNNIELTNQDNV-KPISIYLTKFTEIET-----EILNIEFEYST-------------
A0A1F3DS87      FKQVNKIELTNQDNV-KPISIYLTKFTEIET-----EVLNIEFEYST-------------
A0A2H0B957      FSITHQIQGDKESST-SNVNRYANLLTKIEE-----DIDITDIEISS-------------
A0A1F3CFW6      FGITHQIRNDNDSKE-TGTERYSILLSKIEE-----ELDNVEIDISN-------------
A0A2M7E2T8      FGITHQIRNDKDSKE-TGPERYSILLSKIEE-----ELDNVEIDISN-------------
A0A2M7NC69      FGITHQIRNDKDSKE-TGPERYSILLSKIEE-----ELDNVEIDISN-------------
A0A1F3K695      FKKENNINISESELNTLSLNLYASKIEEIET-----EILNLDFELIT-------------
A0A353KZR1      FKKENNINISESELNTLSLNLYASKIEEIET-----EILNLDFELIT-------------
A0A2N2WYB5      FKKENKLNLDKYPINGSPFPIFTAKISEFED-----ELINIEFELVT-------------
A0A1F3K4G0      FKRENKINTDQFKAEGSPFPLFTTKISELED-----ELINIDFELVA-------------
A0A356H8Y3      FKRENKINTDQFKAEGSPFPLFTTKISELED-----ELINIDFELVA-------------
A0A351HSA6      FKRENKINTDQFKAEGSPFPLFTTKISELED-----ELINIDFELVA-------------
A0A1F3Q014      FTKNNNVTNT--DIENT---AKTTRLNALDD-----QIISLELEENV-------------
A0A2A4YXP3      FHQGTNYTSM--DRSSS---YF-DRSNRLEN-----ELIDVDLQQSV-------------
A0A2D5KD44      FKRENGITEI--DQFSK---VYIERMNQIDQ-----AQVELEIEIAT-------------
A0A1F3R158      FQKTNKLTDI--DKFSS---LYVDRVNKLEN-----QLVDIDLQKNV-------------
A0A2M8ADX2      FQKTNKLSDI--DKFSS---LYIERVNKLEN-----QLVDIDLQKSV-------------
A0A1J5B2H0      FKKTNKIDTIKLDVVPT---LF-SRQNELEN-----QFSKLELEENM-------------
A0A1V5N756      FKKENKIDLI-FQPLPE---VY-SIIKEFNS-----EILKLEIEIAK-------------
                                                                            

A0A1I3J6V0      ------------------------------------------------------------
A0A1H4ADG3      ---TNS------LIEYMHSQNGNDRVV--PASLTI--NDGSLSAIIDNYN----------
A0A3D5KRY6      ---FNN------LKYYLENRDQNK-DLVFPSIEQL--TDPALIETVKKLN----------
A0A1V5IPN7      ---KAK------TLDVLRKQLQDQDSLLVKVENVL--QAPYIGELRRQIT----------
A0A1V3WH52      ------------------------------------------------------------
A0A2K8Z965      ---LND------LQKYVETKSENR-GNTPPAVVGL--NDPVLLGLITNLT----------
A0A418M8U8      ---LSD------LQRYINNRSLDR-GAT-PALVGL--NDPVLFSLIEKLT----------
I2GTA4          ---LSD------LQRYINNRSLDR-SAT-PALVGL--NDPVLFSLIEKLT----------
A0A2K8ZAJ2      ---LAD------VERYVQSHSGRK-GVA-PATLGL--SEPILTSLLTKAA----------
A0A368JPA3      ---LGD------VEKYVRSKGENR-GVL-PTTLKF--SDPTLTALIGKLT----------
A0A3P1BT12      ---LGD------VEKYIRAKGENR-GML-PATLKF--NDPALTSLISKLN----------
A0A3P1CI15      ---LGD------VEKYIRSKKDNR-AAL-PATLKF--NDPTLTSLLGKLT----------
A0A1Q3PII2      ---VEL------LAAHLRA-KPTM-AI--PSALYP--REDNFADLVTKYN----------
A0A351BXT2      ---KQE------EYNSLKSEIERM-DP--TLVNFL--QGKVDELYLTEIQ----------
A0A3D0MYJ7      ---VEI------QINNLRRKISEI-SP--EVDLYV--NSQANQSKFTTIS----------
A0A3D3LS70      ---SRR------TYDALKSELEKL-DP--QLITYV--ESQISQSYVEEIQ----------
A0A1G7ZF38      ---VGL------LEAHLRE-KSAT-AI--PSALYP--QESNFAAMVSKYN----------
C6VS52          ---VQL------LEDHLRK-SPST-AI--PSLLYP--QESNFSALASTFN----------
A0A1G1TM36      ---VES------IERYLRNPQPAA-TV--PTTLGI--TDEALNNLVGRLT----------
A0A1V3WH27      -----------------------------------------VVNVENQLN----------
A0A0D3L8Q3      ---LNS----I-EDYL---RREGNEVGIVPSTLSI--TDHTLNRLIERYN----------
A0A0K8QSK7      ---YRY----L-RNYII--QNQELESIMAPSAMGV--EDPMMTSLTQELN----------
A0A1V6CN82      ---YNY----L-KTYIL--ENRDVGSILVPSSVGI--NDPLLSGLLSQYN----------
A0A1M4XZ45      ---YHY----L-RDYISTSSSQEMETVIAPSAMGI--QDPLLNSLILQLN----------
A0A399D319      ---YHY----L-RDYIHSDTNKE-ETIIAPSAMGI--QDPLLNSLILRLN----------
A0A0P7X1V8      ---ANS----A-LEAY-----QQELDRLTPGLSEQ--LTASIAPRINQLQVFLADRETQR
A0A3B0C2S4      ---AAL----L-KNAV---LGQSAYG-LLPVDVGL--ENSGINSLVAEYN----------
A0A416GA42      ---TRY----L-KEFL---LQPKNDKSLIPVNIGV--SETNLVNQIAEYN----------
A0A3N2M1H3      ---TTY----M-KDFL---DDSANKFNIIPANTGL--DNPSIEKDIATYN----------
A0A1T3IYP5      ---AEM----M-RSYL---SAKGKQNNLIPNNTGL--VDASVENQIAEYN----------
A0A212K7W5      ---AKY----I-LSHL---KDSRTKDMLLPANLGI--EGTNIDRQINEYN----------
F5IU11          ---AKY----I-LSHL---KNPRTKDILLPANLGI--EGANIEGQINEYN----------
A0A352Z1R7      ---VEF----A-LDAL---NSTLRKGNIYSPAIMR--DDPLVAGLATKLS----------
A0A0A2F501      ---ARY----I-RQHL---GTDTNATQLIPAISGI--GNKLIDQQIGEYN----------
R5B7P0          ---ARY----I-KDYI---GKEDNRNQPLPANMGL--SSQTIENGISEYN----------
R5B0L5          ---TRY----L-RNYL---GSESSRNQPLPVNVGS--GSPAIESQIAQYN----------
A0A374THP7      ---AQY----I-RNYL---TGKVGKNQLLPSNTGI--ESPGIEQQIAEYN----------
A0A3R5XWG1      ---AQY----I-RSSL---VGRVSKNQVLPSNTGI--DSPGIEQQIAEYN----------
A0A414YFM3      ---AQY----I-RSSL---VGRVSKNQVLPSNTGI--DSPGIEQQIAEYN----------
A0A0A2EVS5      ---ARY----I-RGHI----TGGQGRELLPVNSGI--NSPVIEREISEYN----------
A0A1T4NAJ7      ---ARY----I-RGHI----TGGQGRELLPVNSGI--NSPVIEREISEYN----------
A0A2V1IJY1      ---TLY----I-KSYL---GAASDNEKMLPMNSGV--ANVDIQSQITDYN----------
A0A3N2KCL3      ---TLY----I-KSYL---GAASDNEKMLPMNSGV--ANVDIQSQITDYN----------
A0A255T941      ---AQY----I-RHEL----TSKSIDQTLPTNSGI--ANANIETQINNYN----------
A0A1Y4CHN5      ---AKY----I-KSYL---AAGESQNQLLPANSGI--SGGNIENQISEYN----------
A0A1Y3V692      ---AQY----I-RREL----NNKELSQLLPTNSGI--ANVNIESQIGEYN----------
A0A174TYU6      ---AQY----I-RREL----NNKELSQLLPTNSGI--ANVNIESQIGEYN----------
A0A1M6I2S6      ---AQY----I-RREL----NNKELSQLLPTNSGI--ANVNIESQIGEYN----------
F3PXM2          ---ARY----I-RGEL----NGKGLTQLLPANSDI--GNSHIESLIGEYN----------
A0A3E4ZNL4      ---AQY----I-RREL----NSKDMNQPLPTNSGI--SSVNIESQIGEYN----------
A0A174AHH7      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A174JCE8      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A3E4JMC4      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A412SND6      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A414IEQ9      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A415UKN5      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A0M1W8D8      ---AQY----I-RREL----NSKDMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A3R6GKX5      ---AQY----I-RREL----NSKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A7V4S1          ---AQY----I-RREL----NSKEMNQPLPTNSGI--ANVNIESQIGEYN----------
B0NU19          ---AQY----I-RREL----NSKEMNQPLPTNSGI--ANVNIESQIGEYN----------
D4V601          ---AQY----I-RREL----NSKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A397WLT5      ---AQY----I-RREL----NSKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A3R6GM96      ---AQY----I-RREL----NSKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A015XH67      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A078RZN2      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A6L0K5          ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A7ACT5          ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A6KY94          ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A173UQR8      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A3R6HK75      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A412B7D1      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A412VNY9      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A414LTU9      ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
I9Q4U4          ---AQF----I-RREL----GGKEMNQPLPTNSGI--ANVNIESQIGEYN----------
A0A373ISF0      ---ARY----I-LKEL----KEKSLSQPLPTNSGI--ANSNIESQISEYN----------
U6RF62          ---ARY----I-LKEL----KEKSLSQPLPTNSGI--ANSNIENQISEYN----------
A0A073I794      ---VQY----I-RKEL----NNKEFTQPLPTNSGI--ANVNIESQISEYN----------
A0A108TH71      ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
I8VXH0          ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
A0A412S0N6      ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
A0A412IIJ0      ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
A0A0P0FM97      ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
R6KTP3          ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
A0A139LU87      ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
A0A1C6B3Y5      ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
E2NMQ4          ---AQY----I-RREL----NTKQLDQTLPANSGI--VSANIETQISEYN----------
A0A412YDB9      ---AQY----I-RREL----NTKQLNQTLPTNSGI--VSANIETQISEYN----------
R7DY01          ---AQY----I-RREL----NTKQLNQTLPTNSGI--VSANIETQISEYN----------
A0A414LGK8      ---AQY----I-RREL----NTKQLNQTLPTNSGI--VSANIETQISEYN----------
A0A016E4F9      ---ARY----I-RKEL----NNKELDQLLPTNSGI--ANVNIESQIGEYN----------
A0A413PP50      ---AQY----I-RKEL----NNKELSQLLPTNSGI--ANVNIESQIGEYN----------
A0A3A5TI83      ---AQY----I-RKEL----NNKKLSQLLPTNSGI--ANVNIESQIGEYN----------
A0A415NEB6      ---AQY----I-RKEL----NNKKLSQLLPTNSGI--ANVNIESQIGEYN----------
A7AJ60          ---AQY----I-RKEL----NNKKLSQLLPTNSGI--ANVNIESQIGEYN----------
A0A015UXN7      ---AQY----I-RKEL----NNKKLSQLLPTNSGI--ANVNIESQIGEYN----------
A0A395YYT3      ---AQY----I-RKEL----NNKKLSQLLPTNSGI--ANVNIESQIGEYN----------
A0A415IPQ4      ---AQY----I-RREL----NAKQPDQPLPTNSGI--VNANIETLISEYN----------
A0A3E5BRW7      ---AQY----I-RREL----NAKLLDQPLPANSGI--VNANIETLIGEYN----------
K9DXS6          ---AQY----I-RREL----NAKLLDQPLPANSGI--VNANIETLIGEYN----------
A0A1M6KFV3      ---AQY----I-RREL----NSKQLNQPLPANSGI--VNANIETLISEYN----------
A0A1Q6G7L3      ---AQY----I-RREL----NSKQLNQPLPANSGI--VNANIETLISEYN----------
A0A413H235      ---AQY----I-RREL----NSKQLNQPLPANSGI--VNANIETLISEYN----------
A0A1M5B2J8      ---ARY----I-RNYL---TSETNRFQLLPANSGI--DNPNIASQINEYN----------
A0A255RCT5      ---ARY----I-RNYL---TSETNRFQLLPANSGI--DNANIGSQITEYN----------
A0A1Y4GLF5      ---ARY----I-RNYL---ANDANKSQLLPANSGI--DNGNIESQISEYN----------
A0A1H3XSC0      ---TRY----I-RNYL---TNDANKNQLLPANSGI--ESANIESQIAEYN----------
B3JI46          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A174UR09      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESTNIESQIAEYN----------
A6LE40          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
R6NN15          ---ARY----I-RNYL---TAASSRNQLLPANSGL--ESANIENQISEYN----------
A0A358R8U0      ---TRY----V-RNYL---SDENNRTQLLPANSGI--ESTNIESQISEYN----------
R6WSB6          ---TRY----V-RNYL---SDENNRTQLLPANSGI--ESTNIESQISEYN----------
A0A401LPX7      ---ARY----I-KNYL---TDENNKYQLLPANSGI--ENASLSTQLNEYN----------
A0A3A5Z900      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENANLATQLNEYN----------
A0A3R6I893      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A3R6EGW5      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A285TGL6      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A3A5RFX4      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A1Q6IUW9      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A3R6NPG7      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A413XDP6      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
K6AP24          ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A076IQN8      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A078RYI7      ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
C7XEQ8          ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
D7INX6          ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
K5ZG55          ---ARY----I-KNYL---TNENNKHQLLPANSGI--ENASLATQLNEYN----------
A0A3N2N9B8      ---TRF----V-RNYL---TAESSRNQLLPANSGL---VGDIASQVGEYN----------
A0A3N2NMI0      ---ARF----V-RTYL---TAEDSRNQLLPANSGL---VGDIAKQVSEYN----------
A0A359I8H7      ---SIY----L-RDYL---NNPGNAKSVIPVNTGI--GSPTLEAQISNYN----------
A0A3N2KA63      ---SIY----L-RDYL---NNPGNAKSVIPVNTGI--GSPTLEAQISNYN----------
A0A3B9FAU3      ---AQY----V-KGML---TRGAKSRKLLPTNAGL--ESTGIEQQIAEYN----------
A0A3C1E5L7      ---AQY----V-KGML---TRGAKSRKLLPTNAGL--ESTGIEQQIAEYN----------
A0A354SN68      ---AYF----I-KEYL---SNVKNRNQLLPVNSGI--GNEGIEGLINDYN----------
A0A0A2DUD9      ---ARQ----V-RNLL---KN-LDKSRLLPVNSFV--NNPSLEQQIGEFN----------
A0A3N2N595      ---TRY----I-RNYL---SADNDNTKLLPIPSEV--ENVDVKSQLTNYN----------
R5FHS9          ---AQY----V-LSYI---TNPKQRNHVLPANFGL--TDQNIEQQIESYN----------
A0A3P1ZBJ5      ---TRY----V-SQML---TNEKNKFDLLPANSGI--NSSSVEALIGDYN----------
A0A413TW79      ---ARY----L-RDFL---TGKVGKNQLLPANIGI--DSPGIEQQITEYN----------
A0A3E5E9M7      ---ARY----L-RDFL---TGKVGKNQLLPANIGI--DSPGIEQQITEYN----------
A0A3E4SK73      ---ARY----L-RDFL---TGKVGKNQLLPANIGI--DSPGIEQQITEYN----------
A0A415GGC6      ---ARY----L-RDFL---TGKVGKNQLLPANIGI--DSPGIEQQITEYN----------
A0A413DBH9      ---ARY----L-RDFL---TGKVGKNQLLPANIGI--DSPGIEQQITEYN----------
G9S1S8          ---ARY----I-RNYL---GGESNKYQLLPANSGI--ENSNLGDQITEYN----------
A0A354M4S6      ---ARY----I-RNYL---GGESNKYQLLPANSGI--ENSNLGDQITEYN----------
R7DH52          ---ARY----I-RNYL---GGESNKYQLLPANSGI--ENSNLGDQITEYN----------
A0A396N3D5      ---ARY----I-RNYL---GGESNKYQLLPANSGI--ENSNLGDQITEYN----------
A0A415ZDP9      ---ARY----I-RNYL---GGESNKYQLLPANSGI--ENSNLGDQITEYN----------
A0A016CWA4      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A1C6H117      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A415TAH7      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A0M1W0V2      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A139KA16      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A174VQ92      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A1Q6HCG0      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A1Y4JYM9      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A5QW67      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A5RQE6      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A6BP07      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E5E153      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3Q9IP20      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A412WV15      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A413ICP6      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A414KYB9      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A416X133      ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
E5WX00          ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
K0X3P3          ---TRY----I-RNYL---SNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A5Z014      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A1M4YZ07      ---TRY----I-RNYL---TNDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A078S3Q8      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A069SJV7      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E5DXI5      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E5EM98      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E5F453      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
I9T3G6          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A0P0FQW1      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESVNIESQIAEYN----------
C3RFN5          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E4SYU0      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A6LGY1          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
K5ZSH4          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A078T2W6      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3R6D1V4      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3R6EAF7      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A412MJT7      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E4WKT5      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A5YY33      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A078TAH2      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A1E9CFZ7      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A373FYU5      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A5TZ72      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A5XBP2      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3A6MEG9      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E4JP35      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E4KP40      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E4NX82      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A3E4XFU8      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A412RG70      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A412TD37      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A413GAA4      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A414M7I4      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
E5UZA2          ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A069SMG6      ---TRY----I-RNYL---ANDANRTQLLPANSGI--ESANIESQIAEYN----------
A0A1Y4PQK7      ---VRY----I-RNYL---ATTAGQNQLLPANSGL--ENVGIEKQISEYN----------
A0A1Y3ZDB3      ---VRY----I-RNYL---ATTAEQNQLLPANSGL--ENVGIEKQISEYN----------
A0A3A6AAP4      ---VRY----I-RNYL---ATTAEQNQLLPANSGL--ENVGIEKQISEYN----------
A0A1Y4IH41      ---VRY----I-RNYL---ATTAEQNQLLPANSGL--ENVGIEKQISEYN----------
A0A1Y4DYA7      ---TRY----V-RNYL---TNNNNKNQLLPANSGI--ESSGIENQILDYN----------
A0A1Y3X4I9      ---TRY----V-RNYL---TGGNSRNQLLPANSGI--ESSGIEKQIADYN----------
A0A1Y4FNK8      ---ARY----I-RNYL---TNATSKNQLLPANSGI--ESPGIEQQIANYN----------
A0A355FD59      ---ANY----I-RNYL---TGPAYTNQLLPANSGI--ENSGIESQISEYN----------
A0A359CEZ9      ---ANY----I-RNYL---TGPAYTNQLLPANSGI--ENSGIESQISEYN----------
A0A353Q7B4      ---ANY----I-RNYL---TGPAYTNQLLPANSGI--ENSGIESQISEYN----------
A0A1M3KVR9      ---ARY----M-RNHL---MTSTNNNQLIPANSGI--ESASVENQITEYN----------
F8X3A5          ---ARY----M-RNHL---MTSTNNNQLIPANSGI--ESASVENQITEYN----------
A0A3C1ITV0      ---ARF----I-REYL---VDNTRQYDLLPSNSGV--GSQAIEEQIAEYN----------
R7HN19          ---ARF----I-REYL---VDNTRQYDLLPSNSGV--GSQAIEEQIAEYN----------
A0A415EEZ4      ---VRF----I-REYL---NDPTKQSELLPANSGI--LDTGVEGLINQYN----------
A0A060RD97      ---ANY----I-KDYL---LDPINANALIPRVSGA--QNLGVDSQIDSYN----------
A0A350IHV0      ---AKF----I-KEYL---KDPQHDGALIPSNLGL--DSKTVDSQITEYN----------
A0A077ENE7      ---AEM----M-RSYL---MNKGKQNNLIPNNTGL--VDSGVEGQIAEYN----------
T0NN57          ---AEM----M-RSYL---VNKNKRNDLIPNNTGL--VDASVEGQIAEYN----------
X5K347          ---AEM----M-RSYL---VNKNKRNDLIPNNTGL--VDASVEGQIAEYN----------
A0A1T5K9D4      ---AEY----L-RDYV---RGSMDSFEVIPANTGL--NDANLDQAISQYN----------
R5RVP0          ---AKF----I-KEYL---ENPAHSGALIPANSGL--TSTTVEAQIKEYN----------
A0A285T4L1      ---AQF----I-KEYL---TDPTKNRDLIPSGTGI--SDASVEGQINQYN----------
A0A3E5BU42      ---AQF----I-KEYL---TDPTKNRDLIPSGTGI--SDASVEGQINQYN----------
A0A414ZBF2      ---AEY----I-KDYL---QDNSKTAELIPSSIGI--NDNGIQNQINEYN----------
R5KD55          ---AGY----I-RDYI---TNRANTNQLLPANMGL--DDGKTDGLIDKYN----------
A0A174QNT3      ---VEF----I-KKYV---TDKSKSADLIPNVSGV--GDAGVQTQIEDYN----------
R9I0H0          ---VEF----V-KNYV---TDKTRSSDLIPNVSGV--GDVGVQSQIESYN----------
K5BUT9          ---ARS----I-KSYL---ADVTRKDQLIPNVTGV--GDVSMQSQITAYN----------
A0A174FPA3      ---ARS----I-KTYL---ADVTRKDQLIPNVTGV--GDVSMQSQITAYN----------
R6S9Y6          ---ARS----I-KTYL---ADVTRKDQLIPNVTGV--GDVSMQSQITAYN----------
C9KX15          ---ARS----I-KTYL---ADVTRKDQLIPNVTGV--GDVSMQSQITAYN----------
A0A3L8AAP1      ---AQS----I-KSYL---LDATRNNQLIPNVSGV--GDASVQSQITAYN----------
R6DAG6          ---AQS----I-KSYL---LDATRNNQLIPNVSGV--GDASVQSQITAYN----------
A0A1G8BVM8      ---ANY----M-KNYL---HDNANKSELIPGNLGI--NNSGIESQIARYN----------
A0A416GGJ1      ---AQY----I-KEYL---IDPAKETDLIPANTGL--SDASVESQINTYN----------
A0A3D1NQW3      ---TEF----L-KEYL---LDPTKTNELIPGTLSI--NSPAINSQIEGYN----------
B0MT10          ---TEF----L-KEYL---LDPTKTNELIPGTLSI--NSPAINSQIEGYN----------
R7JGW9          ---TEF----L-KEYL---LDPTKTNELIPGTLSI--NSPAINSQIEGYN----------
A0A0E2M2Y7      ---AKY----I-QSFL---RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A0K2J6Z0      ---AKY----I-QSFL---RQTSTDNELMPANLGL--TERGIDNSITLYN----------
B2RKZ8          ---AKY----I-QSFL---RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A212GC82      ---AKY----I-QSFL---RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A254MU12      ---AKY----I-QSFL---RQTSTDNELMPANLGL--TERGIDNSITLYN----------
R6CQ93          ---AQF----I-KEYL---TDPTKSRDLIPSGTGI--SDASVEGQINQYN----------
A0A3D2BF46      ---AQY----I-RDYL---LNDTKLRDLIPANVAI--TNVSISDQIKNYN----------
A0A358R538      ---ARF----V-SDYL---RDPAHAGELIPMAASV--ASETVAAQIDRYN----------
A0A1Y4AAB8      ---AEF----I-RSYL---LDREHAGDLIPAMAAI--ANSGITEQISAYN----------
A0A1Y3WWY9      ---AQF----I-RSYL---SDPSKAGELIPAMASV--TNAAVSAQIDEYN----------
A0A1Y4U5L4      ---AQF----I-RSYL---SDPSKAGELIPAMASV--TNAAVSAQIDEYN----------
A0A1Y3VCJ1      ---AEF----V-RGYL---ADPAKSGELIPAMAAI--SNGAVTAQIDEYN----------
A0A1Y3QTW7      ---ANY----I-RDYL---NNPTHAGELIPMVASL--TNNGIVAQITEYN----------
R6XWY7          ---ANY----I-RDYL---NNPTHAGELIPMVASL--TNNGIVAQITEYN----------
A0A174AVF1      ---ANY----I-RDYL---DDPSHAGDLIPMVASL--TNNGIVAQITEYN----------
A0A373HTL7      ---ANY----I-RDYL---DDPSHAGDLIPMVASL--TNNGIVAQITEYN----------
A0A1Q6EIY0      ---ADF----I-REYL---NDPSHAGDLIPMVASM--TNNGIVAQISEYN----------
E4M8L3          ---ADF----I-REYL---NDPSHAGDLIPMVASM--TNNGIVAQISEYN----------
I3YQ50          ---ADF----I-REYL---NDPSHAGDLIPMVASM--TNNGIVAQISEYN----------
R5UEY8          ---ADF----I-REYL---NDPSHAGDLIPMVASM--TNNGIVAQISEYN----------
A0A1H4D866      ---AEF----I-RTYL---NDPKNAGELIPMMASV--TNQGISSQIADYN----------
A0A374A9J5      ---AEY----I-RTYL---NDPKNVGELIPAMAAA-GTNTAIAKQIEDYN----------
A0A1Q6E9S3      ---AEY----I-RTYL---NDPKNVGELIPAMAAA-GTNTAIAKQIEDYN----------
D4IJ36          ---AEY----I-RTYL---NDPKNVGELIPAMAAA-GTNTAIAKQIEDYN----------
A0A414Q925      ---AQY----M-KEYL---QDNSKTTELVPASIGI--DDMGVQNLIMEYN----------
A0A415PUS9      ---AQY----M-KEYL---QDNSKTTELVPASIGI--DDMGVQNLIMEYN----------
A0A108TCU0      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A413BA42      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
S3Y344          ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A413MY74      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A412TGL3      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A413VJ33      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A414L0W6      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A412DP39      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A413ZSE8      ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
B0NP84          ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
R6AK43          ---AQY----M-KEYL---QDNSKTTEPVPASIGI--DDMGVQNLIMEYN----------
A0A412N2D9      ---AQY----M-KEYL---QDNSKTTDPIPASIGI--DDMGVQNLIMEYN----------
R6LHA4          ---AQY----M-KEYL---QDNSKTTDPIPASIGI--DDMGVQNLIMEYN----------
A0A1Q6FL18      ---AQY----M-KEYL---QDNSKTTDPIPASIGI--DDMGVQNLIMEYN----------
A0A1Y4JYS9      ---AQY----M-KEYL---QDNSKTTDPIPASIGI--DDMGVQNLIMEYN----------
A0A3E5HPT8      ---VSF----I-KQYL---QDSNKDDELIPSNIGL--SDLSIESQISRYN----------
C6IJ48          ---VSF----I-KQYL---QDSNKDDELIPSNIGL--SDLSIESQISRYN----------
Q8A3U2          ---VSF----I-KQYL---QDSNKDDELIPSNIGL--SDLSIESQISRYN----------
A0A3R6S1H6      ---ARS----I-KEYL---HDPQHERDLIPSNTGI--PDVNIEQSIGKYN----------
A0A3R6SD81      ---ARS----I-KEYL---HDPQHERDLIPSNTGI--PDVNIEQSIGKYN----------
A0A413VXJ7      ---AKY----I-KDYL---VDPQKNADLIPANTGI--SDNSVESQISEYN----------
I9RSN9          ---AKY----I-KDYL---VDPQKNADLIPANTGI--SDNSVESQISEYN----------
U6RJK5          ---AKY----I-KDYL---VDPQKNADLIPANTGI--SDNSVESQISEYN----------
A0A1Q6GA32      ---AKY----I-KDYL---VDPQKNADLIPANTGI--SDNSVESQISEYN----------
I9RPU6          ---ARY----I-KEYL---TDPQKNSDLIPANTGI--SDNSVEAQIKEYN----------
I8Y597          ---VKY----I-KEYL---VDPQKGSDLIPANTGI--SDNSVESQIKEYN----------
I8YFS5          ---VKY----I-KEYL---VDPQKSSDLIPANTGI--SDTSVEAQIKEYN----------
A0A1Q6GBF5      ---ARY----I-KEYL---TDPLKNSDLIPANTGI--SDNSVESQIKEYN----------
I8YFZ3          ---VRY----I-KEYL---TDPQKNSDLIPANTGI--SDNSVESQIKEYN----------
A0A1Q6GDH2      ---AKY----I-KEYL---TDPQKNSDLIPANTGI--SDNSVESQIKEYN----------
U6RSB0          ---ARY----I-KEYL---TDPQKSSDLIPANTGI--SDNSVESQIKEYN----------
I9SIK1          ---AKY----I-KEYL---TDPQKSSDLIPANTGI--SDNSVESQIKEYN----------
I9GXM2          ---AKY----I-KEYL---TDPQKSSDLIPANTGI--SDNSVEFQIKEYN----------
I9TP59          ---AKY----I-KEYL---TDPQKSSDLIPANTGI--SDNSVESQIKEYN----------
A0A0J6CIR2      ---AKY----I-RDYL---TDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
A0A3D8HG59      ---ARY----I-RSYL---VDPSKEAELIPANTGI--SDSNVESQIGEYN----------
A0A3R6S408      ---ARY----I-RSYL---VDPSKEAELIPANTGI--SDSNVESQIGEYN----------
A0A354WXN6      ---AKY----I-KEYL---IDPSHNADLIPANTGV---DVNVESDISEYN----------
R5IP14          ---VNF----I-KDYL---SDPVKINDLIPANTGI--ESAEISGAISEYN----------
A0A316SZX7      ---ALF----I-KEYL---SDEKHVSELLPANTGV--ADLGINEQIKEYN----------
A0A1Y4AIY1      ---AQY----I-RDYL---SDPQKALDLIPANT-I--TDVTVEQQIAAYN----------
F3ZRU7          ---GQY----I-KDYL---IDPANRGKLIPANTGI--SDNTTEGQIKEYN----------
A0A1C5Q1F3      ---ALY----I-RDYL---ADPAKSGELIPSNTGI--SDGTIERQIMEYN----------
R7A239          ---ALY----I-RDYL---ADPAKSGELIPSNTGI--SDGTIERQIMEYN----------
A0A1M6K7I9      ---AEY----I-KQYL---VDPSKVADLIPANTGI--TDAGVEKQIAEYN----------
A0A3R6HIK7      ---AKY----I-RDYL---SDPQKALELIPANT-I--TDMKVEQQISTYN----------
K5ZVW7          ---AKY----I-RDYL---SDPQKALELIPANT-I--TDMKVEQQISTYN----------
A0A1Y4D5Z0      ---AKY----V-REYL---SDPHKASDLLPANT-L--SDVNIEQQIAEYN----------
R5S343          ---AKY----I-REYL---TDTRTRGKLIPANTGL--TDMNMEGRIGEYN----------
A0A3R5ZMK1      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A3E4ZTK7      ---AKY----I-KNYL---TDPGKSSELIPANTGI--SDVNIESQIGEYN----------
A0A1Y3ZIA4      ---AKY----I-KNYL---TDPGKNSDLIPANTGI--SDVNIESQIGEFN----------
K5Y1A4          ---AKY----I-KNYL---TDPGKNSDLIPANTGI--SDVNIESQIGEFN----------
A0A3R6K8X4      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A1Q6I3T6      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A414XX40      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A412DM15      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A7AEU7          ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A415BDM7      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A3R5ZYK4      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A414GI87      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A3R6BKI7      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A414LPI6      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
A0A412M2W1      ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
K5ZX55          ---AKY----I-KNYL---TDPGKSSDLIPANTGI--SDVNIESQIGEFN----------
K5ZBN2          ---AKY----I-REYL---TDPHKGADLIPANTGI--SDVSLESQISEYN----------
A0A0J6CKW3      ---AKY----I-REYL---TDPHKGADLIPANTGI--SDVSLESQISEYN----------
A0A0F5IQM7      ---AKY----I-REYL---TDPHKGADLIPANTGI--SDVSLESQISEYN----------
S0GLB0          ---AKY----I-REYL---TDPHKGADLIPANTGI--SDVSLESQISEYN----------
A0A3R6NLC1      ---AKY----I-REYL---TDPHKGADLIPANTGI--SDANVESQISEYN----------
A0A416WYC9      ---AKY----I-REYL---TDPHKGADLIPANTGI--SDANVESQISEYN----------
A0A0F5IT40      ---AKY----I-RDYL---TDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
S0GSI7          ---AKY----I-RDYL---TDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
K5YB65          ---AKY----I-RDYL---TDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
A0A0F5IWP9      ---AKY----I-RDYL---IDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
A0A0F5IZT8      ---AKY----I-RDYL---IDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
A0A417LKQ2      ---AKY----I-RDYL---TDPHKSSDLIPANTGI--ADVNIEGQISEYN----------
A0A416TME1      ---AKY----I-RDYL---TDPHKSADLIPANTGI--ADVNIEGQISEYN----------
A0A416XPE8      ---AKY----I-RDYL---TDPHKSADLIPANTGI--ADVNIEGQISEYN----------
L8JI02          ---YTY----I-SESL---AEGRFGDVVAPSTFGL--EDPLLSSLLIELS----------
A6EBM4          ---IDQ----L-RNTI---TTEQTNTPLNLSLEGT--IDPLLATLAQNLN----------
A0A2N3U785      ---LQT----I-EDYL---TKSKNKSILVPSTLNI--KDPTLQDLISRFN----------
A0A0E3ZG78      ---LES----I-ESYL---NKDENQYKMVPSTLSI--QDVTLMGLIARFN----------
A0A1I6BRK6      ---LES----L-ENYL---KNNNN--SIVPNSLGI--KDETLAKLIGRFN----------
A0A243WAB1      ---LES----I-ENYL---KRTNGQYSMVPSTLGI--KDETLLGLIGKFN----------
A0A399SH26      ---LAK----I-ENYI---IAKDKSAGIVPSTLGI--NDPVLTQLLQKLY----------
A0A0E3ZGV6      ---LDN----V-ERYV---VRKNKDLGIVPSTLGV--SDPVLSQLLQKLY----------
A0A1I2N4S1      ---LDN----V-EKYV---LSKEENIGIVPSTLGV--SDPVLSQLLQKLY----------
A0A2T5YE44      ---LDN----V-EKYV---LSKEQNIGIVPSTLGV--SDPVLSQLLQKLY----------
A0A1M4YED3      LDQIER----Y-VTSR---NNKDGVAPATLGLNDR--GLTSLVERLAEAE----------
A0A3P1Z8V4      RSSGKG----K-EV--------------IPAVAGF--TNAALAQQITEYN----------
A0A2L2WX98      QNSSKR----N-ET---------------VPVLSL--PEASFTPLIGEYN----------
G5GD56          QNNSNE----H-QI---------------IPAINL--ERATFNGQIDTYN----------
R6A0L2          HTHSNS----H-DL---------------IPALNV--GDASFNTQIAAYN----------
R7LG80          DNQTND----R-DL---------------IPALSL--KDASFNTTIDKYN----------
A0A1M6XHU0      EQELQK----L-EP-G---LVNELVKSRQVATLEA--QIDALSKKIAELK----------
D0MHQ9          EQELQK----L-EP-G---LVDELVKSRQVSTLEA--QIDALSKKIAELK----------
G2SF81          EQELQK----L-EP-G---LVDELVKSRQVSTLEA--QIDALSKKIAELK----------
A0A2H3NSN0      VNQLNE----A-ES-S---FRSDVEGEQSVQSMQN--RIAALDQQIADLE----------
A0A2P6C324      EDQMER----A-QP-S---LRSAVLKEQEVQSLRT--QIQALEDQIAELK----------
A0A126PFG0      ERTLRD----P-RPTA---TVPTA-----LGITDA--TLSSLVEKLTELH----------
A0A3M1N7Z3      LDTLRQ----D-PAAE---VAFLP-----LGALPE--VQVPLTE-LNQLL----------
R7PCR1          HSKSKD----D-EFIP---MLDLG-----DAGIQQ--EISAY------------------
A0A2A8CVM9      RDQLAQ----F-EP-G---LRETVQQEQEASGLRS--EISVLERKIGEMR----------
A0A3C0ZQC7      QEELAK----Q-EP-N---VAKAI-----GEANDP--YIRLLQEQLAMLE----------
A0A2E3R1D0      QSELSR----L-ES-Q---LGTRL-----SSNLDS--ELAAARERIQQLN----------
A0A2T2USC0      KEELAN----I-RP-N---LAERI-----ASGLGE--ELSQVQKEKAEVA----------
A0A2T2V0F3      QEELAN----I-RP-N---LAERI-----SSGLEE--ELSQVQREKAQVT----------
A0A2T2S682      KKELKR----I-RP-R---LAERL-----SSGIQT--ELKQVQQEKANVA----------
D5H561          REELES----I-QPGQ---LSDQL-----ASTVDQ--EISSLQSEIAKLE----------
A0A2H3NWA9      QDNIES----I-EP-Q---LAERL-----ASNIDS--ELARVQEERAELK----------
A0A2A8CVB6      RSELEK----I-EP-Q---ISDRL-----SSTTGD--VLESVQEEKARLQ----------
A0A2P6C1S6      KEELGT----I-EP-K---LAERL-----SSSLGQ--RLSSLQTEQAELE----------
A0A2T2UTM4      KEELRQ----I-EP-K---LAERL-----SSDLGE--KLSTFQTEKAELE----------
A0A1T5MMH4      ---INKLMDGL----------QTGNFSVNPSIRQA--LPEYMFKDIDEVQ----------
A0A2W4R1L8      ---INELLDDM----------SNGVYLVNPVHRLY--FPQAINDNLDKLS----------
A0A2E5CV79      ---RRE------RISFLNSKLSAEEKNFATKISTD--INAQMIVLRKEIN----------
A0A2A4G4B1      ---ALLMKKSV----------LEGGIQLLPTNIGL--DHSGVKETIDNFN----------
A0A2D4ZVH1      ---VMSGIAQY----------ENQLNEIKPGLADL--YSDAIGPVIERYQ----------
A0A0E3V905      ---LNDLQKYI--------EGKGDTRGNTPAVVGL--SDPVLLSLINNLT----------
A0A1M6GR99      ---LMTQKRYYDYIKEYNSDNSDDTQIVPPSAMGV--QDPLLNNLIEELS----------
A0A1M5BA90      ---LNEVEKYV--------LSKNNQIGIVPSVVGV--KDPLLSSLLQKLY----------
A0A1V9F098      ---LNEMERYV--------NSKENKGDIIPATIGI--SDPVLTELMQKLY----------
A0A1V9FHD0      ---LDEMERYA--------NSKDNNTETVPSTMDI--PDPVLTDLMQKMY----------
A0A1T5CS78      ---LNNVENYV--------ISKGSAGGMVPSTLGI--SDPILSQLIEKLY----------
A0A0Q9Z8F1      ---LNNVENYV--------ISKGSAGGMVPSTLGI--SDPILSQLIEKLY----------
A0A2N0U0M7      ---LNNVENYV--------ISKGSAGGMVPSTLGI--SDPILSQLIEKLY----------
A0A1M6TTV4      ---IELASEQLDEGTPISPV----------------DMPKEIMQLLVDYN----------
A0A1Q6IT42      ---ISMVDSFL--------NKPENKYSLVPVTTGL--PDRGAAEAINEYN----------
K0X1U5          ---ISMVDSFL--------NKPENKYSLVPVTTGL--PDRGAAEAINEYN----------
A0A416XAH0      ---ISMVDSFL--------NKPENKYSLVPVTTGL--PDRGAAEAINEYN----------
R5EXK3          ---ISMVDSFL--------NKPENKYSLVPVTTGL--PDRGAAEAINEYN----------
A0A401UAP7      ---IRKLKEDL----------KDGKTERYVSLTDKETLPQEVINDVLAYQ----------
A0A1W2GF52      ---VDL------VGENFRNGQQVSIFKMPTRITEL----------VNSYN----------
A0A2G5L7B8      ---VEL------ANKQLGEGTPITTLGLPKPFLEM----------LAEYN----------
A0A0D3LFR6      ---LTNLSSRI-------KSEDTYFAQSLVNRAGD-DFPADIKTLLDQLN----------
M7N6D4          ---ITSLASRI-------EAEDSYFAQSLVNRQDG-NFPAELKGLVEELN----------
A0A364XUP5      ---LNQLSDGL------------RSKKFFVSPGLRKILPEYISKNLDRVQ----------
A0A1M5RLA9      ---VNTLMDGM------------KAGDLSISLTQLHALPPTVAKNLEQLE----------
A0A385SFR9      ---VNTLMEGL------------KTGDLFISLTQLHALPPTIAKNLEQLE----------
L8JW09          ---FDQLLADL----------ENNKTEFLGISQET--YPKHIADAYNELS----------
A0A1Q3ZMZ7      ---LKD----L-KRRINSTSSETEISNILIEIANE-EYSGIIRTQIETLQ----------
A0A2D8JJW3      ------------------------------------------------LD----------
A0A2W2AFF7      ---VESLQKYL--------HENVNNRRVVPSSLVL--QDPTFVALIDKYN----------
A0A2N5YXE2      ---LEK------VSEKIEKDPELKTYEILAMLSGQ-QSETFIAGMINSLQ----------
A0A2I0QZ80      ---LKV----V-KEKLNSDPNSNDVYRLIPNIIGQ-SYEGSLTKQIQELY----------
A0A2U2XBJ3      ---LNS----V-QDKLEGNPNSLDVYRLIPVIIGK-SYESSLNSQIQELY----------
A0A3E1F1A3      ---LET----V-KKKIEGNPNSLDVYRLIPIIIGK-SYESSLNQQIQELY----------
A0A1V9F383      ---LDEMENYV--------TSRSNKGDLVPATLGI--TDPVLSDLMQKLY----------
G8TRZ6          ---VDEMENYV--------NQKSNTGDLIPSTLGI--ADPILSDLMSKLY----------
A0A2W1NDY9      ---ILG----L-VEGI-NSKNRVSIYNLIPTLAGT-RFQPLLEGQIEKLY----------
A0A1G0CI31      ---LKL----V-SSKLRNDPNRLEIYRLIPEMLGK-SFEISLTRQITDLH----------
F2IKD6          ---LKV----V-NSKLKTEPNRLDIYRLIPEMLGK-SYESSLTKQITDLN----------
A0A1I7BM74      ---LKR----I-KTEINNSPRSTEVYKLLPVLIEK-SYQNALKDQIETLF----------
A0A2G2FJ17      ---LEM----I-SLKLKQSPESLDVYKLIPELIGK-SFEGSLNLQVKELH----------
A0A416X8R7      ---ARAVERYL--------TDNEHSKQLIPNVSGV--GDSGLQNQITTYN----------
K0XJ09          ---ARAVERYL--------TDNENGKQLIPNVSGV--GDSGLQNQITTYN----------
R5EUZ0          ---ARAVERYL--------TDNEHSKQLIPNVSGV--GDSGLQNQITTYN----------
W0EQS0          ---AQAVQKAF--------SGKENNKQLIPNVSGV--GDAGLQSQIEAYN----------
A0A1Y3WE15      ---AQAVQRAF--------ANEKGDKQLIPNVSGV--GDAGLQKQIESYN----------
A0A1Y4GUK3      ---AQAVHRAF--------TNDKDNKQLIPNVSGV--GDAGLQSQIEAYN----------
A0A2U1FKU2      ---AKYIQAFL--------RQTNSDNELMPANLGL--TEQGIDNSIAQYN----------
A0A0A2F954      ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A0A2FW91      ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A2D2N2N1      ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
Q7MWZ2          ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
T2NDT6          ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
W1R7P9          ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A1R4AFZ0      ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A1R4DVZ7      ---AKYIQSFL--------RQTSTDNELMPANLGL--TERGIDNSITLYN----------
A0A1G9E2A9      ---LDELEAYV------NRVDSTLEVEFIPSTRAI--RDEQLLSLVNQLN----------
A0A2T2YJE8      ---LNEVDQLL--------NKSSNLDQMIPSLKEL--DDAQLLKQIAQLS----------
A0A3M9N829      ---YNT------IQSKMQQDEDLGLIVAGLQGQPN--QDPQLSELLTELS----------
A0A0P0CSF9      ---LNT------IQTKVQRNEDLGMIASSIQGQEN--QDPQLAEQLTELS----------
A0A3M9MNC3      ---LNT------IQSKVQKNEDLGMIASTIQGQEN--QDPQLAEQLTELS----------
A0A2M6GH67      ---LRDIHNLV--------AHDSDLEQIIPSLKQI--EDAELSTKIAELS----------
A0A127B287      ---LSD------IQQRIRKGDDLSLVISSLQLQEQ--QDPQLAQLLTELN----------
A0A369QP10      ---LNEIDQLI--------GRNTSLDQMIPSLKEL--DDEQLSNRISQLS----------
A0A418R9X5      ---LAELSRLV-EQERLTSRQDGDVMQTIPALSTI--EDAQLTKRITELS----------
A0A428JSJ3      ---LADLARLV-EQERLTDREDGDVFQTIPALSTI--KDGQLLQRITELS----------
A0A428KI59      ---LAELARLI-EQERLTDREDGDVFQTIPALSTI--KDGQLTQRIIELS----------
W8F1I6          ---LAELARLI-EQERLTDREDGDVFQTIPALSTI--KDGQLTQRIIELS----------
A0A246FQC0      ---MNDVARLV-EQDRLTVRPDGDVMQSIPALAEV--KDGQLVQRITELS----------
A0A372E5P8      ---MSDVGQLL-DREQLTTRADGDVMQSIPALADV--KDGQLIQRITELS----------
A0A1H3EMW1      ---MGDVGRLL-QQEQLTTRADGDVMQSIPALAEV--KDGQLVQRITELS----------
A0A1H9ZSN3      ---MNDVGQLL-DREQLTTRADGDVMQSIPALAEV--KDAQLVQRITELS----------
A0A0M3RW20      ---LNGVARLI-QRERITRDENVSVEQSVPGLVTL--EDPILTQQITELN----------
A0A1S9B3W0      ---LTEITRLV-EQERLT-KDDETVEQSIPGLAAL--EDPVLSQQIGFLN----------
A0A1W1VRL3      ---LADLSSLV-EQDQLTANEDSTVAQSIPGLAEL--EDGRLTQEIEALN----------
A0A1M6R305      ---LNEVAALA-EQGTITAREDLTVEESIPALATI--ENPQLSQQLTEVN----------
A0A2M9B9H9      ---LGEISRLV-EQDRLTQNEDATLEQSIPGIAAV--EDAQLTQQLSELN----------
A0A126PDF2      ---LSEISRMV-QQTHITRNEDETIEQSIPGLGDI--NDPILSQLLSQLN----------
A0A2Z3GKA1      ---LSEISRMVQQQTHITRNENETIEQSIPGLGDI--NDPVLSQLLSQLN----------
A0A328BL48      ---LQELSRVV-ETERLIGSDELTVEESIPGLAVL--QDPQISQQLTVLN----------
A0A3S0QKV1      ---LTQVSRLV-QQERITSRDDETVEQSIPGLALL--EDPQLTQLMSVLN----------
A0A3R9P8H7      ---LNDVARLI-EQDRLTDRADGDVLQSIPALTDA--KDGQLVARIQELS----------
A0A212UCJ7      ---LRSLNSQI-AQNRIVASEERSAEQSIPALAEL--KAPELAARIGELY----------
A0A238WIA7      ---LRNLSNQI-ESNQFVAREDVSAEQSIPALAEI--KAPELTERIGELY----------
A0A0W8EDI5      ---IGEIAQLV-EQNQVMVQEGDDIEQSIPALAIL--EDAQLTQQIGVLN----------
A0A3B7RBP8      ---LAEVASLV-QQNRVLTREGETIEQSIPALTVL--EDAQLSQQIALLN----------
A0A1I5WSL8      ---LTEIEVMA-RQDRLTRDETQTVEQSMPAIVGI--EDAQLLQQLNELN----------
A0A0U3JVM7      ---LGEIAQMA-SQGSLTRDETQTVEQSIPALAGI--EDPQLAQQLNELN----------
A0A1G1SSV2      ---LAEIANMA-NQDRLTRDETQTVEQSLPALAGI--EDAQLGQELNQLN----------
A0A1G1SXV7      ---LAAITNMA-NQERLTRDETQTVEQSLPALAGI--EDAQLGQELNQLN----------
A0A243WHR7      ---LDEIVALV-ESNQLTNSEEASISESIPGLKQL--GDEQVTQQINRLN----------
A0A076HRT9      ---LNEVADLA-ERGTITSREDLTVEQSIPALATL--ENSQLSQQLGELN----------
A0A1M6DHW8      ---LSNVARLV-EQDRLIASDEATLEEGIPGIALL--DDSPLTQQLSELN----------
A0A3D1KEX9      ---AKY----L-REYVVKNASNTNLIPDLNL-----GDNGAMQGQIGKYN----------
A0A358Y7S2      ---LYL----V-QGKLTSNPNRLDIYKVIPEMIGKKSFEGAVIRQIEELN----------
A0A1X7J248      ---IEN----I-QKQLEKDTLSFDKINYLVLPSNM-------QPLFEEFS----------
E4TQD2          ---INN----I-QSQLDKDTLSFDKINYLVLPSNM-------QPLFEEFS----------
A0A2J6HHN3      ---LSA-------FILSVENEENDVLFLISMLTGT-ESYTYLSPYLTSLQ----------
A0A1Y3WMT8      ---ISM----V-DSFMNSPE---NKYSLVPITTGL--PDRGAAEAINEYN----------
A0A1Y4GQU1      ---ISM----V-DSFLNRPE---NKYSLVPVTTGL--PDKGAAEAINEYN----------
A0A1V5W8T5      ---LQK----V-NKQIAAGK-DFNAVELISILSGS-SSESMVLNFLNGIQ----------
A0A2T8HKA9      ---AEM----M-RDYIYDAG---RSEKLIPSNMGL--ADLNVDRYISDYN----------
A0A3B8INU3      ---VNR----M-FSSVIDSADIPDQSLLFPHLNTA----------LQEYG----------
A0A098LL25      ---LGE----L-KDLILGDQ---EVNSFIPALSQV--ENPQLSAAINSLN----------
A0A1Q3Q573      ---LQN----F-KMLLQKT----KDYSTLPILQFK-EEEMSIAGEIENIN----------
A0A357YNR3      ---VSN----L-NDYVQNIN---NHEQLIPANSGI--NSQSLNNQINSYN----------
F4KK08          ---AQF----V-RGHLKDKN---QMESLIPANVGI--ASPSIEAAIAKYN----------
A0A3N2N6F7      ---TRF----L-IDYMQSPA---NKGKLLPGNLGI--ENQGIVAQITEYN----------
A0A419VXB7      ---YKN----L-RGYIGEDGNMKNI--VFPSVVGI--TDVGLNSMVVRLS----------
A0A2V1ILM4      ---SKF----I-LDYIKNPDTNGQLVPANAGLENP-----GIEAQINEFN----------
A0A3N2L0E8      ---SKF----I-LDYIKNPDTNGQLVPANAGLENP-----GIEAQINEFN----------
A0A3N2LFC5      ---SKF----I-LDYIKNPDTNGQLVPANAGLENP-----GIEAQINEFN----------
C3J7R8          ---ANY----L-KDYLKSPS---SKDELIPANVGL--NEASADNLIREYN----------
A0A0B0BTJ4      ---LSA----I-GDILNGK----EEIGILPVNIGI--ENQALSNAINKYN----------
A0A3B9CNN6      ---LSA----I-GDILNGK----EEIGILPVNIGI--ENQALSNAINKYN----------
R5X290          ---LSA----I-GDILNGK----EEIGILPVNIGI--ENQALSNAINKYN----------
A0A1Q6E6I7      ---LSA----I-GDILNGK----EEIGILPVNIGI--ENQALSNAINKYN----------
A0A2G2F510      ---LIT----V-HKMIGSSPNRLEVYKMLPEMLGK-SYETSLVKHIEELH----------
A0A316JZ08      ---LIA----I-DNQLERAPNRLEVFRMIPEMLGK-SYEASLVTHITDLH----------
A0A1I1FXP9      ---LMD----L-RNTIINNQ---DIRKIIPALKHI--NDQELVDLAEALS----------
A0A3B9FXJ0      ---LKW--------LLDYANNNIEDLDALSGYFGN-LKFNNFAPYFNSLS----------
R5GSU5          ---AEY----L-EDFLKNNSKADQVIPVLNDMVDQ-----GIQQQITEYN----------
A0A2P8EAX2      ---LES----I-ESLIAVQGSGNETIPSSFV-----TLDPTLSELLSKYN----------
A0A3N4H5N3      ---LES----L-ENLINSQSSQGDLIPSSLV-----SLDPALGDLLTRYN----------
A0A2A3UE91      ---ITE----I-QANIAKNK-NIDIYQLISLMSGT-EYESVIKDVTQNIQ----------
A0A0A2G557      ---AGF----I-KEHLTNPS---SANGLIPASSGL--EDLASNSLIKEYN----------
A0A2N2WFW8      ---LDR----F-YNTFESG--NSDFVVLLSLLSGL-ESQVYLAPYLQSLK----------
A0A1F3IU95      ---LEI----F-YKAFSSG--NADIITLLPLISGI-ESQVYLSPYLQSLK----------
A0A3D0VUF6      ---LEI----F-YKAFSSG--NADIITLLPLISGI-ESQVYLSPYLQSLK----------
A0A1T4PT95      ---ARF----I-KEHLTNPS---TAGGLIPASSGL--EDLSSNTLINEYN----------
A0A3Q9FR88      ---YQK----L-RHFLEADSSIVYIQAYATILTDG-----SISSSLDELA----------
A0A150ADJ9      ---YQK----L-RHFLEADSSIVYIQAYATILTDG-----SIASNLSELA----------
A0A1B1FWQ4      ---YQK----L-RTLLQADSSIVYIQAYATILTDG-----SISSSLDELA----------
A0A1S1Z228      ---YQK----L-RHFLEADSSIVYIQAYATILTDG-----SISSSLSELA----------
A0A1F3SJM1      ---LDI----L-DQKLNAKVSRLNVYRMIPEMLGK-SYETALVGHIESLH----------
A0A2G2EB96      ---LLN----V-KQKLSKTPNRLEVYKLLPELLGR-SYERALEGHLNQLH----------
A0A2G6PRA9      ---LLN----V-KRKLSKSPNRLEVYKLLPELLGR-SYEASLAGHLRELH----------
A1ZKR2          ---IKE----L-DDLVNKQG---DLSEFLPTLTTPIQGLGQLQPLISKLN----------
A0A1Q3GX01      ---IKE----L-ENLMEQDK---ELVLYLPETSAGLQGLTQ---IMNQIN----------
A0A349DQI4      ---IKE----I-ENLIAEDK---ELVLYLPENTSGLQSLTE---ILKKIS----------
A0A2N3IIZ0      ---IIE----L-EIFVNQRFVDSKNIPLMPDVDGA------ILQQISELN----------
A0A2A4PYG9      ---LDE----V-ADMIKKKD-DIDVYNLLPALTGS-SFQDEISDLVQSLH----------
A0A2A5FYT6      ---LKE----I-EKKITANEKEIDPYTIIPVLTGT-HFEKNISRQINSLH----------
A0A2E6SYP1      ---FTQ----F-QLKLSENPSNEELYSILLLNSTN----KYLSSVGTSLK----------
A0A2E5RLE8      ---FRN----F-YSAISNKINHEELYSILLLNSKN----QYISTTSSRLR----------
A0A2E7TQF6      ---FRN----F-YSAISNKINHEELYSILLLNSKN----QYISTTSSRLR----------
A0A2E6GVY9      ---FKN----F-YSSISNKISHEELYSVLLLNSKN----QYISTTASRLR----------
A0A350JJ90      ---LSE----L-RGGIQIEKTGVDIYNLLPVLAGT-EFENSVKGQIEELQ----------
A0A3M1CDV2      ---LDE----I-LNNIQTQK-NIDLYQLISLASGT-SYEESIKNITSNIQ----------
A0A2E2TFD1      ---LIQ----V-KQAATSSSDSVEVHQLIPLLTGT-QFEDNLLQQIAYLQ----------
A0A2E4ELE6      ---LDE----L-KAASDGEKDSVDVYDLLPLLAGT-QFEIGIKKQIQFLH----------
A0A2E3XZI5      ---LNQFDLMF-DENLSSKI-TTSSIKNISLLTNIFYEDELIKIMITQLQ----------
A0A2M7NLQ9      ---YRE----I-STLLEDDS-----TLLVALTYSSMLKDTNLKNRIEKVY----------
I4AFR0          ---YKE----I-STLLENDS-----TLLIALTYSTILKEPSLKIRLEEVY----------
A0A2N2Y3E5      ---YNN----L-LDYLKKK--DLSAVELIAIIPQN-LNSSVLTSILSEIQ----------
A0A2D9D7T6      ---LYL----I-KSKITPNPDRIQIYKLIPEMLGKKNLEANVIKQVEELN----------
A0A1F3PPL5      ---LNR----I-KSEVAENK-NIDVYELIALLSGT-KSEGYISNILESIQ----------
A0A357QK06      ---LNR----I-KSEVAENK-NIDVYELIALLSGT-KSEGYISNILESIQ----------
A0A2A5B3B0      ---LEE----I-KTSISSNDKDIDVYELLPILAGT-EYAGGIMSLITTLK----------
A0A0F2NS19      ---LKE----I-SKSVTGKINTIDIYNLLPTLTGT-EYEASITALITNLQ----------
A0A2A5H8X6      ---LKE----I-SKSVTGKINTIDVYNLLPTLTGT-EYEASITALITNLQ----------
A0A2H0GAU8      ---LTE----I-SKSVSGKLNTIDVYNLMPTLTGT-EYEASISALITNLQ----------
A0A2M8FTK1      ---LTE----I-SKSVSGKLNTIDVYNLMPTLTGT-EYEASISALITNLQ----------
A0A0S2HYK8      ---LKN----V-KTQLETNQ-QLNTYEMIATLAGT-NSEKVLVSILTNLQ----------
A0A2N5ZWN6      ---LEN----V-NDQLKKQG-QINIYEMIATLAGT-SSEKVLVNILSNLQ----------
A0A2E0FJ09      ---LNE----I-ATVITDNPLELDIYNVLPILIGS-EFESNLYTLISVLH----------
A0A1F3FZ62      ---LEE----L-EKNFSSIK-DLDVYKLIAFISGT-EVNKIVKGNLDAIQ----------
A0A1F3K211      ---LEE----L-EKNFSSIK-DLDVYKLIAFISGT-EVNKIVKGNLDAIQ----------
A0A1F3KLL5      ---LKR----I-EKQLSAGE-NLKYYDLYSLLSGT-KSENVVSRLLEEIN----------
A0A359D1M1      ---LKR----I-EKQLSAGE-NLKYYDLYSLLSGT-KSENVVSRLLEEIN----------
A0A2E7CT70      ---LNQFQEMF-QSTLSKKI-SSNSIKSLS-LSKIFYDNLVIQNMIESLE----------
A0A2D5V560      ---XNQFSDMF-ENXLSTEI-NSTSMKNISLLTAIFYNESLTSKMIEQLQ----------
A0A2D7K5A8      ---MDQFSNMF-ENNLSTEI-NSSSVKNISLLTTIFYGESLTSKMIDQLE----------
A0A2E1XQ82      ---MDQFSNMF-ENNLSTEI-NSSSVKNISLLTTIFYGESLTSKMIAQLE----------
A0A1V6I2U9      ---LEK----M-LDKLKSNP-EINTYELLAMLSGQ-KSEVFLSSMINSLQ----------
A0A1F3C1M2      ---LKR----I-NEYVNKNS-NLNILDLIAILSGT-KSEGLIVSILNKLQ----------
A0A1F3DS87      ---LKR----I-NEYVNKNS-NLNILDLIAILSGT-KSEGLIVSILNKLQ----------
A0A2H0B957      ---LKQ----I-LDEISKTP-NINAYNLISLLP-L-KDNNILLSLLNQIQ----------
A0A1F3CFW6      ---LKQ----I-LDEISKTP-NIKVYDLISLLP-S-KNDGILISLLNQMQ----------
A0A2M7E2T8      ---LKQ----I-LDEISKTP-NIKVYDLISLLP-S-KNDGILISLLNQMQ----------
A0A2M7NC69      ---LKQ----I-LDEISKTP-NIKVYDLISLLP-S-KNDGILISLLNQMQ----------
A0A1F3K695      ---LKR----I-QEQINSK-ANLNIFELIALLSGT-KSGNVIEGILNTLQ----------
A0A353KZR1      ---LKR----I-QEQINSK-ANLNIFELIALLSGT-KSGNVIEGILNTLQ----------
A0A2N2WYB5      ---LQR----I-STQVNVD-NELNIYELIALLSGT-KSEAILVSVLNNLQ----------
A0A1F3K4G0      ---LQR----I-NQQVAND-HDLNIYELIATLSGT-KSETIVVNVLNNLQ----------
A0A356H8Y3      ---LQR----I-NQQVAND-HDLNIYELIATLSGT-KSETIVVNVLNNLQ----------
A0A351HSA6      ---LQR----I-NQQVAND-HDLNIYELIATLSGT-KSETIVVNVLNNLQ----------
A0A1F3Q014      ---LNK----I-ETTLSNS-KNIDTYTLIAMLAGT-TTESNITSAVEALH----------
A0A2A4YXP3      ---LKE----V-KKSISLNNDDIDVYDLLPILAGT-DYAGGIMSLITSLK----------
A0A2D5KD44      ---LEE----I-KKQIKEGGEQIDIYEFLPILVGS-QFESSISSLIEQLN----------
A0A1F3R158      ---LEE----I-NNSVKGKIKDINVYNLLPILSGT-EYEIRITTLITDLQ----------
A0A2M8ADX2      ---LEE----I-NNSVKGKIKEINVYNLLPILAGT-EYEIRITSLITDLQ----------
A0A1J5B2H0      ---LNE----V-EITFNAS-ENVDIYKLIATIAGS-EFQGIISSLLNNLQ----------
A0A1V5N756      ---LKR----V-EEFVNQS-KDLDVYELYALVAGS-QFQSSVSGNLQAIQ----------
                                                                            

A0A1I3J6V0      GM--VEQIDEIEGDGTA---GSAAV-----------------------------------
A0A1H4ADG3      KL--LLQKERVLLSATP---DHPVV----------------KNLDNQI------------
A0A3D5KRY6      GL--YSNREVLSYTVQE---KNPVL----------------VSLNNEI------------
A0A1V5IPN7      NTQATIARLRTNENYSE---NHPQM----------------KLLQEEL------------
A0A1V3WH52      ----TFKEAEISKLYTK---RHPAY-----------------------------------
A0A2K8Z965      TL--EQQRDQMARTTSE---QHPML----------------ETINSQI------------
A0A418M8U8      QL--DLQRSQLARTTSD---QNPLL----------------QTIDTQI------------
I2GTA4          QL--DLQRSQLVRTTSE---QNPLI----------------QTIDTQI------------
A0A2K8ZAJ2      EL--ELKREDLLKTTSS---GSPLI----------------ESLDSQL------------
A0A368JPA3      EL--ETQRTVLLRNSPE---PSAVL----------------RSLDDQI------------
A0A3P1BT12      DL--EQQRSLLVRNSSD---SNPVL----------------RSLDDQI------------
A0A3P1CI15      DL--EVQRNLLARNSSE---SSPLL----------------RSLDDQI------------
A0A1Q3PII2      DM--LLSRVKALSQLSP---GHPDF----------------ILLEEQI------------
A0A351BXT2      SKIAELESQRDVEASIP---NDEKLREKTLAEYNRKIAPLRETLEEKI------------
A0A3D0MYJ7      NEIASLEVKRDIELSTV---ENPQVYAKVESDYNKKISTLKSQYDKYY------------
A0A3D3LS70      KTIANVEAERDMELTIP---KDPKLIEKVKNEYDAKITALKKSLDEKV------------
A0A1G7ZF38      ET--QLALTRALASLAP---GHPEV----------------QSMEKQI------------
C6VS52          EM--QLNRVKALTTLAP---NHPAV----------------TTLDSQI------------
A0A1G1TM36      SL--QLQRETLLTTTPA---GNPLF----------------KPLDSEI------------
A0A1V3WH27      EL--TFREAEISQLFKK---SHPTY----------------RALHEKR------------
A0A0D3L8Q3      EL--QLERQRLLLTNKP---NNPLV----------------MNLSEQL------------
A0A0K8QSK7      TL--TLEKSRLGNVRVS-----PRL----------------NQINAQI------------
A0A1V6CN82      QL--TVEKSKMSDVLIS-----PRL----------------TQLNDQL------------
A0A1M4XZ45      EL--ITEKSSQTSIRKGS--EHPTI----------------LRLNAQI------------
A0A399D319      EL--ITEKSSQTSIKRGS--QHPII----------------LQLNAQI------------
A0A0P7X1V8      TL--LLSRNPQLRNTPD----DPSL----------------IEINQQI------------
A0A3B0C2S4      EM--AIEREKLISTVGD---NHPTL----------------VTLSGQL------------
A0A416GA42      KM--RLQCDKMESTTAV---ENPVV----------------QDLQQAM------------
A0A3N2M1H3      TI--LLARNNLVSNSSE---RNPLV----------------EDYDSQL------------
A0A1T3IYP5      TT--LLKRNRLAEGGNN---LNPVV----------------LDLDDAL------------
A0A212K7W5      TL--LLKRNTLLANSSD---NNPLV----------------LDIKQSL------------
F5IU11          TL--LLKRNTLQANSSD---NNPLV----------------LDMKQSL------------
A0A352Z1R7      EL--EIQKRTLLTDYTE---NHPAV----------------RTIQGQI------------
A0A0A2F501      QK--MLERNSLRANSSD---ENPIV----------------QDLTTQI------------
R5B7P0          SK--ILQRNNLVANSGE---ENVLV----------------KDLDQAL------------
R5B0L5          DA--MLERNQLAANSSH---THPMV----------------VDMDNRL------------
A0A374THP7      KS--QLERNNLVANSSE---QNPLV----------------ADYDQSL------------
A0A3R5XWG1      KT--LLERNNIVANSSE---QNPLV----------------ADYDQNL------------
A0A414YFM3      KT--LLERNNIVANSSE---QNPLV----------------ADYDQNL------------
A0A0A2EVS5      ET--LLQLNRLLSNSSE---KNPLV----------------IDMDRTL------------
A0A1T4NAJ7      ET--LLQLNRLLSNSSE---KNPLV----------------IDMDRTL------------
A0A2V1IJY1      NL--VLQRNSLLAKSSD---KNPLV----------------VQLNEQM------------
A0A3N2KCL3      NL--VLQRNSLLAKSSD---KNPLV----------------VQLNEQM------------
A0A255T941      NM--VLDRNRLISNSSE---ANPLV----------------QDLTSSL------------
A0A1Y4CHN5      TA--QLQRNNLVANSSD---ENPLV----------------KDMDNAL------------
A0A1Y3V692      TM--VLDRNRLIANSSE---KNPLA----------------KDMANSL------------
A0A174TYU6      TM--VLDRNRLIANSSE---KNPLA----------------KDMANSL------------
A0A1M6I2S6      TM--VLDRNRLIANSSE---KNPLA----------------KDMANSL------------
F3PXM2          AQ--VLERNRLAANSSE---KNPLV----------------VDLTASL------------
A0A3E4ZNL4      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A174AHH7      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A174JCE8      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A3E4JMC4      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A412SND6      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A414IEQ9      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A415UKN5      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A0M1W8D8      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A3R6GKX5      KI--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A7V4S1          KI--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
B0NU19          KI--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
D4V601          KI--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A397WLT5      KI--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A3R6GM96      KI--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A015XH67      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A078RZN2      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A6L0K5          KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A7ACT5          KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A6KY94          KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A173UQR8      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A3R6HK75      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A412B7D1      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A412VNY9      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A414LTU9      KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
I9Q4U4          KM--VLDRNRLIANSSE---KNPLV----------------KDLGNSM------------
A0A373ISF0      NM--VLNRNRLIDNSSE---KNPLV----------------KDLASSL------------
U6RF62          NM--VLNRNRLIANSSE---KNPLV----------------KDLANSL------------
A0A073I794      TM--VLDRNRLIANSSE---KNPLV----------------KDMANSL------------
A0A108TH71      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
I8VXH0          NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A412S0N6      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A412IIJ0      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A0P0FM97      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
R6KTP3          NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A139LU87      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A1C6B3Y5      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
E2NMQ4          NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A412YDB9      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
R7DY01          NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A414LGK8      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A016E4F9      TM--VLDRNRLIANSSE---KNPLA----------------KDMANSL------------
A0A413PP50      TM--VLDRNRLIANSSE---KNPLA----------------KDMANSL------------
A0A3A5TI83      TI--VLERNRLIANSSE---KNPLA----------------KDMANSL------------
A0A415NEB6      TI--VLERNRLIANSSE---KNPLA----------------KDMANSL------------
A7AJ60          TI--VLERNRLIANSSE---KNPLA----------------KDMANSL------------
A0A015UXN7      TI--VLERNRLIANSSE---KNPLA----------------KDMANSL------------
A0A395YYT3      TI--VLERNRLIANSSE---KNPLA----------------KDMANSL------------
A0A415IPQ4      NL--VLDRNRLIANSSE---KNPLV----------------SNMANSL------------
A0A3E5BRW7      NL--VLDRNRLIANSSE---KNPLV----------------KNMANSL------------
K9DXS6          NL--VLDRNRLIANSSE---KNPLV----------------KNMANSL------------
A0A1M6KFV3      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A1Q6G7L3      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A413H235      NL--VLDRNRLIANSSE---KNPLV----------------KNMASSL------------
A0A1M5B2J8      NQ--LLERNNLVSKSSV---KNPLV----------------VEMDASL------------
A0A255RCT5      NQ--LLERNNLVSKSSD---KNPLV----------------VEMDASL------------
A0A1Y4GLF5      RQ--LLQRNNLVANSST---DNPLV----------------VDMDQAL------------
A0A1H3XSC0      RQ--LLQRNSLVANSST---QNPLV----------------VDMDQAL------------
B3JI46          KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A174UR09      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A6LE40          KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
R6NN15          NL--QLQRNNLVANSSE---QNPLV----------------VDMDESL------------
A0A358R8U0      TK--LLQRNSLVANSST---QNPLV----------------VDMDQAL------------
R6WSB6          TK--LLQRNSLVANSST---QNPLV----------------VDMDQAL------------
A0A401LPX7      TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
A0A3A5Z900      TK--LLERNSLVSHSSA---KNPLV----------------REMDKSL------------
A0A3R6I893      TK--LLERNSLVSHSSA---KNPLV----------------REMDKSL------------
A0A3R6EGW5      TK--LLERNSLVSHSSA---KNPLV----------------REMDKSL------------
A0A285TGL6      TK--LLERNSLVSHSSA---KNPLV----------------REMDKSL------------
A0A3A5RFX4      TK--LLERNSLVSHSSA---KNPLV----------------REMDKSL------------
A0A1Q6IUW9      TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
A0A3R6NPG7      TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
A0A413XDP6      TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
K6AP24          TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
A0A076IQN8      TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
A0A078RYI7      TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
C7XEQ8          TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
D7INX6          TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
K5ZG55          TK--LLERNSLVSHSSV---KNPLV----------------REMDKSL------------
A0A3N2N9B8      DL--LLQRNSLVEKSSE---SNPLV----------------ISMDGQL------------
A0A3N2NMI0      EM--LLQRNALVEKSSD---TNPLV----------------VTIDQQL------------
A0A359I8H7      NL--LLTRNTLAASSSD---TNPLV----------------VDYDGQI------------
A0A3N2KA63      NL--LLTRNTLAASSSD---TNPLV----------------VDYDGQI------------
A0A3B9FAU3      TL--LLQRNSLIANSSE---RNPIV----------------SDYDEQL------------
A0A3C1E5L7      TL--LLQRNSLIANSSE---RNPIV----------------SDYDEQL------------
A0A354SN68      AQ--ILQRNNIVSNSSE---SNPLI----------------KDIDTGL------------
A0A0A2DUD9      DL--LLKRNNLVKNSSE---SNPLV----------------VDLDANL------------
A0A3N2N595      DL--ILQRNSLVDKSSD---KNPLV----------------VSIDAQL------------
R5FHS9          KD--LIERNQLLANSSE---ANPLV----------------KDLDQSL------------
A0A3P1ZBJ5      GN--ILQRNRLIMNSSE---KSPTV----------------IELEARI------------
A0A413TW79      KQ--QLERNNLVANSSE---QNPLV----------------ADYDQSL------------
A0A3E5E9M7      KQ--QLERNNLVANSSE---QNPLV----------------ADYDQSL------------
A0A3E4SK73      KQ--QLERNNLVANSSE---QNPLV----------------ADYDQSL------------
A0A415GGC6      KQ--QLERNNLVANSSE---QNPLV----------------ADYDQSL------------
A0A413DBH9      KQ--QLERNNLVANSSE---QNPLV----------------ADYDQSL------------
G9S1S8          NK--LLQRNSLVANSSD---QNPLV----------------IDLDHAL------------
A0A354M4S6      NK--LLQRNSLVANSSD---QNPLV----------------IDLDHAL------------
R7DH52          NK--LLQRNSLVANSSD---QNPLV----------------IDLDHAL------------
A0A396N3D5      NK--LLQRNSLVANSSD---QNPLV----------------IDLDHAL------------
A0A415ZDP9      NK--LLQRNSLVANSSD---QNPLV----------------IDLDHAL------------
A0A016CWA4      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A1C6H117      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A415TAH7      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A0M1W0V2      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A139KA16      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A174VQ92      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A1Q6HCG0      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A1Y4JYM9      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A5QW67      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A5RQE6      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A6BP07      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3E5E153      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3Q9IP20      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A412WV15      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A413ICP6      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A414KYB9      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A416X133      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
E5WX00          KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
K0X3P3          KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A5Z014      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
A0A1M4YZ07      KQ--LLQRNSLVANSSA---ENPLV----------------MDMDQAL------------
A0A078S3Q8      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
A0A069SJV7      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
A0A3E5DXI5      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
A0A3E5EM98      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
A0A3E5F453      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
I9T3G6          KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
A0A0P0FQW1      KQ--LLQRNSLVANSSA---ENPLV----------------VDMDQAL------------
C3RFN5          KQ--LLQRNSLVANSSA---ENPLV----------------MDMDQAL------------
A0A3E4SYU0      KQ--LLQRNSLVANSSA---ENPLV----------------MDMDQAL------------
A6LGY1          KQ--LLQRNSLVANSSA---ENPLV----------------MDMDQAL------------
K5ZSH4          KQ--LLQRNSLVANSSA---ENPLV----------------MDMDQAL------------
A0A078T2W6      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3R6D1V4      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3R6EAF7      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A412MJT7      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3E4WKT5      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A5YY33      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A078TAH2      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A1E9CFZ7      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A373FYU5      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A5TZ72      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A5XBP2      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3A6MEG9      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3E4JP35      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3E4KP40      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3E4NX82      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A3E4XFU8      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A412RG70      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A412TD37      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A413GAA4      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A414M7I4      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
E5UZA2          KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A069SMG6      KQ--LLQRNSLVANSST---ENPLV----------------VDMDQAL------------
A0A1Y4PQK7      TL--QLQRNNLVANSSE---QNPLV----------------MDIDQSL------------
A0A1Y3ZDB3      TL--QLQRNNLVANSSE---QNPLV----------------MDLDQSL------------
A0A3A6AAP4      TL--QLQRNNLVANSSE---QNPLV----------------MDLDQSL------------
A0A1Y4IH41      TL--QLQRNNLVANSSE---QNPLV----------------MDLDQSL------------
A0A1Y4DYA7      TL--QLQRNNLVANSSV---NNPLV----------------ADMDQSL------------
A0A1Y3X4I9      AL--QLQRNNLVANSSE---SNPLV----------------VDLDQSL------------
A0A1Y4FNK8      TA--QLRRNDLVANSSE---KNPLV----------------IDMDQSL------------
A0A355FD59      TL--QLQRNNLLANSSE---QNPLI----------------KDLDQSL------------
A0A359CEZ9      TL--QLQRNNLLANSSE---QNPLI----------------KDLDQSL------------
A0A353Q7B4      TL--QLQRNNLLANSSE---QNPLI----------------KDLDQSL------------
A0A1M3KVR9      TI--QLQRNNLVSNSSE---QNPLV----------------VDLDQSL------------
F8X3A5          TI--QLQRNNLVSNSSE---QNPLV----------------VDLDQSL------------
A0A3C1ITV0      KR--LLERQRLVANSSD---SNPLV----------------SDINNQL------------
R7HN19          KK--LLERQRLVANSSD---SNPLV----------------SDINNQL------------
A0A415EEZ4      EN--MLLRKKLIRISSD---RNPTV----------------GTLSNEL------------
A0A060RD97      EL--RLKLDKMLESSGE---NNPLV----------------VDGRTQL------------
A0A350IHV0      QM--VLTRDRYMSDSSS---DNPLV----------------GDLNNSI------------
A0A077ENE7      KA--LLKRNRLAEGGNS---SNPVV----------------LDLDDAL------------
T0NN57          MA--LLKRNRLAEGGNT---SNPVV----------------MDLDEAL------------
X5K347          MA--LLKRNRLAEGGNT---SNPVV----------------MDLDEAL------------
A0A1T5K9D4      DL--VIKRDRLEKASSS---VSPAV----------------MQIEDAM------------
R5RVP0          SL--VLNRDRFANESSD---NNPLV----------------SDLNTSI------------
A0A285T4L1      AL--KLKRDKLIADSSE---SNPVV----------------EELNNAI------------
A0A3E5BU42      AL--KLKRDKLIADSSE---SNPVV----------------EELNNAI------------
A0A414ZBF2      TT--LTKKNKLMANSSA---NNPIV----------------REMNASL------------
R5KD55          AL--QLERNSLMANGGK---NNPLV----------------KDIDKAL------------
A0A174QNT3      EM--MLQRNRLVSNSGE---SNPVV----------------QNMNKNL------------
R9I0H0          EM--MLQRNRLVTNSGE---NNPVV----------------QNMNRNL------------
K5BUT9          EL--MLQRNRLKESSGE---KNPVV----------------QAADKNL------------
A0A174FPA3      EL--MLQRNRLKESSGE---KNPVV----------------QAADKNL------------
R6S9Y6          EL--MLQRNRLKESSGE---KNPVV----------------QAADKNL------------
C9KX15          EL--MLQRNRLKESSGE---KNPVV----------------QAADKNL------------
A0A3L8AAP1      EL--MLQRNHLLAESGA---KNPVV----------------QTADKNL------------
R6DAG6          EL--MLQRNHLLAESGA---KNPVV----------------QTADKNL------------
A0A1G8BVM8      ET--MTLRNKLLANSTS---NNPII----------------NDLQTSL------------
A0A416GGJ1      EL--KLRRDKLIDDSSD---KNPVV----------------EEMNNSL------------
A0A3D1NQW3      TE--LQRYMKLNSESSE---NNPII----------------QNLGNGL------------
B0MT10          TE--LQRYMKLNSESSE---NNPII----------------QNLGNGL------------
R7JGW9          TE--LQRYMKLNSESSE---NNPII----------------QNLGNGL------------
A0A0E2M2Y7      DL--KLKYDRLKQSSSE---SNPLV----------------QEMAMQL------------
A0A0K2J6Z0      DL--KLKYDRLKQSSSE---SNPLV----------------QEMAMQL------------
B2RKZ8          DL--KLKYDRLKQSSSE---SNPLV----------------QEMAMQL------------
A0A212GC82      DL--KLKYDRLKQSSSE---SNPLV----------------QEMAMQL------------
A0A254MU12      DL--KLKYDRLKQSSSE---SNPLV----------------QEMAMQL------------
R6CQ93          SL--KLKRDKLIADSSE---NNPVV----------------KELDNSI------------
A0A3D2BF46      EL--MLRRDKLAGNASS---NSPVI----------------QDFDSEL------------
A0A358R538      EA--ILTRSRLLANGSE---QNPVI----------------GEMDREL------------
A0A1Y4AAB8      EG--ILRREKLSENSSA---NNPVM----------------QELDNNL------------
A0A1Y3WWY9      TS--ILQREKLLENSSE---NSPVI----------------RDLDNLL------------
A0A1Y4U5L4      TA--ILQREKLLENSSE---NSPVI----------------RDLDNLL------------
A0A1Y3VCJ1      AT--ILQREKLLDNSSP---NNPVI----------------RNLDNLL------------
A0A1Y3QTW7      DA--ILRRQKLLENSSE---RSPVI----------------QDMDNVL------------
R6XWY7          DA--ILRRQKLLENSSE---RSPVI----------------QDMDNVL------------
A0A174AVF1      DA--ILRRQKLLENSSE---RSPVI----------------QDMDNVL------------
A0A373HTL7      DA--ILRRQKLLENSSE---RSPVI----------------QDMDNVL------------
A0A1Q6EIY0      EA--ILRREKLLENSSE---RSPVI----------------QDLDNGL------------
E4M8L3          EA--ILRREKLLENSSE---RSPVI----------------QDLDNGL------------
I3YQ50          EA--ILRREKLLENSSE---RSPVI----------------QDLDNGL------------
R5UEY8          EA--ILRREKLLENSSE---RSPVI----------------QDLDNGL------------
A0A1H4D866      NA--ILRREKLMENSSD---RSPVI----------------QDLDNLL------------
A0A374A9J5      SA--ILRREKLLENSSE---RSPVI----------------QDLDNLL------------
A0A1Q6E9S3      SA--ILRREKLLENSSE---RSPVI----------------QDLDNLL------------
D4IJ36          SA--ILRREKLLENSSE---RSPVI----------------QDLDNLL------------
A0A414Q925      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A415PUS9      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A108TCU0      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A413BA42      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
S3Y344          TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A413MY74      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A412TGL3      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A413VJ33      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A414L0W6      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A412DP39      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A413ZSE8      TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
B0NP84          TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
R6AK43          TV--LTRRNKLIANSSA---NNPLV----------------RDLNGTL------------
A0A412N2D9      TV--LTRRNKLIANSSE---GNPLV----------------RDLNGTL------------
R6LHA4          TV--LTRRNKLIANSSE---GNPLV----------------RDLNGTL------------
A0A1Q6FL18      TV--LTRRNKLIANSSE---GNPLV----------------RDLNGTL------------
A0A1Y4JYS9      TV--LTRRNKLIANSSE---GNPLV----------------RDLNGTL------------
A0A3E5HPT8      ET--LLRRNRLVSGSSS---NNPVV----------------QELNRIM------------
C6IJ48          ET--LLRRNRLVSGSSS---NNPVV----------------QELNRIM------------
Q8A3U2          ET--LLRRNRLVSGSSS---NNPVV----------------QELNRIM------------
A0A3R6S1H6      EM--LLKRNKLQENSSE---KNPII----------------QELNGSL------------
A0A3R6SD81      EM--LLKRNKLQENSSE---KNPII----------------QELNGSL------------
A0A413VXJ7      EM--LLKRDKLVSGSSS---KNPIV----------------IDLNNSL------------
I9RSN9          EM--LLKRDKLVSGSSS---KNPIV----------------IDLNNSL------------
U6RJK5          EM--LLKRDKLVSGSSS---KNPIV----------------IDLNNSL------------
A0A1Q6GA32      EM--LLKRDKLVSGSSS---KNPIV----------------IDLNNSL------------
I9RPU6          DI--LLKRDKLVVGSSS---KNPIV----------------IDLNNSL------------
I8Y597          DM--LLKRDKLVAGSSN---KNPIV----------------IDLNNSL------------
I8YFS5          DM--LLKRDKLVSGSSN---KNPIV----------------IDLNNSL------------
A0A1Q6GBF5      DI--LLKRDKLVAGSSS---KNPIV----------------MDLNNSL------------
I8YFZ3          DI--LLKRDKLVVGSSS---KNPIV----------------MDLNNSL------------
A0A1Q6GDH2      DI--LLKRDKLVVGSSS---KNPIV----------------IDLNNSL------------
U6RSB0          DI--LLKRDKLVVGSSS---KNPIV----------------IDLNNSL------------
I9SIK1          DV--LLKRDKLVVGSSS---KNPIV----------------MDLNNSL------------
I9GXM2          DI--LLKRDKLVVGSSS---KNPIV----------------MDLNNSL------------
I9TP59          DI--LLKRDKLVVGSSS---KNPIV----------------MDLNNSL------------
A0A0J6CIR2      NL--LLKRDKLIGNSSN---KNPVV----------------MDLNNSL------------
A0A3D8HG59      AL--LLKRDRLVSSSSN---RNPVV----------------MSLNSSI------------
A0A3R6S408      AL--LLKRDRLVSSSSN---RNPVV----------------MSLNSSI------------
A0A354WXN6      TM--LLKRDKLISNSSS---KNPVI----------------QDLNNSL------------
R5IP14          QL--LLKRDRLMSNSSD---RNPMV----------------IDLNQTL------------
A0A316SZX7      TL--LLNRDRLIANSGN---NSPVV----------------QDLNSSL------------
A0A1Y4AIY1      EM--LLKRDNLIRNSSN---KNPVV----------------MDLNNSL------------
F3ZRU7          TM--LLQRDRLLSNSSD---KNPVV----------------SDLNKSL------------
A0A1C5Q1F3      EL--MLQRDKLIGNSSN---KNPVV----------------MDMNNSL------------
R7A239          EL--MLQRDKLIGNSSN---KNPVV----------------MDMNNSL------------
A0A1M6K7I9      EI--LLKRDKFVTGSSD---RNPVV----------------MDLNNSL------------
A0A3R6HIK7      EM--LLKRDNFIANSSD---KNPVV----------------MDLNNSL------------
K5ZVW7          EM--LLKRDNFIANSSD---KNPVV----------------MDLNNSL------------
A0A1Y4D5Z0      TQ--LLKRDRLISNSSN---KNPVV----------------MDLNNSL------------
R5S343          EL--LLKRDRLIENSSD---NNPVV----------------ADMNRSL------------
A0A3R5ZMK1      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A3E4ZTK7      EM--LLKRDKLISNSSN---KNPVV----------------QDLNNSL------------
A0A1Y3ZIA4      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
K5Y1A4          EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A3R6K8X4      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A1Q6I3T6      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A414XX40      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A412DM15      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A7AEU7          EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A415BDM7      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A3R5ZYK4      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A414GI87      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A3R6BKI7      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A414LPI6      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
A0A412M2W1      EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
K5ZX55          EM--LLKRDKLISNSSS---KNPVV----------------QDLNNSL------------
K5ZBN2          TL--LLKRDKLIGNSSN---RNPVV----------------MDLNNSL------------
A0A0J6CKW3      TL--LLKRDKLIGNSSN---RNPVV----------------MDLNNSL------------
A0A0F5IQM7      TL--LLKRDKLIGNSSN---RNPVV----------------MDLNNSL------------
S0GLB0          TL--LLKRDKLIGNSSN---RNPVV----------------MDLNNSL------------
A0A3R6NLC1      AL--LLKRDKLIGNSSN---KNPVV----------------MDLNNSL------------
A0A416WYC9      AL--LLKRDKLIGNSSN---KNPVV----------------MDLNNSL------------
A0A0F5IT40      NL--LLKRDKLIGNSSN---KNPVV----------------MDLNNSL------------
S0GSI7          NL--LLKRDKLIGNSSN---KNPVV----------------MDLNNSL------------
K5YB65          NL--LLKRDKLIGNSSN---KNPVV----------------MDLNNSL------------
A0A0F5IWP9      NL--LLKRDKLISNSSN---KNPVV----------------MDLNNSL------------
A0A0F5IZT8      NL--LLKRDKLISNSSN---KNPVV----------------MDLNNSL------------
A0A417LKQ2      NL--LLKRDKLISNSSN---KNPVV----------------MDLNNSL------------
A0A416TME1      NL--LLKRDKLISNSSN---KNPVV----------------MDLNNSL------------
A0A416XPE8      NL--LLKRDKLISNSSN---KNPVV----------------MDLNNSL------------
L8JI02          KL--NQERAGLNYNAKE---QNPVT----------------EVVDRRI------------
A6EBM4          SL--LHEKEELLKVYNG---DAQAV----------------MRLNRQI------------
A0A2N3U785      EL--QLERQGLLRTMQP---NNPLV----------------VNLNDQL------------
A0A0E3ZG78      EL--QLDRERMLRTAQP---KSPII----------------KNLNEQL------------
A0A1I6BRK6      EV--ELERQRMLRTMQP---TSVLI----------------QNTNEQL------------
A0A243WAB1      EL--QLERERTLRTTQP---SSLLV----------------QNLNEQL------------
A0A399SH26      DN--EIQYQRLRKTTAV---NNPIL----------------LSIADEI------------
A0A0E3ZGV6      NS--EIQYQQLSKTTAE---NNPLL----------------VSLREEI------------
A0A1I2N4S1      EA--EIQYQQLKKTTAE---NNPLL----------------ISLREEI------------
A0A2T5YE44      NA--EIQYQQLKKTTAE---NNPLL----------------ASLREEI------------
A0A1M4YED3      AN--QIKLRQTMGENSPQ--VVATQ----------------NEIDRLR------------
A0A3P1Z8V4      RL--VLTRNRYAVNSND---DTPAV----------------RDLDRQL------------
A0A2L2WX98      NQ--MLERNRIAGNTSE---TSPTI----------------REIDNRL------------
G5GD56          QL--MNERNKNAANSSG---QSPLV----------------RDLDKQL------------
R6A0L2          DQ--MNKRNTMVANSSE---NQAVV----------------REMDRQL------------
R7LG80          QL--QMQRNQMANNSSD---DHAVV----------------RELDKQL------------
A0A1M6XHU0      VQ--AEQYYVFNPKLRGNE-EKLGD----------------QQLVEIV---RQIDHFEKQ
D0MHQ9          VQ--AEQYYVFNPKLRGNE-EKLGD----------------QQLVEIV---RQIDHFEKQ
G2SF81          VQ--AEQYYVFNPKLRGNE-EKLGD----------------QQLVEIV---RQIDHFEKQ
A0A2H3NSN0      AQ--AEPYYINNPDLRGNE-DQV------------------RELSQIK---RQIEGLEDR
A0A2P6C324      AR--AEQYYINDPTLRGDE-SRV------------------RELAEIK---RRIDGFEDR
A0A126PFG0      AQ--RERLLTTTPE------NNPLF----------------NPLNSEI------------
A0A3M1N7Z3      EQ--RLRLLKVYQP------TSPIV----------------SAHNQLI------------
R7PCR1          -----NDILIEKKNLEQNSTNSPVI----------------RDMNEAL------------
A0A2A8CVM9      AE--AAQYYVANDGLEGD--TDRIE----------------TEFPQLADLLERINGLEKR
A0A3C0ZQC7      VR--RDVTVAQNPTYVG---QDIYT----------------QKLKEID---VQINALREK
A0A2E3R1D0      AE--LEVFYRQNPALRN---DTNPP----------------ANIARLR---TELARVEAD
A0A2T2USC0      SE--INAVRRNNPNLEPGD-SSPKA----------------REFARLE---EKSRQLSRE
A0A2T2V0F3      AE--INAVKRNNPDLDPGG-TSPKA----------------REFARLK---ERARQLDRE
A0A2T2S682      AE--INRVKTRNPNLDADA-STARA----------------KNLRQLQ---RRADRLERQ
D5H561          LS--KQQLELQS----GAP-TPADS----------------AQAAQID---RRIQKLRAR
A0A2H3NWA9      QQ--LDQALERNSNLSPNPNGNALE----------------RELARTQ---ERIDRLDTQ
A0A2A8CVB6      AR--IDQIERENPNLGA---GGTLQ----------------RDLRRMK---ERVSRLQER
A0A2P6C1S6      SK--IDRVERNNPDLEP---TSQLG----------------RELQRMK---TRAQTLARR
A0A2T2UTM4      VK--IDRVERRNPDLDP---TSRLG----------------QELQRMK---ARAATLDRK
A0A1T5MMH4      SL--LLQQERLKLSYNE---NTLAY----------------REKQQEI------------
A0A2W4R1L8      EL--QMSFDRLKLSYSE---VTFAF----------------REREQQI------------
A0A2E5CV79      QL--ESQSIQNAMIYGE---NHSAV----------------IEIQKRV------------
A0A2A4G4B1      QL--ILEKNQLLESASE---NHPTI----------------LTMNERL------------
A0A2D4ZVH1      YA--LAELETNKLLYLT---KNPGI----------------SENNPEI------------
A0A0E3V905      QL--EQQRDHLLHTTSE---LNPLL----------------ETVDSQI------------
A0A1M6GR99      TA--QTQKDNLIQNNQQ---RNPIV----------------NRLDIQI------------
A0A1M5BA90      DS--QMQYERLKKTIPG---GNPAM----------------FSLEAEI------------
A0A1V9F098      NG--KLEYEKLMKSTGE---NNPFA----------------TAIAKEI------------
A0A1V9FHD0      TA--KVEYGKLMKTTGE---NNPAA----------------IELAKVI------------
A0A1T5CS78      NL--EVDYERLKKTTGE---NNPIL----------------TSISNQI------------
A0A0Q9Z8F1      NL--EVEYERLKRTTAE---NNPVL----------------TSISNQI------------
A0A2N0U0M7      NL--EVEYERLKKTTAE---NNPVL----------------TSISNQI------------
A0A1M6TTV4      KL--KNERMLKLESYNE---NTQVI----------------QRLNQRL------------
A0A1Q6IT42      KL--LLERMRLLRTAKD---SNLAL----------------RTLTAQI------------
K0X1U5          KL--LLERMRLLRTAKD---SNLAL----------------RTLTAQI------------
A0A416XAH0      KL--LLERMRLLRTAKD---SNLAL----------------RTLTAQI------------
R5EXK3          KL--LLERMRLLRTAKD---SNLAL----------------RTLTAQI------------
A0A401UAP7      KK--REAINELKLSYKE---STFAY----------------QELQRDI------------
A0A1W2GF52      DL--VNDRALKLNSYNE---NTQVI----------------KRLDQQI------------
A0A2G5L7B8      EL--KNERLLKLDTYNE---NTQII----------------KQLNSRI------------
A0A0D3LFR6      KL--ISEKEVLLEHYNE---NTQAA----------------QMKIKQV------------
M7N6D4          TL--TSEKEILLASQNE---NTQAV----------------QLRNKKI------------
A0A364XUP5      EL--FLTQEKLKLSYNE---TTFAY----------------RELEKEI------------
A0A1M5RLA9      DL--YRDQEKLKLSYNE---ATFAY----------------RQRQKDI------------
A0A385SFR9      DL--YRDQEKLKLSYKE---VTFAY----------------RQRQKDI------------
L8JW09          VQ--ISERDKLRLSYNE---TTFAL----------------TRKEEEI------------
A0A1Q3ZMZ7      EM--ITDRDILLNKVQK---SNPEI----------------TIKEKQI------------
A0A2D8JJW3      DL--INAKEIYEQEIGK------------------------NDIPKSY------------
A0A2W2AFF7      GV--QLERERMLMSTTE---ENPMV----------------RNMDQQS------------
A0A2N5YXE2      EL--LNKKEILLFDVTA---NNHKI----------------VTIDEQI------------
A0A2I0QZ80      EL--IERKEDLSYKVTQ---NNDII----------------QKLEKRI------------
A0A2U2XBJ3      NL--IEEKEDLLYQVTP---QNENI----------------KKLEMRI------------
A0A3E1F1A3      EL--IEEKEDLLFQVTP---QNEKI----------------SKLEGRI------------
A0A1V9F383      NK--KVEYETLLKTTAE---NNPYA----------------VGVAKEI------------
G8TRZ6          SK--RVEYESLLKTTTV---NNPAA----------------TSAAKEI------------
A0A2W1NDY9      RL--LEDQEDASYRMTM---ENDGL----------------KNLESNI------------
A0A1G0CI31      AL--LQRKEDLLFDVTE---NNTEI----------------KNINIQI------------
F2IKD6          TL--LERKEELLTNVTE---NNSEL----------------KNLNTRI------------
A0A1I7BM74      SK--LEQRENLLYTVTE---ESRTI----------------TQLDKKI------------
A0A2G2FJ17      EL--LETKEDLLYKVTP---ENDMI----------------KKIETRV------------
A0A416X8R7      EI--LLQRERLAANSGE---NNPLV----------------KDLDNNL------------
K0XJ09          EI--LLQRERLAANSGE---NNPLV----------------KDLDNNL------------
R5EUZ0          EI--LLQRERLAANSGE---NNPLV----------------KDLDNNL------------
W0EQS0          AM--ILQRERLVANSGE---SNPLV----------------RDLDSNL------------
A0A1Y3WE15      EM--LLQRERLAANSGE---NNPLV----------------RDLDNNL------------
A0A1Y4GUK3      EM--LLQRERLAANSGE---NNPLV----------------RDLDKNL------------
A0A2U1FKU2      EL--KLRYDRLKQSSSE---NSPAV----------------QEAAMQL------------
A0A0A2F954      EL--KLKYERLKQSSSE---NSPAV----------------QEVGMQL------------
A0A0A2FW91      DL--KLKYDRLKQSSSE---SNPLV----------------QEMAMQL------------
A0A2D2N2N1      EL--KLKYDRLKQSSSE---NSPAV----------------QEVGMQL------------
Q7MWZ2          EL--KLKYDRLKQSSSE---NSPAV----------------QEVGMQL------------
T2NDT6          EL--KLKYDRLKQSSSE---NSPAV----------------QEVGMQL------------
W1R7P9          EL--KLKYDRLKQSSSE---NSPAV----------------QEVGMQL------------
A0A1R4AFZ0      EL--KLKYDRLKQSSSE---NSPAV----------------QEVGMQL------------
A0A1R4DVZ7      EL--KLKYDRLKQSSSE---NSPAV----------------QEVGMQL------------
A0A1G9E2A9      TK--RIEQSTLLVSTKP---TTQAY----------------QFGVTEI------------
A0A2T2YJE8      DL--QLDRNLMVQSYKT---TTKAY----------------QLLEEEI------------
A0A3M9N829      QL--QARSRTARMTSRG---NTAAD----------------NLREEQL------------
A0A0P0CSF9      DL--QAQQRTRRLTSRG---NTLAD----------------NSLEERL------------
A0A3M9MNC3      DL--QAQQRTRKLTSRG---NTLAD----------------NALEERL------------
A0A2M6GH67      SL--QRSYKILLLSYKK---TTQTV----------------KIREEEM------------
A0A127B287      DL--QAQRRKVLTTTRG---NTLSV----------------ELLDQQI------------
A0A369QP10      NL--QLDRSLMMQSYKT---TTKAY----------------QLLEEEI------------
A0A418R9X5      DL--QLDLSQLLKSYQE---TTTAV----------------KLRRAEI------------
A0A428JSJ3      NL--QLDLSQLLKSYQE---TTTAV----------------KLRRSEI------------
A0A428KI59      DL--QLDLSQLLKSYQE---TTTAV----------------KLRRSEI------------
W8F1I6          DL--QLDLSQLLKSYQE---TTTAV----------------KLRRSEI------------
A0A246FQC0      DA--QLDLKRALLSYQPG--ATLAM----------------QTKEQNI------------
A0A372E5P8      DA--QLDLKRALLSYQPG--ATVAM----------------QIKEQSI------------
A0A1H3EMW1      DA--QLDLKRALLSYQPG--ATVAM----------------QIKEQSI------------
A0A1H9ZSN3      DA--QLDLKRALLSYQPG--ATLAM----------------QTKEQSI------------
A0A0M3RW20      LA--QQDLRRVLRSST-E--ATEAV----------------QQRKAAV------------
A0A1S9B3W0      EQ--QREMRKVLQSYQPN--ATTAV----------------RIKEDQL------------
A0A1W1VRL3      DQ--QWDLRRVLRSYK-E--TTEAV----------------KQRRVQL------------
A0A1M6R305      SL--QWNLRRLSRSYK-E--TTEAV----------------QQQREAL------------
A0A2M9B9H9      AL--QWNLRRLLRSYN-E--TTEAV----------------KQQQAQL------------
A0A126PDF2      GM--QWEQERIRRSYTG---ATEAV----------------QQKNAQM------------
A0A2Z3GKA1      GM--QWDQERIRRSYTG---ATEAV----------------QQKNAQM------------
A0A328BL48      EQ--QRELRQVLQSYQP---TTTAV----------------QIRQSQL------------
A0A3S0QKV1      EQ--QRDMRKILESYQPN--ATAAV----------------RIREDQL------------
A0A3R9P8H7      DA--QLDLKRALLSYQPG--ATTAM----------------QTKEQFV------------
A0A212UCJ7      DL--QLQINRVSNSYTP---ETQTI----------------KNLQGQI------------
A0A238WIA7      GL--QLDLNRASVGYKP---TTTAI----------------QVIQDQI------------
A0A0W8EDI5      DQ--QADMNRLLESYKP---TTTAV----------------QIRREQL------------
A0A3B7RBP8      DQ--QADLNRVLESYKS---TTTAV----------------QIKQEQL------------
A0A1I5WSL8      NL--QWNLRRISRSYTD---KTETV----------------QRTKADI------------
A0A0U3JVM7      DL--QWQLRRASRSYTD---KTEAI----------------QSKQANI------------
A0A1G1SSV2      SL--QWRLRRVSRSYNE---STEAV----------------QGIRDDI------------
A0A1G1SXV7      SL--QWRLRRVSRSYNE---STEAI----------------QGIRDDI------------
A0A243WHR7      DL--QWNLRRILRSYQP---TTFTV----------------QQLQADV------------
A0A076HRT9      DL--QWNLRRLLRSYKE---TTEAV----------------QQQREQL------------
A0A1M6DHW8      DL--QRNLRRILRSYTP---ATEAV----------------QQQQSTI------------
A0A3D1KEX9      DA--VIQYTRLSANSSN---SSSVI----------------QDYEKSL------------
A0A358Y7S2      DL--LEKKEELLKDVTL---ENEAI----------------KRIEIKI------------
A0A1X7J248      EL--KEEYQLSKTRYKK---ESQVL----------------LQRKIEI------------
E4TQD2          EL--KRDYQMAKTRYKK---ESQVL----------------LQRNLEI------------
A0A2J6HHN3      DL--EFKRQEYLITMTE---NSTVI----------------ESIDKQI------------
A0A1Y3WMT8      KL--LLERMRLLRTAKD---SNLSL----------------RTLTAQI------------
A0A1Y4GQU1      KL--LLERMRLLRTAKD---SNLSL----------------LTLTAQI------------
A0A1V5W8T5      QL--QKQKEQLLITVTP---DNHKV----------------KVIDQQI------------
A0A2T8HKA9      SA--LLRRNRLLEGNNS---NNPYV----------------QELDQYL------------
A0A3B8INU3      NL--KVELDQLLLSHDP---RTLIV----------------RRTQQSL------------
A0A098LL25      TL--QEERNRLLNSQRE---NTLVV----------------KTKNKSI------------
A0A1Q3Q573      QL--QRSREIKLLERTE---DHPEV----------------RLLDKQI------------
A0A357YNR3      NL--VLERNRLARIASS---SNQSM----------------IDLNYQL------------
F4KK08          EF--LLKRDQLQANSSS---QNPLV----------------QELNTQL------------
A0A3N2N6F7      NL--QLERDQLLSTTGE---NSPLV----------------KDRDNSL------------
A0A419VXB7      EL--NSKKETLSYSVHS---KNPGI----------------QVIDKEL------------
A0A2V1ILM4      QL--QLERDKLSNSTGD---TNPLL----------------QDYDKNL------------
A0A3N2L0E8      QL--QLERDKLSNSTGD---TNPLL----------------QDYDKNL------------
A0A3N2LFC5      QL--QLERDKLSNSTGD---TNPLL----------------QDYDKNL------------
C3J7R8          SL--LLRRDQLIANAET---QNPVV----------------ETLEKQL------------
A0A0B0BTJ4      EL--VLERMRLGTETSD---DNPVI----------------REMNAQI------------
A0A3B9CNN6      EL--VLERMRLGTETSD---DNPVI----------------REMNAQI------------
R5X290          EL--VLERMRLGTETSD---DNPVI----------------REMNAQI------------
A0A1Q6E6I7      EL--VLERMRLGTETSD---DNPVI----------------REMNAQI------------
A0A2G2F510      LL--LERKEDLLYRVTP---ENSEV----------------KLLDRKV------------
A0A316JZ08      DM--LEQKEDLLVSLTP---NNEKV----------------ALVQKRI------------
A0A1I1FXP9      DL--QNQKEMMSYTAKE---GTLAA----------------RLRDKKI------------
A0A3B9FXJ0      EL--EKQKANLMLSLPP---TDPKV----------------KLVTGQI------------
R5GSU5          KL--VLERNRLAPNTGE---NSPVM----------------NDLNQKL------------
A0A2P8EAX2      DL--LRERQRISRIVQP---NNQQL----------------ISLNEQL------------
A0A3N4H5N3      DL--QRDRQRLSRVVQP---NNQQI----------------LSLNEQI------------
A0A2A3UE91      KL--LSEKENLLYAVTP---NSENI----------------KQVNYQL------------
A0A0A2G557      TL--YLYREQLLSESGQ---TNPLI----------------ETQQKQL------------
A0A2N2WFW8      EL--EMKKQDLLVHITE---NSTAV----------------ESVNSQI------------
A0A1F3IU95      DL--EMRKQELLLRVTE---NSTAI----------------ESINAQI------------
A0A3D0VUF6      DL--EMRKQELLLRVTE---NSTAI----------------ESINAQI------------
A0A1T4PT95      TL--YLYRERLLSESGQ---TNPLI----------------ETQQKQL------------
A0A3Q9FR88      KL--ETEALRIKDSYTS---NTIAS----------------NAKLELY------------
A0A150ADJ9      KL--EVQANRIKNSYTE---RTVAS----------------NAKLELY------------
A0A1B1FWQ4      KL--ETEALRIRESYTS---NTVAS----------------NSTLELY------------
A0A1S1Z228      KL--ETEALRIKESYTS---NTVAS----------------NSTLELY------------
A0A1F3SJM1      TL--LEKKEDLLYNVTE---ENEEV----------------VALTKKI------------
A0A2G2EB96      DF--LERKEDLLFEVTE---ANSEI----------------AIINQKI------------
A0A2G6PRA9      EF--LERKEDLLFEVTE---NNSEI----------------EIINQRI------------
A1ZKR2          QL--QENKKILALKATG---SSIVV----------------KDINQKL------------
A0A1Q3GX01      KL--QEEKKLLDLKVNN---SSMVF----------------KDVNKKL------------
A0A349DQI4      KL--QEDKKLLDLRATS---SSMII----------------QNINQQL------------
A0A2N3IIZ0      RL--RQIRQNQELSETS---ATYSY----------------QVLDIKI------------
A0A2A4PYG9      KL--LAKKEEILYTATK---ESEAV----------------KGVNYQI------------
A0A2A5FYT6      QL--LIKKEEMLYSETE---KSEKI----------------KSIDYQI------------
A0A2E6SYP1      QL--LAKRRELSFRVTE---ESYEV----------------KEIDFQI------------
A0A2E5RLE8      NL--LSEKRSLSFRITE---ESYQV----------------KEIDFQI------------
A0A2E7TQF6      NL--LSEKRSLSFRITE---ESYQV----------------KEIDFQI------------
A0A2E6GVY9      KL--LSDKRSLSFRITE---ESYQV----------------KEIDFQI------------
A0A350JJ90      NL--VLTRNRLLGGATM---DNPNI----------------RVYDQQI------------
A0A3M1CDV2      KL--LLEKENLLYQVTP---NSEQI----------------KIINYQI------------
A0A2E2TFD1      EL--QIEKDQSLYEVTQ---SSGRV----------------QNLDYQV------------
A0A2E4ELE6      EL--LLEREQSLYEVTA---DNGRV----------------KNLEYQI------------
A0A2E3XZI5      ED--VLKRDLLLKEVTK---NNKNF----------------IQLNRQI------------
A0A2M7NLQ9      DE--EKEKKFMLDRLTK---QTAAY----------------QQKEKKI------------
I4AFR0          EE--EKEKKFMLDRVTK---QTGAY----------------QQKAKRI------------
A0A2N2Y3E5      SL--IKEKEKAMNNLTT---QSFQI----------------KSIDKQI------------
A0A2D9D7T6      AL--LEKKENLLTGLTP---QNKEI----------------EILDQKI------------
A0A1F3PPL5      QK--NDQKDMLLNDVTN---NNHKI----------------KIVDKQI------------
A0A357QK06      QK--NDQKDMLLNDVTN---NNHKI----------------KIVDKQI------------
A0A2A5B3B0      EL--LFRQENLQYEVTK---NNEVV----------------KSLKHQI------------
A0A0F2NS19      NL--MVQKQNLLSEVTV---NSGSV----------------KSLENQI------------
A0A2A5H8X6      SL--MVQKQNLLSEVTV---NSGSI----------------KSLENQI------------
A0A2H0GAU8      GL--LVQKQNLLGEVTV---SSEAS----------------KSLDRKI------------
A0A2M8FTK1      GL--LVQKQNLLGEVTV---SSEAS----------------KSLDRKI------------
A0A0S2HYK8      NL--INEKNQLLNDVTE---NNMRI----------------KIIDKQI------------
A0A2N5ZWN6      QL--INEKNQLLNDVTE---NNMRI----------------KLIDNQI------------
A0A2E0FJ09      KK--LMLYEDLISERTG---DHEEI----------------KKIRSQI------------
A0A1F3FZ62      SI--LLQKEKMLYEITP---DNRQI----------------NALEYQL------------
A0A1F3K211      SI--LLQKEKMLYEITP---DNRQI----------------NALEYQL------------
A0A1F3KLL5      KL--ENDREQMLSDVTA---NNYKI----------------KVIDKQI------------
A0A359D1M1      KL--ENDREQMLSDVTA---NNYKI----------------KVIDKQI------------
A0A2E7CT70      KN--VIKRDELLRDVTE---SNENV----------------ILLNYQI------------
A0A2D5V560      ED--VNKRDQLLKDITP---NNKNI----------------IILNGEI------------
A0A2D7K5A8      KD--VIQRDELLKDITP---NNKNI----------------ILLNGQI------------
A0A2E1XQ82      ED--VNQRDELLKDITP---NNKNI----------------ILLNGQI------------
A0A1V6I2U9      EL--LNRKEVLLFDLTS---NSHKI----------------QTLDEQI------------
A0A1F3C1M2      DL--INQKEILLNDVTK---NNHQI----------------QVIDKQV------------
A0A1F3DS87      DL--INQKEILLNDVTK---NNHQI----------------QVIDKQV------------
A0A2H0B957      NL--ITQRDAYLNNQTK---NSYQI----------------KVIEKQI------------
A0A1F3CFW6      NL--INQRDLYLNNQTQ---NSFQI----------------KVIEKQI------------
A0A2M7E2T8      NL--INQRDLYLNNQTQ---NSFQI----------------KVIEKQI------------
A0A2M7NC69      NL--INQRDLYLNNQTQ---NSFQI----------------KVIEKQI------------
A0A1F3K695      SL--ITQKEVLLNDVTN---NNHQI----------------KVVDKQI------------
A0A353KZR1      SL--ITQKEVLLNDVTN---NNHQI----------------KVVDKQI------------
A0A2N2WYB5      QL--ISEKEQLLNDVTP---NNLKI----------------KQLDKQI------------
A0A1F3K4G0      EL--INKKEQLLNDITR---DNLKI----------------KLLEKQI------------
A0A356H8Y3      EL--INKKEQLLNDITR---DNLKI----------------KLLEKQI------------
A0A351HSA6      EL--INKKEQLLNDITR---DNLKI----------------KLLEKQI------------
A0A1F3Q014      KL--LIQKEEMLYDVKP---NSEAT----------------RLIDYQI------------
A0A2A4YXP3      EF--LIQKENLQFEVTK---DSEII----------------KSLDHKI------------
A0A2D5KD44      DL--LLKKQELLFTMRE---NSNRI----------------QEIDYQI------------
A0A1F3R158      TL--LLQRQKILNEATK---ESDLI----------------KFHDQQI------------
A0A2M8ADX2      SL--LIQRQKMLTEATK---ESDLI----------------KIQDQQI------------
A0A1J5B2H0      DL--LLKREQLLYEVTL---NSSQI----------------ESINYQI------------
A0A1V5N756      NL--LMQKEELLYNVTA---YNSQI----------------KQINYKL------------
                                                                            

A0A1I3J6V0      ------------------------------------------------------------
A0A1H4ADG3      ---------------------------------------KGLRSDMLSG-----------
A0A3D5KRY6      ---------------------------------------RFTQKSLLEN-----------
A0A1V5IPN7      ---------------------------------------AKTKNTLDTE-----------
A0A1V3WH52      ------------------------------------------------------------
A0A2K8Z965      ---------------------------------------RTAENNMAGN-----------
A0A418M8U8      ---------------------------------------NSLKGNMEDN-----------
I2GTA4          ---------------------------------------NSLKGNMEDN-----------
A0A2K8ZAJ2      ---------------------------------------KNTNAAISEN-----------
A0A368JPA3      ---------------------------------------FATRASIGET-----------
A0A3P1BT12      ---------------------------------------SATKTSINET-----------
A0A3P1CI15      ---------------------------------------ATTRASLAET-----------
A0A1Q3PII2      ---------------------------------------SVLRNSLFDA-----------
A0A351BXT2      ---------------------------------------EVMRSSLFAS-----------
A0A3D0MYJ7      ---------------------------------------EEFVIGITSL-----------
A0A3D3LS70      ---------------------------------------ELLKTGIYAG-----------
A0A1G7ZF38      ---------------------------------------GVLRTSLADA-----------
C6VS52          ---------------------------------------AAARGNLFDA-----------
A0A1G1TM36      ---------------------------------------QTTQLAIRTS-----------
A0A1V3WH27      ---------------------------------------QT-------------------
A0A0D3L8Q3      ---------------------------------------TDLRQNILEN-----------
A0A0K8QSK7      ---------------------------------------EKLKEALMAN-----------
A0A1V6CN82      ---------------------------------------GNVKEAMLEN-----------
A0A1M4XZ45      ---------------------------------------ESVKNSLREN-----------
A0A399D319      ---------------------------------------ESVKNSLREN-----------
A0A0P7X1V8      ---------------------------------------EGLREEIARL-----------
A0A3B0C2S4      ---------------------------------------ENLKVNILRS-----------
A0A416GA42      ---------------------------------------LSLRESILRT-----------
A0A3N2M1H3      ---------------------------------------NGLRESITRS-----------
A0A1T3IYP5      ---------------------------------------SAMRNNISRA-----------
A0A212K7W5      ---------------------------------------LFVREAIISS-----------
F5IU11          ---------------------------------------LFMREAIISS-----------
A0A352Z1R7      ---------------------------------------DEIQKKIRST-----------
A0A0A2F501      ---------------------------------------GAMRSIILSS-----------
R5B7P0          ---------------------------------------ASMRGSISRS-----------
R5B0L5          ---------------------------------------ASMRSTILSS-----------
A0A374THP7      ---------------------------------------GSMRKSITAS-----------
A0A3R5XWG1      ---------------------------------------NAMRRSITAS-----------
A0A414YFM3      ---------------------------------------NAMRRSITAS-----------
A0A0A2EVS5      ---------------------------------------TAMRRSILLS-----------
A0A1T4NAJ7      ---------------------------------------TAMRRSILLS-----------
A0A2V1IJY1      ---------------------------------------DQMRHAILAS-----------
A0A3N2KCL3      ---------------------------------------DQMRHAILAS-----------
A0A255T941      ---------------------------------------QSMQKTIVQS-----------
A0A1Y4CHN5      ---------------------------------------KSMREAIITS-----------
A0A1Y3V692      ---------------------------------------QSMQRTIIQS-----------
A0A174TYU6      ---------------------------------------QSMQRTIIQS-----------
A0A1M6I2S6      ---------------------------------------QSMQRTIIQS-----------
F3PXM2          ---------------------------------------RNLHHTVVQS-----------
A0A3E4ZNL4      ---------------------------------------QSMKRTILQS-----------
A0A174AHH7      ---------------------------------------QSMKRTILQS-----------
A0A174JCE8      ---------------------------------------QSMKRTILQS-----------
A0A3E4JMC4      ---------------------------------------QSMKRTILQS-----------
A0A412SND6      ---------------------------------------QSMKRTILQS-----------
A0A414IEQ9      ---------------------------------------QSMKRTILQS-----------
A0A415UKN5      ---------------------------------------QSMKRTILQS-----------
A0A0M1W8D8      ---------------------------------------QSMKRTILQS-----------
A0A3R6GKX5      ---------------------------------------QSMKRTILQS-----------
A7V4S1          ---------------------------------------QSMKRTILQS-----------
B0NU19          ---------------------------------------QSMKRTILQS-----------
D4V601          ---------------------------------------QSMKRTILQS-----------
A0A397WLT5      ---------------------------------------QSMKRTILQS-----------
A0A3R6GM96      ---------------------------------------QSMKRTILQS-----------
A0A015XH67      ---------------------------------------QSMKRTILQS-----------
A0A078RZN2      ---------------------------------------QSMKRTILQS-----------
A6L0K5          ---------------------------------------QSMKRTILQS-----------
A7ACT5          ---------------------------------------QSMKRTILQS-----------
A6KY94          ---------------------------------------QSMKRTILQS-----------
A0A173UQR8      ---------------------------------------QSMKRTILQS-----------
A0A3R6HK75      ---------------------------------------QSMKRTILQS-----------
A0A412B7D1      ---------------------------------------QSMKRTILQS-----------
A0A412VNY9      ---------------------------------------QSMKRTILQS-----------
A0A414LTU9      ---------------------------------------QSMKRTILQS-----------
I9Q4U4          ---------------------------------------QSMKRTILQS-----------
A0A373ISF0      ---------------------------------------QSMQRTIIQS-----------
U6RF62          ---------------------------------------QSMQRTIIQS-----------
A0A073I794      ---------------------------------------QSMRRTIIQS-----------
A0A108TH71      ---------------------------------------QSMQRTIIQS-----------
I8VXH0          ---------------------------------------QSMQRTIIQS-----------
A0A412S0N6      ---------------------------------------QSMQRTIIQS-----------
A0A412IIJ0      ---------------------------------------QSMQRTIIQS-----------
A0A0P0FM97      ---------------------------------------QSMQRTIIQS-----------
R6KTP3          ---------------------------------------QSMQRTIIQS-----------
A0A139LU87      ---------------------------------------QSMQRTIIQS-----------
A0A1C6B3Y5      ---------------------------------------QSMQRTIIQS-----------
E2NMQ4          ---------------------------------------QSMQRTIIQS-----------
A0A412YDB9      ---------------------------------------QSMQRTIIQS-----------
R7DY01          ---------------------------------------QSMQRTIIQS-----------
A0A414LGK8      ---------------------------------------QSMQRTIIQS-----------
A0A016E4F9      ---------------------------------------QSMQRIIIQS-----------
A0A413PP50      ---------------------------------------QSMQRTIIQS-----------
A0A3A5TI83      ---------------------------------------QSMQRTIIQS-----------
A0A415NEB6      ---------------------------------------QSMQRTIIQS-----------
A7AJ60          ---------------------------------------QSMQRTIIQS-----------
A0A015UXN7      ---------------------------------------QSMQRTIIQS-----------
A0A395YYT3      ---------------------------------------QSMQRTIIQS-----------
A0A415IPQ4      ---------------------------------------QSMQRTIIQS-----------
A0A3E5BRW7      ---------------------------------------QSMQRTIIQS-----------
K9DXS6          ---------------------------------------QSMQRTIIQS-----------
A0A1M6KFV3      ---------------------------------------QSMQRTIIQS-----------
A0A1Q6G7L3      ---------------------------------------QSMQRTIIQS-----------
A0A413H235      ---------------------------------------QSMQRTIIQS-----------
A0A1M5B2J8      ---------------------------------------AAMRKALVSS-----------
A0A255RCT5      ---------------------------------------ASMRKALVSS-----------
A0A1Y4GLF5      ---------------------------------------KSMRKAIIGS-----------
A0A1H3XSC0      ---------------------------------------TAMRHAIVQS-----------
B3JI46          ---------------------------------------ASMRGAIIRS-----------
A0A174UR09      ---------------------------------------ASMRGAIIRS-----------
A6LE40          ---------------------------------------ASMRGAIIRS-----------
R6NN15          ---------------------------------------RSMRRSIVSS-----------
A0A358R8U0      ---------------------------------------SEMRRAIITS-----------
R6WSB6          ---------------------------------------SEMRRAIITS-----------
A0A401LPX7      ---------------------------------------DDMRSALITS-----------
A0A3A5Z900      ---------------------------------------DDMRSALITS-----------
A0A3R6I893      ---------------------------------------DDMRSALITS-----------
A0A3R6EGW5      ---------------------------------------DDMRSALITS-----------
A0A285TGL6      ---------------------------------------DDMRSALITS-----------
A0A3A5RFX4      ---------------------------------------DDMRSALITS-----------
A0A1Q6IUW9      ---------------------------------------DDMRSALITS-----------
A0A3R6NPG7      ---------------------------------------DDMRSALITS-----------
A0A413XDP6      ---------------------------------------DDMRSALITS-----------
K6AP24          ---------------------------------------DDMRSALITS-----------
A0A076IQN8      ---------------------------------------DDMRSALITS-----------
A0A078RYI7      ---------------------------------------DDMRSALITS-----------
C7XEQ8          ---------------------------------------DDMRSALITS-----------
D7INX6          ---------------------------------------DDMRSALITS-----------
K5ZG55          ---------------------------------------DDMRSALITS-----------
A0A3N2N9B8      ---------------------------------------AAMRNAIITT-----------
A0A3N2NMI0      ---------------------------------------AALRNAIVAT-----------
A0A359I8H7      ---------------------------------------KGLREAIVNA-----------
A0A3N2KA63      ---------------------------------------KGLREAIVNA-----------
A0A3B9FAU3      ---------------------------------------AQIRKVILEG-----------
A0A3C1E5L7      ---------------------------------------AQIRKVILEG-----------
A0A354SN68      ---------------------------------------GTLREAILSS-----------
A0A0A2DUD9      ---------------------------------------NDLKSVIVAS-----------
A0A3N2N595      ---------------------------------------SSIRSVILKS-----------
R5FHS9          ---------------------------------------RLQRSSIITS-----------
A0A3P1ZBJ5      ---------------------------------------SKQRQAIIAS-----------
A0A413TW79      ---------------------------------------ASMRHSIVTS-----------
A0A3E5E9M7      ---------------------------------------ASMRHSIVTS-----------
A0A3E4SK73      ---------------------------------------ASMRHSIVTS-----------
A0A415GGC6      ---------------------------------------ASMRHSIVTS-----------
A0A413DBH9      ---------------------------------------ASMRHSIVTS-----------
G9S1S8          ---------------------------------------AAMRKAIVAS-----------
A0A354M4S6      ---------------------------------------AAMREAIIAS-----------
R7DH52          ---------------------------------------AAMREAIIAS-----------
A0A396N3D5      ---------------------------------------AAMREAIIAS-----------
A0A415ZDP9      ---------------------------------------AAMREAIIAS-----------
A0A016CWA4      ---------------------------------------ASMRGAIIRS-----------
A0A1C6H117      ---------------------------------------ASMRGAIIRS-----------
A0A415TAH7      ---------------------------------------ASMRGAIIRS-----------
A0A0M1W0V2      ---------------------------------------ASMRGAIIRS-----------
A0A139KA16      ---------------------------------------ASMRGAIIRS-----------
A0A174VQ92      ---------------------------------------ASMRGAIIRS-----------
A0A1Q6HCG0      ---------------------------------------ASMRGAIIRS-----------
A0A1Y4JYM9      ---------------------------------------ASMRGAIIRS-----------
A0A3A5QW67      ---------------------------------------ASMRGAIIRS-----------
A0A3A5RQE6      ---------------------------------------ASMRGAIIRS-----------
A0A3A6BP07      ---------------------------------------ASMRGAIIRS-----------
A0A3E5E153      ---------------------------------------ASMRGAIIRS-----------
A0A3Q9IP20      ---------------------------------------ASMRGAIIRS-----------
A0A412WV15      ---------------------------------------ASMRGAIIRS-----------
A0A413ICP6      ---------------------------------------ASMRGAIIRS-----------
A0A414KYB9      ---------------------------------------ASMRGAIIRS-----------
A0A416X133      ---------------------------------------ASMRGAIIRS-----------
E5WX00          ---------------------------------------ASMRGAIIRS-----------
K0X3P3          ---------------------------------------ASMRGAIIRS-----------
A0A3A5Z014      ---------------------------------------ASMRGAIIRS-----------
A0A1M4YZ07      ---------------------------------------ASMRGAIIRS-----------
A0A078S3Q8      ---------------------------------------ASMRGAIIRS-----------
A0A069SJV7      ---------------------------------------ASMRGAIIRS-----------
A0A3E5DXI5      ---------------------------------------ASMRGAIIRS-----------
A0A3E5EM98      ---------------------------------------ASMRGAIIRS-----------
A0A3E5F453      ---------------------------------------ASMRGAIIRS-----------
I9T3G6          ---------------------------------------ASMRGAIIRS-----------
A0A0P0FQW1      ---------------------------------------ASMRGAIIRS-----------
C3RFN5          ---------------------------------------ASMRGAIIRS-----------
A0A3E4SYU0      ---------------------------------------ASMRGAIIRS-----------
A6LGY1          ---------------------------------------ASMRGAIIRS-----------
K5ZSH4          ---------------------------------------ASMRGAIIRS-----------
A0A078T2W6      ---------------------------------------ASMRGAIIRS-----------
A0A3R6D1V4      ---------------------------------------ASMRGAIIRS-----------
A0A3R6EAF7      ---------------------------------------ASMRGAIIRS-----------
A0A412MJT7      ---------------------------------------ASMRGAIIRS-----------
A0A3E4WKT5      ---------------------------------------ASMRGAIIRS-----------
A0A3A5YY33      ---------------------------------------ASMRGAIIRS-----------
A0A078TAH2      ---------------------------------------ASMRGAIIRS-----------
A0A1E9CFZ7      ---------------------------------------ASMRGAIIRS-----------
A0A373FYU5      ---------------------------------------ASMRGAIIRS-----------
A0A3A5TZ72      ---------------------------------------ASMRGAIIRS-----------
A0A3A5XBP2      ---------------------------------------ASMRGAIIRS-----------
A0A3A6MEG9      ---------------------------------------ASMRGAIIRS-----------
A0A3E4JP35      ---------------------------------------ASMRGAIIRS-----------
A0A3E4KP40      ---------------------------------------ASMRGAIIRS-----------
A0A3E4NX82      ---------------------------------------ASMRGAIIRS-----------
A0A3E4XFU8      ---------------------------------------ASMRGAIIRS-----------
A0A412RG70      ---------------------------------------ASMRGAIIRS-----------
A0A412TD37      ---------------------------------------ASMRGAIIRS-----------
A0A413GAA4      ---------------------------------------ASMRGAIIRS-----------
A0A414M7I4      ---------------------------------------ASMRGAIIRS-----------
E5UZA2          ---------------------------------------ASMRGAIIRS-----------
A0A069SMG6      ---------------------------------------ASMRGAIIRS-----------
A0A1Y4PQK7      ---------------------------------------ATIREAIISS-----------
A0A1Y3ZDB3      ---------------------------------------ATIRGAIISS-----------
A0A3A6AAP4      ---------------------------------------ATIRGAIISS-----------
A0A1Y4IH41      ---------------------------------------ATIRGAIISS-----------
A0A1Y4DYA7      ---------------------------------------QNMRNAIISS-----------
A0A1Y3X4I9      ---------------------------------------QNMRRAIISS-----------
A0A1Y4FNK8      ---------------------------------------ENMRHAIVTS-----------
A0A355FD59      ---------------------------------------ESMRKAIVSS-----------
A0A359CEZ9      ---------------------------------------ESMRKAIVSS-----------
A0A353Q7B4      ---------------------------------------ESMRKAIVSS-----------
A0A1M3KVR9      ---------------------------------------QSMRKAIVSS-----------
F8X3A5          ---------------------------------------QSMRKAIVSS-----------
A0A3C1ITV0      ---------------------------------------RMMRSTILRS-----------
R7HN19          ---------------------------------------RMMRSTILRS-----------
A0A415EEZ4      ---------------------------------------ASLKNTVLYS-----------
A0A060RD97      ---------------------------------------SALKMTIIQA-----------
A0A350IHV0      ---------------------------------------SALKVAISRS-----------
A0A077ENE7      ---------------------------------------GAMRTNISRA-----------
T0NN57          ---------------------------------------GAMRNNIGRA-----------
X5K347          ---------------------------------------GAMRNNIGRA-----------
A0A1T5K9D4      ---------------------------------------ISMKQNILGT-----------
R5RVP0          ---------------------------------------AALKIAINRS-----------
A0A285T4L1      ---------------------------------------HALRQSIIRA-----------
A0A3E5BU42      ---------------------------------------HALRQSIIRA-----------
A0A414ZBF2      ---------------------------------------VSMRASISKA-----------
R5KD55          ---------------------------------------NQLRRSVISS-----------
A0A174QNT3      ---------------------------------------VAMRSTIAGS-----------
R9I0H0          ---------------------------------------DAMRKTIAGS-----------
K5BUT9          ---------------------------------------EGMRATISGS-----------
A0A174FPA3      ---------------------------------------EGMRATISGS-----------
R6S9Y6          ---------------------------------------EGMRATISGS-----------
C9KX15          ---------------------------------------EGMRATISGS-----------
A0A3L8AAP1      ---------------------------------------AEMRTVISGS-----------
R6DAG6          ---------------------------------------AEMRTVISGS-----------
A0A1G8BVM8      ---------------------------------------VSMRSSILSS-----------
A0A416GGJ1      ---------------------------------------RAMKQNIVRA-----------
A0A3D1NQW3      ---------------------------------------ASTRRSIIAT-----------
B0MT10          ---------------------------------------ASTRRSIIAT-----------
R7JGW9          ---------------------------------------ASTRRSIIAT-----------
A0A0E2M2Y7      ---------------------------------------VAMRKSINAA-----------
A0A0K2J6Z0      ---------------------------------------VAMRKSINAA-----------
B2RKZ8          ---------------------------------------VAMRKSINAA-----------
A0A212GC82      ---------------------------------------VAMRKSINAA-----------
A0A254MU12      ---------------------------------------VAMRKSINAA-----------
R6CQ93          ---------------------------------------HALKQSIIRA-----------
A0A3D2BF46      ---------------------------------------AALRRAIIAS-----------
A0A358R538      ---------------------------------------AAVRRSILAS-----------
A0A1Y4AAB8      ---------------------------------------AAVRRSIIAS-----------
A0A1Y3WWY9      ---------------------------------------AAIRRTIIAS-----------
A0A1Y4U5L4      ---------------------------------------AAIRRTIIAS-----------
A0A1Y3VCJ1      ---------------------------------------ASIRRAIIAS-----------
A0A1Y3QTW7      ---------------------------------------AAVRRSIIAS-----------
R6XWY7          ---------------------------------------AAVRRSIIAS-----------
A0A174AVF1      ---------------------------------------AAVRRSIIAS-----------
A0A373HTL7      ---------------------------------------AAVRRSIIAS-----------
A0A1Q6EIY0      ---------------------------------------AAVRRSIIAS-----------
E4M8L3          ---------------------------------------AAVRRSIIAS-----------
I3YQ50          ---------------------------------------AAVRRSIIAS-----------
R5UEY8          ---------------------------------------AAVRRSIIAS-----------
A0A1H4D866      ---------------------------------------ASVRRSIVAS-----------
A0A374A9J5      ---------------------------------------AAVRRSIISS-----------
A0A1Q6E9S3      ---------------------------------------AAVRRSIISS-----------
D4IJ36          ---------------------------------------AAVRRSIISS-----------
A0A414Q925      ---------------------------------------MSMRLSIAKA-----------
A0A415PUS9      ---------------------------------------MSMRLSIAKA-----------
A0A108TCU0      ---------------------------------------MSMRLSIAKA-----------
A0A413BA42      ---------------------------------------MSMRLSIAKA-----------
S3Y344          ---------------------------------------MSMRLSIAKA-----------
A0A413MY74      ---------------------------------------MSMRLSIAKA-----------
A0A412TGL3      ---------------------------------------MSMRLSIAKA-----------
A0A413VJ33      ---------------------------------------MSMRLSIAKA-----------
A0A414L0W6      ---------------------------------------MSMRLSIAKA-----------
A0A412DP39      ---------------------------------------MSMRLSIAKA-----------
A0A413ZSE8      ---------------------------------------MSMRLSIAKA-----------
B0NP84          ---------------------------------------MSMRLSIAKA-----------
R6AK43          ---------------------------------------MSMRLSIAKA-----------
A0A412N2D9      ---------------------------------------MSMRLSIAKA-----------
R6LHA4          ---------------------------------------MSIRLSIAKA-----------
A0A1Q6FL18      ---------------------------------------MSMRLSIAKA-----------
A0A1Y4JYS9      ---------------------------------------MSMRLSIAKA-----------
A0A3E5HPT8      ---------------------------------------QTMKQNIYMA-----------
C6IJ48          ---------------------------------------QTMKQNIYMA-----------
Q8A3U2          ---------------------------------------QTMKQNIYMA-----------
A0A3R6S1H6      ---------------------------------------SAMRQTIVRT-----------
A0A3R6SD81      ---------------------------------------SAMRQTIVRT-----------
A0A413VXJ7      ---------------------------------------AAMKQTIIRS-----------
I9RSN9          ---------------------------------------AAMKQTIIRS-----------
U6RJK5          ---------------------------------------AAMKQTIIRS-----------
A0A1Q6GA32      ---------------------------------------AAMKQTIIRS-----------
I9RPU6          ---------------------------------------GAMKQTIIRS-----------
I8Y597          ---------------------------------------GAMKQTIIRS-----------
I8YFS5          ---------------------------------------GAMKQTIIRS-----------
A0A1Q6GBF5      ---------------------------------------SAMKQTIIRS-----------
I8YFZ3          ---------------------------------------SAMKQTIIRS-----------
A0A1Q6GDH2      ---------------------------------------SAMKQTIIRS-----------
U6RSB0          ---------------------------------------SAMKQTIIRS-----------
I9SIK1          ---------------------------------------SAMKQTIIRS-----------
I9GXM2          ---------------------------------------SAMKQTIIRS-----------
I9TP59          ---------------------------------------GAMKQTIIRS-----------
A0A0J6CIR2      ---------------------------------------SAMKQTIIRA-----------
A0A3D8HG59      ---------------------------------------QAMKQTIVRS-----------
A0A3R6S408      ---------------------------------------QAMKQTIVRS-----------
A0A354WXN6      ---------------------------------------NAMRQTIIRS-----------
R5IP14          ---------------------------------------STMRNSIIQS-----------
A0A316SZX7      ---------------------------------------VSMRKSLLRS-----------
A0A1Y4AIY1      ---------------------------------------SAMKQTIIRS-----------
F3ZRU7          ---------------------------------------FAMEQTINRS-----------
A0A1C5Q1F3      ---------------------------------------ASMKQTIVRT-----------
R7A239          ---------------------------------------ASMKQTIVRT-----------
A0A1M6K7I9      ---------------------------------------GAMRQSILRS-----------
A0A3R6HIK7      ---------------------------------------SAMKQSIIRS-----------
K5ZVW7          ---------------------------------------SAMKQSIIRS-----------
A0A1Y4D5Z0      ---------------------------------------NALKQTIIRS-----------
R5S343          ---------------------------------------LAMKQTIVNT-----------
A0A3R5ZMK1      ---------------------------------------IAMKQTIIRS-----------
A0A3E4ZTK7      ---------------------------------------IAMKQTIIRS-----------
A0A1Y3ZIA4      ---------------------------------------IAMKQTIIRS-----------
K5Y1A4          ---------------------------------------IAMKQTIIRS-----------
A0A3R6K8X4      ---------------------------------------IAMKQTIIRS-----------
A0A1Q6I3T6      ---------------------------------------IAMKQTIIRS-----------
A0A414XX40      ---------------------------------------IAMKQTIIRS-----------
A0A412DM15      ---------------------------------------IAMKQTIIRS-----------
A7AEU7          ---------------------------------------IAMKQTIIRS-----------
A0A415BDM7      ---------------------------------------IAMKQTIIRS-----------
A0A3R5ZYK4      ---------------------------------------IAMKQTIIRS-----------
A0A414GI87      ---------------------------------------IAMKQTIIRS-----------
A0A3R6BKI7      ---------------------------------------IAMKQTIIRS-----------
A0A414LPI6      ---------------------------------------IAMKQTIIRS-----------
A0A412M2W1      ---------------------------------------IAMKQTIIRS-----------
K5ZX55          ---------------------------------------IAMKQTIIRS-----------
K5ZBN2          ---------------------------------------GAMKQTIIRA-----------
A0A0J6CKW3      ---------------------------------------GAMKQTIIRA-----------
A0A0F5IQM7      ---------------------------------------GAMKQTIIRA-----------
S0GLB0          ---------------------------------------GAMKQTIIRA-----------
A0A3R6NLC1      ---------------------------------------GAMKQTIIRA-----------
A0A416WYC9      ---------------------------------------GAMKQTIIRA-----------
A0A0F5IT40      ---------------------------------------SAMKQTIIRA-----------
S0GSI7          ---------------------------------------SAMKQTIIRA-----------
K5YB65          ---------------------------------------SAMKQTIIRA-----------
A0A0F5IWP9      ---------------------------------------GAMKQTIIRA-----------
A0A0F5IZT8      ---------------------------------------GAMKQTIIRA-----------
A0A417LKQ2      ---------------------------------------NAMKQTIIRA-----------
A0A416TME1      ---------------------------------------NAMKQTIIRA-----------
A0A416XPE8      ---------------------------------------NAMKQTIIRA-----------
L8JI02          ---------------------------------------RNTKNTLQEN-----------
A6EBM4          ---------------------------------------QEVRKAAMEN-----------
A0A2N3U785      ---------------------------------------SNLEVNILEN-----------
A0A0E3ZG78      ---------------------------------------ANIRSSILEN-----------
A0A1I6BRK6      ---------------------------------------ADLRVNILET-----------
A0A243WAB1      ---------------------------------------ANLRINILEN-----------
A0A399SH26      ---------------------------------------EKIRPSILEN-----------
A0A0E3ZGV6      ---------------------------------------ESIRPGILEN-----------
A0A1I2N4S1      ---------------------------------------DNMRPGVLEN-----------
A0A2T5YE44      ---------------------------------------DNMRPGVLEN-----------
A0A1M4YED3      -------------------------------------------PAILDN-----------
A0A3P1Z8V4      ---------------------------------------EALRSAINTS-----------
A0A2L2WX98      ---------------------------------------ASMRSSLLAS-----------
G5GD56          ---------------------------------------AAQRTSILSS-----------
R6A0L2          ---------------------------------------AQMRQAIASS-----------
R7LG80          ---------------------------------------HQMRQSIKAS-----------
A0A1M6XHU0      REALQAQLVQEMLGRSGQTP----AT--------EPLSYVEQLRARRIE-----------
D0MHQ9          REQLQAQLVKEMIGRDSQAP----AS--------EPLSYVEQLRARRIE-----------
G2SF81          REQLQAQLVKEMIGRDSQAP----AS--------EPLSYVEQLRARRIE-----------
A0A2H3NSN0      KERLTAEMVELAADPEVRVG----QG--------AALGRLTELRARIDE-----------
A0A2P6C324      KMDLTEDLVEASREASGTAG----GVATAEGGGIASIGQLGTLQGRIEE-----------
A0A126PFG0      ---------------------------------------LATQLAIRSS-----------
A0A3M1N7Z3      ---------------------------------------LSRVRALLDQ-----------
R7PCR1          ---------------------------------------KAKRASILAG-----------
A0A2A8CVM9      KRSLTNQLVAEATQSSGLPG---ATAGNDSQMGTSALNRIMQLKTRITE-----------
A0A3C0ZQC7      LRKRTEEFLLSLLPGQRSTG-----------SSNDPASFLSEAKQKIIE-----------
A0A2E3R1D0      QERIARQLSAQSLASGSSPD-----------DQRSGFVRAADLRAQISA-----------
A0A2T2USC0      ADSLAQQYVQQTIAAGGVGSIPAKGEETTRRGQGRGLSYVVDLQRKVAQ-----------
A0A2T2V0F3      ADSLAQKYVSEAIAAGGIGSIPAEDRQGGGRQQGRGVGYVVELQREVAQ-----------
A0A2T2S682      ADSLADAYVEKTLAAGGIGA----GEGGEEGGGERGISYVVQLQRQIAQ-----------
D5H561          IQRLSDRYVEE-LMGGGLSP----KQGAQR---------INELKRRIAE-----------
A0A2H3NWA9      AQDIAARYVDQALAAGGAGP----GEDSE-----RGVGYVAEQREQLVQ-----------
A0A2A8CVB6      ADSLASKYVNESLAAGGVGS----QSGEN----SRSLTYVVEQRRAIAQ-----------
A0A2P6C1S6      TDSLANRYVEESLSAGGVAS----SSGEDG--GPSGVSYVAQQRREIAQ-----------
A0A2T2UTM4      TDSLASRYVRESLSAGGVAA----GGGGEG--GGSGVSYVAQQRREIAQ-----------
A0A1T5MMH4      ---------------------------------------ENRTDKTSQQ-----------
A0A2W4R1L8      ---------------------------------------QNLQEQVTKQ-----------
A0A2E5CV79      ---------------------------------------SIMKEKLDEK-----------
A0A2A4G4B1      ---------------------------------------TELQKGIAIS-----------
A0A2D4ZVH1      ---------------------------------------ARIENEILKVKRQIKDRTNNL
A0A0E3V905      ---------------------------------------KITKNNMAST-----------
A0A1M6GR99      ---------------------------------------KNLKNTVSEN-----------
A0A1M5BA90      ---------------------------------------DNMRPAILEN-----------
A0A1V9F098      ---------------------------------------EQIRPIILEK-----------
A0A1V9FHD0      ---------------------------------------EQTRPMILEK-----------
A0A1T5CS78      ---------------------------------------SKIRPSILEN-----------
A0A0Q9Z8F1      ---------------------------------------SKIRPSILEN-----------
A0A2N0U0M7      ---------------------------------------SKIRPSILEN-----------
A0A1M6TTV4      ---------------------------------------EISQNSAKFR-----------
A0A1Q6IT42      ---------------------------------------DVMRENILNT-----------
K0X1U5          ---------------------------------------DVMRENILNT-----------
A0A416XAH0      ---------------------------------------DVMRENILNT-----------
R5EXK3          ---------------------------------------DVMRENILNT-----------
A0A401UAP7      ---------------------------------------EFAEKALVIQ-----------
A0A1W2GF52      ---------------------------------------EIAKNSANSR-----------
A0A2G5L7B8      ---------------------------------------DLSQKAVHDR-----------
A0A0D3LFR6      ---------------------------------------SMIKEDLLAA-----------
M7N6D4          ---------------------------------------SAVKEELANA-----------
A0A364XUP5      ---------------------------------------ETHSTRAIEH-----------
A0A1M5RLA9      ---------------------------------------ETLRAKASRQ-----------
A0A385SFR9      ---------------------------------------ETLRDKSGRQ-----------
L8JW09          ---------------------------------------KNSKTALKAQ-----------
A0A1Q3ZMZ7      ---------------------------------------DQKIREIKKS-----------
A0A2D8JJW3      ---------------------------------------ELAIKDTLRF-----------
A0A2W2AFF7      ---------------------------------------DNLRGDINNS-----------
A0A2N5YXE2      ---------------------------------------ATKKATIVDF-----------
A0A2I0QZ80      ---------------------------------------TIRKESITRI-----------
A0A2U2XBJ3      ---------------------------------------QIRKENIDEV-----------
A0A3E1F1A3      ---------------------------------------QVRKENIDEV-----------
A0A1V9F383      ---------------------------------------EQLRPLVLEK-----------
G8TRZ6          ---------------------------------------EALRPLVLEK-----------
A0A2W1NDY9      ---------------------------------------INQTETINRT-----------
A0A1G0CI31      ---------------------------------------QSKIQSIRRS-----------
F2IKD6          ---------------------------------------QSKIQYIRRS-----------
A0A1I7BM74      ---------------------------------------SADIEITNKI-----------
A0A2G2FJ17      ---------------------------------------DNRIQNINKI-----------
A0A416X8R7      ---------------------------------------AAVRVNLTAS-----------
K0XJ09          ---------------------------------------AAVRVNLTAS-----------
R5EUZ0          ---------------------------------------AAVRVNLTAS-----------
W0EQS0          ---------------------------------------ASVRENLSSS-----------
A0A1Y3WE15      ---------------------------------------ASVRVNLASS-----------
A0A1Y4GUK3      ---------------------------------------ASVRINLASS-----------
A0A2U1FKU2      ---------------------------------------VSMRKSINVA-----------
A0A0A2F954      ---------------------------------------VAMRKSINAA-----------
A0A0A2FW91      ---------------------------------------VAMRKSINAA-----------
A0A2D2N2N1      ---------------------------------------VAMRKSINAA-----------
Q7MWZ2          ---------------------------------------VAMRKSINAA-----------
T2NDT6          ---------------------------------------VAMRKSINAA-----------
W1R7P9          ---------------------------------------VAMRKSINAA-----------
A0A1R4AFZ0      ---------------------------------------VAMRKSINAA-----------
A0A1R4DVZ7      ---------------------------------------VAMRKSINAA-----------
A0A1G9E2A9      ---------------------------------------NKLEKSVKEL-----------
A0A2T2YJE8      ---------------------------------------KFVEQSVRKL-----------
A0A3M9N829      ---------------------------------------KFTQGRLNAI-----------
A0A0P0CSF9      ---------------------------------------EIAQNRLRDV-----------
A0A3M9MNC3      ---------------------------------------QFAQGRLRDA-----------
A0A2M6GH67      ---------------------------------------RLTKEAVTEL-----------
A0A127B287      ---------------------------------------KFAQDKVSSL-----------
A0A369QP10      ---------------------------------------DFSEKAVRKL-----------
A0A418R9X5      ---------------------------------------ANIKAIIREL-----------
A0A428JSJ3      ---------------------------------------ANIKGIIREL-----------
A0A428KI59      ---------------------------------------ANVKSIIREL-----------
W8F1I6          ---------------------------------------ANVKSIIREL-----------
A0A246FQC0      ---------------------------------------ADLKKIVRQL-----------
A0A372E5P8      ---------------------------------------TNIKKIVRQL-----------
A0A1H3EMW1      ---------------------------------------ADLKKIVRQL-----------
A0A1H9ZSN3      ---------------------------------------ADLKKIVRQL-----------
A0A0M3RW20      ---------------------------------------EYAKRNVQDA-----------
A0A1S9B3W0      ---------------------------------------QKTKSNIQKL-----------
A0A1W1VRL3      ---------------------------------------DFTRSTIRRL-----------
A0A1M6R305      ---------------------------------------SYVRGNLRRT-----------
A0A2M9B9H9      ---------------------------------------AYVKNNIRRL-----------
A0A126PDF2      ---------------------------------------DYTLSSILRQ-----------
A0A2Z3GKA1      ---------------------------------------DYTLSSILRQ-----------
A0A328BL48      ---------------------------------------AFTKRSIRRL-----------
A0A3S0QKV1      ---------------------------------------RRTRDGVQKL-----------
A0A3R9P8H7      ---------------------------------------ADLKKIVRQL-----------
A0A212UCJ7      ---------------------------------------TFTKQNINQL-----------
A0A238WIA7      ---------------------------------------AFTKRSIRQL-----------
A0A0W8EDI5      ---------------------------------------DFTRRSIRRL-----------
A0A3B7RBP8      ---------------------------------------DYTRRSIGRL-----------
A0A1I5WSL8      ---------------------------------------EYARTAVSRL-----------
A0A0U3JVM7      ---------------------------------------EYTRASIKRL-----------
A0A1G1SSV2      ---------------------------------------AYTRASLKRL-----------
A0A1G1SXV7      ---------------------------------------AFTRASLKRL-----------
A0A243WHR7      ---------------------------------------NLVKKSTQRL-----------
A0A076HRT9      ---------------------------------------NFVKGNVRRT-----------
A0A1M6DHW8      ---------------------------------------AFLKGSIRRQ-----------
A0A3D1KEX9      ---------------------------------------VAMRSAIKVS-----------
A0A358Y7S2      ---------------------------------------QNKISNIRRS-----------
A0A1X7J248      ---------------------------------------NVLKDRINNY-----------
E4TQD2          ---------------------------------------NALKDRINNY-----------
A0A2J6HHN3      ---------------------------------------SYQKRMIHQS-----------
A0A1Y3WMT8      ---------------------------------------DAMRDNILNT-----------
A0A1Y4GQU1      ---------------------------------------DAMRENILNT-----------
A0A1V5W8T5      ---------------------------------------LEQKKLLLDF-----------
A0A2T8HKA9      ---------------------------------------SSNRQNIERA-----------
A0A3B8INU3      ---------------------------------------QILRDELLDA-----------
A0A098LL25      ---------------------------------------ERIKENVLEL-----------
A0A1Q3Q573      ---------------------------------------FSSKNQLLKR-----------
A0A357YNR3      ---------------------------------------TSMLNSVKSS-----------
F4KK08          ---------------------------------------AAQRLSIITS-----------
A0A3N2N6F7      ---------------------------------------ASIRAALASS-----------
A0A419VXB7      ---------------------------------------EYVKKSLVEN-----------
A0A2V1ILM4      ---------------------------------------RSMRSALVSS-----------
A0A3N2L0E8      ---------------------------------------RSMRSALVSS-----------
A0A3N2LFC5      ---------------------------------------RSMRSALVSS-----------
C3J7R8          ---------------------------------------ASMHVAVVKS-----------
A0A0B0BTJ4      ---------------------------------------ISMQHSLKKS-----------
A0A3B9CNN6      ---------------------------------------ISMQHSLKKS-----------
R5X290          ---------------------------------------ISMQHSLKKS-----------
A0A1Q6E6I7      ---------------------------------------ISMQHSLKKS-----------
A0A2G2F510      ---------------------------------------KAKTNLIQRS-----------
A0A316JZ08      ---------------------------------------DTKINTILRS-----------
A0A1I1FXP9      ---------------------------------------GSMGEDLLKI-----------
A0A3B9FXJ0      ---------------------------------------DEVKKNFKEA-----------
R5GSU5          ---------------------------------------IATNEAIRAS-----------
A0A2P8EAX2      ---------------------------------------SSLKSNILQN-----------
A0A3N4H5N3      ---------------------------------------SSLRSNIIQN-----------
A0A2A3UE91      ---------------------------------------ENQRKLLLES-----------
A0A0A2G557      ---------------------------------------ESLRKAIIKS-----------
A0A2N2WFW8      ---------------------------------------DFQKRIIRES-----------
A0A1F3IU95      ---------------------------------------EFQNKIIRES-----------
A0A3D0VUF6      ---------------------------------------EFQNKIIRES-----------
A0A1T4PT95      ---------------------------------------ESLQKAIIKS-----------
A0A3Q9FR88      ---------------------------------------KKLRYEVAES-----------
A0A150ADJ9      ---------------------------------------KKLRYEVAES-----------
A0A1B1FWQ4      ---------------------------------------KKLRYEVAES-----------
A0A1S1Z228      ---------------------------------------KKLRFEVAES-----------
A0A1F3SJM1      ---------------------------------------KAKILLIQHS-----------
A0A2G2EB96      ---------------------------------------ASKLRIIQRS-----------
A0A2G6PRA9      ---------------------------------------TSKLNIIQRS-----------
A1ZKR2          ---------------------------------------ELQRTQVQKL-----------
A0A1Q3GX01      ---------------------------------------DIQKEKATRI-----------
A0A349DQI4      ---------------------------------------NTQKAKANRL-----------
A0A2N3IIZ0      ---------------------------------------NNLQKNITES-----------
A0A2A4PYG9      ---------------------------------------SVQKKLLIGS-----------
A0A2A5FYT6      ---------------------------------------SIQKNLLLES-----------
A0A2E6SYP1      ---------------------------------------KLQLNDLKEV-----------
A0A2E5RLE8      ---------------------------------------NLEIQDLLEV-----------
A0A2E7TQF6      ---------------------------------------NLEIQDLLEV-----------
A0A2E6GVY9      ---------------------------------------NLEIEDLLEV-----------
A0A350JJ90      ---------------------------------------SVQKNLVIKS-----------
A0A3M1CDV2      ---------------------------------------ENQKKILIET-----------
A0A2E2TFD1      ---------------------------------------RIQKKLLFES-----------
A0A2E4ELE6      ---------------------------------------SIQKKLLVES-----------
A0A2E3XZI5      ---------------------------------------EEE----ILY-----------
A0A2M7NLQ9      ---------------------------------------ELLKKEVDKF-----------
I4AFR0          ---------------------------------------DLLKKEVDKF-----------
A0A2N2Y3E5      ---------------------------------------DNQREILKEF-----------
A0A2D9D7T6      ---------------------------------------DARIVSIRKS-----------
A0A1F3PPL5      ---------------------------------------ENLRKTMIDF-----------
A0A357QK06      ---------------------------------------ENLRKTMIDF-----------
A0A2A5B3B0      ---------------------------------------NVQKKVLFES-----------
A0A0F2NS19      ---------------------------------------DVQKQILFTT-----------
A0A2A5H8X6      ---------------------------------------DVQKQILFTT-----------
A0A2H0GAU8      ---------------------------------------EIQKEVLFAT-----------
A0A2M8FTK1      ---------------------------------------EIQKEVLFAT-----------
A0A0S2HYK8      ---------------------------------------ANQKKLIIDF-----------
A0A2N5ZWN6      ---------------------------------------ENQRRLIIDF-----------
A0A2E0FJ09      ---------------------------------------DVQTKLISEG-----------
A0A1F3FZ62      ---------------------------------------GIQKKIMFET-----------
A0A1F3K211      ---------------------------------------GIQKKIMFET-----------
A0A1F3KLL5      ---------------------------------------VTKKGILVEF-----------
A0A359D1M1      ---------------------------------------VTKKGILVEF-----------
A0A2E7CT70      ---------------------------------------EEE----IIY-----------
A0A2D5V560      ---------------------------------------EES----VVY-----------
A0A2D7K5A8      ---------------------------------------EES----VLY-----------
A0A2E1XQ82      ---------------------------------------EES----ILY-----------
A0A1V6I2U9      ---------------------------------------KSKKETIIDF-----------
A0A1F3C1M2      ---------------------------------------QNQKEILIEF-----------
A0A1F3DS87      ---------------------------------------QNQKQILIEF-----------
A0A2H0B957      ---------------------------------------ETQKQTLIDL-----------
A0A1F3CFW6      ---------------------------------------ETQKQTIIDL-----------
A0A2M7E2T8      ---------------------------------------ETQKQTIIDL-----------
A0A2M7NC69      ---------------------------------------ETQKQTIIDL-----------
A0A1F3K695      ---------------------------------------ENQKMILTEF-----------
A0A353KZR1      ---------------------------------------ENQKMILTEF-----------
A0A2N2WYB5      ---------------------------------------SNQKNLLIDF-----------
A0A1F3K4G0      ---------------------------------------DNQKDLLLEF-----------
A0A356H8Y3      ---------------------------------------DNQKDLLLEF-----------
A0A351HSA6      ---------------------------------------DNQKDLLLEF-----------
A0A1F3Q014      ---------------------------------------EIQKKLLKES-----------
A0A2A4YXP3      ---------------------------------------KVQKKILFES-----------
A0A2D5KD44      ---------------------------------------DIQKKLISES-----------
A0A1F3R158      ---------------------------------------EVQKEVLFKT-----------
A0A2M8ADX2      ---------------------------------------ELQKEVLFKT-----------
A0A1J5B2H0      ---------------------------------------NIQKKLLIES-----------
A0A1V5N756      ---------------------------------------DIQKKLFAES-----------
                                                                            

A0A1I3J6V0      ----------------------------------------------TLIPG---------
A0A1H4ADG3      --------------------------------LN------------SIKYS---------
A0A3D5KRY6      --------------------------------IE------------SLISN---------
A0A1V5IPN7      --------------------------------IQKFIAISLSQDPLSARNE---------
A0A1V3WH52      -------------------------------------------------RT---------
A0A2K8Z965      --------------------------------IL------------TMKNM---------
A0A418M8U8      --------------------------------IR------------TMKTM---------
I2GTA4          --------------------------------IR------------TMKTM---------
A0A2K8ZAJ2      --------------------------------IE------------TIRQQ---------
A0A368JPA3      --------------------------------LA------------TLRGI---------
A0A3P1BT12      --------------------------------IA------------TLRSI---------
A0A3P1CI15      --------------------------------IA------------TLRSI---------
A0A1Q3PII2      --------------------------------IQ------------YQKQE---------
A0A351BXT2      --------------------------------TP------------EERRN---------
A0A3D0MYJ7      --------------------------------TP------------DIKND---------
A0A3D3LS70      --------------------------------TP------------EERKE---------
A0A1G7ZF38      --------------------------------IE------------HQKRE---------
C6VS52          --------------------------------IH------------QQKQE---------
A0A1G1TM36      --------------------------------VQ------------NIKAS---------
A0A1V3WH27      ------------------------------------------------------------
A0A0D3L8Q3      --------------------------------LS------------NIRQS---------
A0A0K8QSK7      --------------------------------IN------------SSISQ---------
A0A1V6CN82      --------------------------------IN------------NIVDH---------
A0A1M4XZ45      --------------------------------VN------------NIISQ---------
A0A399D319      --------------------------------VN------------NIISQ---------
A0A0P7X1V8      --------------------------------TN------------DLIQSDAGLSFFGS
A0A3B0C2S4      --------------------------------LN------------VYQTQ---------
A0A416GA42      --------------------------------MD------------NHIEA---------
A0A3N2M1H3      --------------------------------MS------------NRIAG---------
A0A1T3IYP5      --------------------------------VD------------NVLKG---------
A0A212K7W5      --------------------------------VD------------NLLIS---------
F5IU11          --------------------------------VD------------NLLVT---------
A0A352Z1R7      --------------------------------YE------------TNLVN---------
A0A0A2F501      --------------------------------LD------------NQILT---------
R5B7P0          --------------------------------ID------------NEILA---------
R5B0L5          --------------------------------LD------------NQITT---------
A0A374THP7      --------------------------------LD------------NFVVT---------
A0A3R5XWG1      --------------------------------ID------------NFVVT---------
A0A414YFM3      --------------------------------ID------------NFVVT---------
A0A0A2EVS5      --------------------------------ID------------NEINS---------
A0A1T4NAJ7      --------------------------------ID------------NEINS---------
A0A2V1IJY1      --------------------------------VD------------NSINA---------
A0A3N2KCL3      --------------------------------VD------------NSINA---------
A0A255T941      --------------------------------ID------------NLILS---------
A0A1Y4CHN5      --------------------------------ID------------NLVVT---------
A0A1Y3V692      --------------------------------VD------------NLIVS---------
A0A174TYU6      --------------------------------VD------------NLIVS---------
A0A1M6I2S6      --------------------------------VD------------NLIVS---------
F3PXM2          --------------------------------VD------------NLIVS---------
A0A3E4ZNL4      --------------------------------VD------------NLIVS---------
A0A174AHH7      --------------------------------VD------------NLIVS---------
A0A174JCE8      --------------------------------VD------------NLIVS---------
A0A3E4JMC4      --------------------------------VD------------NLIVS---------
A0A412SND6      --------------------------------VD------------NLIVS---------
A0A414IEQ9      --------------------------------VD------------NLIVS---------
A0A415UKN5      --------------------------------VD------------NLIVS---------
A0A0M1W8D8      --------------------------------VD------------NLIVS---------
A0A3R6GKX5      --------------------------------VD------------NLIVS---------
A7V4S1          --------------------------------VD------------NLIVS---------
B0NU19          --------------------------------VD------------NLIVS---------
D4V601          --------------------------------VD------------NLIVS---------
A0A397WLT5      --------------------------------VD------------NLIVS---------
A0A3R6GM96      --------------------------------VD------------NLIVS---------
A0A015XH67      --------------------------------VD------------NLIVS---------
A0A078RZN2      --------------------------------VD------------NLIVS---------
A6L0K5          --------------------------------VD------------NLIVS---------
A7ACT5          --------------------------------VD------------NLIVS---------
A6KY94          --------------------------------VD------------NLIVS---------
A0A173UQR8      --------------------------------VD------------NLIVS---------
A0A3R6HK75      --------------------------------VD------------NLIVS---------
A0A412B7D1      --------------------------------VD------------NLIVS---------
A0A412VNY9      --------------------------------VD------------NLIVS---------
A0A414LTU9      --------------------------------VD------------NLIVS---------
I9Q4U4          --------------------------------VD------------NLIVS---------
A0A373ISF0      --------------------------------VD------------NLIVS---------
U6RF62          --------------------------------VD------------NLIVS---------
A0A073I794      --------------------------------VD------------NLIVS---------
A0A108TH71      --------------------------------VD------------NLIVS---------
I8VXH0          --------------------------------VD------------NLIVS---------
A0A412S0N6      --------------------------------VD------------NLIVS---------
A0A412IIJ0      --------------------------------VD------------NLIVS---------
A0A0P0FM97      --------------------------------VD------------NLIVS---------
R6KTP3          --------------------------------VD------------NLIVS---------
A0A139LU87      --------------------------------VD------------NLIVS---------
A0A1C6B3Y5      --------------------------------VD------------NLIVS---------
E2NMQ4          --------------------------------VD------------NLIVS---------
A0A412YDB9      --------------------------------VD------------NLIVS---------
R7DY01          --------------------------------VD------------NLIVS---------
A0A414LGK8      --------------------------------VD------------NLIVS---------
A0A016E4F9      --------------------------------VD------------NLIVS---------
A0A413PP50      --------------------------------VD------------NLIVS---------
A0A3A5TI83      --------------------------------VD------------NLIVS---------
A0A415NEB6      --------------------------------VD------------NLIVS---------
A7AJ60          --------------------------------VD------------NLIVS---------
A0A015UXN7      --------------------------------VD------------NLIVS---------
A0A395YYT3      --------------------------------VD------------NLIVS---------
A0A415IPQ4      --------------------------------VD------------NLIVS---------
A0A3E5BRW7      --------------------------------VD------------NLIVS---------
K9DXS6          --------------------------------VD------------NLIVS---------
A0A1M6KFV3      --------------------------------VD------------NLIVS---------
A0A1Q6G7L3      --------------------------------VD------------NLIVS---------
A0A413H235      --------------------------------VD------------NLIVS---------
A0A1M5B2J8      --------------------------------ID------------NQLVA---------
A0A255RCT5      --------------------------------ID------------NQVVA---------
A0A1Y4GLF5      --------------------------------ID------------NQIET---------
A0A1H3XSC0      --------------------------------ID------------NQIVT---------
B3JI46          --------------------------------ID------------NQIVT---------
A0A174UR09      --------------------------------ID------------NRIVT---------
A6LE40          --------------------------------ID------------NQIVT---------
R6NN15          --------------------------------VD------------NLITT---------
A0A358R8U0      --------------------------------ID------------NQILT---------
R6WSB6          --------------------------------ID------------NQILT---------
A0A401LPX7      --------------------------------ID------------NQMVA---------
A0A3A5Z900      --------------------------------ID------------NQMVA---------
A0A3R6I893      --------------------------------ID------------NQMVA---------
A0A3R6EGW5      --------------------------------ID------------NQMVA---------
A0A285TGL6      --------------------------------ID------------NQMVA---------
A0A3A5RFX4      --------------------------------ID------------NQMVA---------
A0A1Q6IUW9      --------------------------------ID------------NQMVA---------
A0A3R6NPG7      --------------------------------ID------------NQMVA---------
A0A413XDP6      --------------------------------ID------------NQMVA---------
K6AP24          --------------------------------ID------------NQMVA---------
A0A076IQN8      --------------------------------ID------------NQMVA---------
A0A078RYI7      --------------------------------ID------------NQMVA---------
C7XEQ8          --------------------------------ID------------NQMVA---------
D7INX6          --------------------------------ID------------NQMVA---------
K5ZG55          --------------------------------ID------------NQMVA---------
A0A3N2N9B8      --------------------------------VD------------NQISA---------
A0A3N2NMI0      --------------------------------VD------------TQIAA---------
A0A359I8H7      --------------------------------IN------------GQIVA---------
A0A3N2KA63      --------------------------------IN------------GQIVA---------
A0A3B9FAU3      --------------------------------ID------------NLCST---------
A0A3C1E5L7      --------------------------------ID------------NLCST---------
A0A354SN68      --------------------------------ID------------SEIST---------
A0A0A2DUD9      --------------------------------LD------------NQLLA---------
A0A3N2N595      --------------------------------ID------------NSITA---------
R5FHS9          --------------------------------VE------------NSIRS---------
A0A3P1ZBJ5      --------------------------------ID------------NLLLT---------
A0A413TW79      --------------------------------ID------------NFVVT---------
A0A3E5E9M7      --------------------------------ID------------NLVVT---------
A0A3E4SK73      --------------------------------ID------------NFVVT---------
A0A415GGC6      --------------------------------ID------------NFVVT---------
A0A413DBH9      --------------------------------ID------------NFVVT---------
G9S1S8          --------------------------------ID------------NQVVT---------
A0A354M4S6      --------------------------------ID------------NQVVT---------
R7DH52          --------------------------------ID------------NQVVT---------
A0A396N3D5      --------------------------------ID------------NQVVT---------
A0A415ZDP9      --------------------------------ID------------NQVVT---------
A0A016CWA4      --------------------------------ID------------NQIVT---------
A0A1C6H117      --------------------------------ID------------NQIVT---------
A0A415TAH7      --------------------------------ID------------NQIVT---------
A0A0M1W0V2      --------------------------------ID------------NQIVT---------
A0A139KA16      --------------------------------ID------------NQIVT---------
A0A174VQ92      --------------------------------ID------------NQIVT---------
A0A1Q6HCG0      --------------------------------ID------------NQIVT---------
A0A1Y4JYM9      --------------------------------ID------------NQIVT---------
A0A3A5QW67      --------------------------------ID------------NQIVT---------
A0A3A5RQE6      --------------------------------ID------------NQIVT---------
A0A3A6BP07      --------------------------------ID------------NQIVT---------
A0A3E5E153      --------------------------------ID------------NQIVT---------
A0A3Q9IP20      --------------------------------ID------------NQIVT---------
A0A412WV15      --------------------------------ID------------NQIVT---------
A0A413ICP6      --------------------------------ID------------NQIVT---------
A0A414KYB9      --------------------------------ID------------NQIVT---------
A0A416X133      --------------------------------ID------------NQIVT---------
E5WX00          --------------------------------ID------------NQIVT---------
K0X3P3          --------------------------------ID------------NQIVT---------
A0A3A5Z014      --------------------------------ID------------NQIVT---------
A0A1M4YZ07      --------------------------------ID------------NQIVT---------
A0A078S3Q8      --------------------------------ID------------NQIVT---------
A0A069SJV7      --------------------------------ID------------NQIVT---------
A0A3E5DXI5      --------------------------------ID------------NQIVT---------
A0A3E5EM98      --------------------------------ID------------NQIVT---------
A0A3E5F453      --------------------------------ID------------NQIVT---------
I9T3G6          --------------------------------ID------------NQIVT---------
A0A0P0FQW1      --------------------------------ID------------NQMVT---------
C3RFN5          --------------------------------ID------------NQIVT---------
A0A3E4SYU0      --------------------------------ID------------NQIVT---------
A6LGY1          --------------------------------ID------------NQIVT---------
K5ZSH4          --------------------------------ID------------NQIVT---------
A0A078T2W6      --------------------------------ID------------NQIVT---------
A0A3R6D1V4      --------------------------------ID------------NQIVT---------
A0A3R6EAF7      --------------------------------ID------------NQIVT---------
A0A412MJT7      --------------------------------ID------------NQIVT---------
A0A3E4WKT5      --------------------------------ID------------NQIVT---------
A0A3A5YY33      --------------------------------ID------------NQIVT---------
A0A078TAH2      --------------------------------ID------------NQIVT---------
A0A1E9CFZ7      --------------------------------ID------------NQIVT---------
A0A373FYU5      --------------------------------ID------------NQIVT---------
A0A3A5TZ72      --------------------------------ID------------NQIVT---------
A0A3A5XBP2      --------------------------------ID------------NQIVT---------
A0A3A6MEG9      --------------------------------ID------------NQIVT---------
A0A3E4JP35      --------------------------------ID------------NQIVT---------
A0A3E4KP40      --------------------------------ID------------NQIVT---------
A0A3E4NX82      --------------------------------ID------------NQIVT---------
A0A3E4XFU8      --------------------------------ID------------NQIVT---------
A0A412RG70      --------------------------------ID------------NQIVT---------
A0A412TD37      --------------------------------ID------------NQIVT---------
A0A413GAA4      --------------------------------ID------------NQIVT---------
A0A414M7I4      --------------------------------ID------------NQIVT---------
E5UZA2          --------------------------------ID------------NQIVT---------
A0A069SMG6      --------------------------------ID------------NQIVT---------
A0A1Y4PQK7      --------------------------------IN------------NLEVT---------
A0A1Y3ZDB3      --------------------------------ID------------NLEVT---------
A0A3A6AAP4      --------------------------------ID------------NLEVT---------
A0A1Y4IH41      --------------------------------ID------------NLEVT---------
A0A1Y4DYA7      --------------------------------ID------------NHITT---------
A0A1Y3X4I9      --------------------------------ID------------NHITT---------
A0A1Y4FNK8      --------------------------------ID------------NHITT---------
A0A355FD59      --------------------------------ID------------NLVVT---------
A0A359CEZ9      --------------------------------ID------------NLVVT---------
A0A353Q7B4      --------------------------------ID------------NLVVT---------
A0A1M3KVR9      --------------------------------ID------------NLIVT---------
F8X3A5          --------------------------------ID------------NLTVS---------
A0A3C1ITV0      --------------------------------VD------------NHISA---------
R7HN19          --------------------------------VD------------NHISA---------
A0A415EEZ4      --------------------------------LD------------NLYRS---------
A0A060RD97      --------------------------------IN------------NTVNS---------
A0A350IHV0      --------------------------------MD------------NLIST---------
A0A077ENE7      --------------------------------VD------------NALRG---------
T0NN57          --------------------------------VD------------NSLRG---------
X5K347          --------------------------------VD------------NSLRG---------
A0A1T5K9D4      --------------------------------ID------------NLMTS---------
R5RVP0          --------------------------------VE------------NLIST---------
A0A285T4L1      --------------------------------VD------------NMIVS---------
A0A3E5BU42      --------------------------------VD------------NMIVS---------
A0A414ZBF2      --------------------------------VD------------NLVAG---------
R5KD55          --------------------------------IN------------NMIVS---------
A0A174QNT3      --------------------------------ID------------NYMRT---------
R9I0H0          --------------------------------ID------------NYVRT---------
K5BUT9          --------------------------------MD------------NYMKT---------
A0A174FPA3      --------------------------------MD------------NYMKT---------
R6S9Y6          --------------------------------MD------------NYMKT---------
C9KX15          --------------------------------MD------------NYMKT---------
A0A3L8AAP1      --------------------------------MD------------NYIKN---------
R6DAG6          --------------------------------MD------------NYIKN---------
A0A1G8BVM8      --------------------------------VD------------NLVAS---------
A0A416GGJ1      --------------------------------VD------------NLIVS---------
A0A3D1NQW3      --------------------------------LD------------SYIST---------
B0MT10          --------------------------------LD------------SYIST---------
R7JGW9          --------------------------------LD------------SYIST---------
A0A0E2M2Y7      --------------------------------VD------------NYIKT---------
A0A0K2J6Z0      --------------------------------VD------------NYIKT---------
B2RKZ8          --------------------------------VD------------NYIKT---------
A0A212GC82      --------------------------------VD------------NYIKT---------
A0A254MU12      --------------------------------VD------------NYIKT---------
R6CQ93          --------------------------------VD------------NMIVS---------
A0A3D2BF46      --------------------------------LQ------------SHIST---------
A0A358R538      --------------------------------LD------------SHIAT---------
A0A1Y4AAB8      --------------------------------LD------------SHIRA---------
A0A1Y3WWY9      --------------------------------LD------------SHIST---------
A0A1Y4U5L4      --------------------------------LD------------SHIST---------
A0A1Y3VCJ1      --------------------------------LD------------SHIAT---------
A0A1Y3QTW7      --------------------------------LN------------SHVST---------
R6XWY7          --------------------------------LN------------SHVST---------
A0A174AVF1      --------------------------------LN------------SHVST---------
A0A373HTL7      --------------------------------LN------------SHVST---------
A0A1Q6EIY0      --------------------------------LN------------SHIST---------
E4M8L3          --------------------------------LN------------SHIST---------
I3YQ50          --------------------------------LN------------SHIST---------
R5UEY8          --------------------------------LN------------SHIST---------
A0A1H4D866      --------------------------------LD------------SHIST---------
A0A374A9J5      --------------------------------LD------------SNIST---------
A0A1Q6E9S3      --------------------------------LD------------SNIST---------
D4IJ36          --------------------------------LD------------SNIST---------
A0A414Q925      --------------------------------VD------------NLIAS---------
A0A415PUS9      --------------------------------VD------------NLIAS---------
A0A108TCU0      --------------------------------VD------------NLIAS---------
A0A413BA42      --------------------------------VD------------NLIAS---------
S3Y344          --------------------------------VD------------NLIAS---------
A0A413MY74      --------------------------------VD------------NLIAS---------
A0A412TGL3      --------------------------------VD------------NLIAS---------
A0A413VJ33      --------------------------------VD------------NLIAS---------
A0A414L0W6      --------------------------------VD------------NLIAS---------
A0A412DP39      --------------------------------VD------------NLIAS---------
A0A413ZSE8      --------------------------------VD------------NLIAS---------
B0NP84          --------------------------------VD------------NLIAS---------
R6AK43          --------------------------------VD------------NLIAS---------
A0A412N2D9      --------------------------------VD------------NLIAS---------
R6LHA4          --------------------------------VD------------NLIAS---------
A0A1Q6FL18      --------------------------------VD------------NLIAN---------
A0A1Y4JYS9      --------------------------------VD------------NLIAN---------
A0A3E5HPT8      --------------------------------VD------------NLSKS---------
C6IJ48          --------------------------------VD------------NLSKS---------
Q8A3U2          --------------------------------VD------------NLSKS---------
A0A3R6S1H6      --------------------------------VD------------NLIAG---------
A0A3R6SD81      --------------------------------VD------------NLIAG---------
A0A413VXJ7      --------------------------------VD------------NLIVG---------
I9RSN9          --------------------------------VD------------NLIVG---------
U6RJK5          --------------------------------VD------------NLIVG---------
A0A1Q6GA32      --------------------------------VD------------NLIVG---------
I9RPU6          --------------------------------VD------------NLIVG---------
I8Y597          --------------------------------VD------------NLIVG---------
I8YFS5          --------------------------------VD------------NLIVG---------
A0A1Q6GBF5      --------------------------------VD------------NLIVG---------
I8YFZ3          --------------------------------VD------------NLIVG---------
A0A1Q6GDH2      --------------------------------VD------------NLIVG---------
U6RSB0          --------------------------------VD------------NLIVG---------
I9SIK1          --------------------------------VD------------NLIVG---------
I9GXM2          --------------------------------VD------------NLIVG---------
I9TP59          --------------------------------VD------------NLIVG---------
A0A0J6CIR2      --------------------------------ID------------NLIVG---------
A0A3D8HG59      --------------------------------VD------------NLIVS---------
A0A3R6S408      --------------------------------VD------------NLIVS---------
A0A354WXN6      --------------------------------ID------------NLIVG---------
R5IP14          --------------------------------ID------------NLLVT---------
A0A316SZX7      --------------------------------VD------------NLLAS---------
A0A1Y4AIY1      --------------------------------VD------------NLIAG---------
F3ZRU7          --------------------------------VD------------NVISG---------
A0A1C5Q1F3      --------------------------------VD------------NLIAG---------
R7A239          --------------------------------VD------------NLIAG---------
A0A1M6K7I9      --------------------------------VD------------NLIVG---------
A0A3R6HIK7      --------------------------------VD------------NLIKG---------
K5ZVW7          --------------------------------VD------------NLIKG---------
A0A1Y4D5Z0      --------------------------------VD------------NLIVG---------
R5S343          --------------------------------MD------------NLIET---------
A0A3R5ZMK1      --------------------------------VD------------NLIVG---------
A0A3E4ZTK7      --------------------------------VD------------NLIVG---------
A0A1Y3ZIA4      --------------------------------VD------------NLIVG---------
K5Y1A4          --------------------------------VD------------NLIVG---------
A0A3R6K8X4      --------------------------------VD------------NLIVG---------
A0A1Q6I3T6      --------------------------------VD------------NLIVG---------
A0A414XX40      --------------------------------VD------------NLIVG---------
A0A412DM15      --------------------------------VD------------NLIVG---------
A7AEU7          --------------------------------VD------------NLIVG---------
A0A415BDM7      --------------------------------VD------------NLIVG---------
A0A3R5ZYK4      --------------------------------VD------------NLIVG---------
A0A414GI87      --------------------------------VD------------NLIVG---------
A0A3R6BKI7      --------------------------------VD------------NLIVG---------
A0A414LPI6      --------------------------------VD------------NLIVG---------
A0A412M2W1      --------------------------------VD------------NLIVG---------
K5ZX55          --------------------------------VD------------NLIVG---------
K5ZBN2          --------------------------------VD------------NLIVG---------
A0A0J6CKW3      --------------------------------VD------------NLIVG---------
A0A0F5IQM7      --------------------------------VD------------NLIVG---------
S0GLB0          --------------------------------VD------------NLIVG---------
A0A3R6NLC1      --------------------------------VD------------NLIVG---------
A0A416WYC9      --------------------------------VD------------NLIVG---------
A0A0F5IT40      --------------------------------ID------------NLIVG---------
S0GSI7          --------------------------------ID------------NLIVG---------
K5YB65          --------------------------------ID------------NLIVG---------
A0A0F5IWP9      --------------------------------ID------------NLIVG---------
A0A0F5IZT8      --------------------------------ID------------NLIVG---------
A0A417LKQ2      --------------------------------VD------------NLIVG---------
A0A416TME1      --------------------------------VD------------NLIVG---------
A0A416XPE8      --------------------------------VD------------NLIVG---------
L8JI02          --------------------------------VQ------------NIINV---------
A6EBM4          --------------------------------IN------------ASQSR---------
A0A2N3U785      --------------------------------LR------------NIKQG---------
A0A0E3ZG78      --------------------------------LR------------NIKKG---------
A0A1I6BRK6      --------------------------------LR------------NIKNG---------
A0A243WAB1      --------------------------------LR------------NIKKG---------
A0A399SH26      --------------------------------IQ------------NQRDN---------
A0A0E3ZGV6      --------------------------------IR------------NQRDN---------
A0A1I2N4S1      --------------------------------IR------------NQRSN---------
A0A2T5YE44      --------------------------------IR------------NQRSN---------
A0A1M4YED3      --------------------------------VR------------NQKAS---------
A0A3P1Z8V4      --------------------------------LA------------NHVKS---------
A0A2L2WX98      --------------------------------IQ------------SYVKS---------
G5GD56          --------------------------------VR------------SYVRS---------
R6A0L2          --------------------------------LR------------SYVNS---------
R7LG80          --------------------------------VA------------NYIST---------
A0A1M6XHU0      --------------------------------KQ------------LAIQE---------
D0MHQ9          --------------------------------KQ------------LAIQE---------
G2SF81          --------------------------------KQ------------LAIQE---------
A0A2H3NSN0      --------------------------------QE------------ATVRQ---------
A0A2P6C324      --------------------------------QT------------IKIEQ---------
A0A126PFG0      --------------------------------VK------------NIKAS---------
A0A3M1N7Z3      --------------------------------VE------------QRKQE---------
R7PCR1          --------------------------------VR------------SYVNS---------
A0A2A8CVM9      --------------------------------QE------------IRIGQ---------
A0A3C0ZQC7      --------------------------------TQ------------IQIQS---------
A0A2E3R1D0      --------------------------------AR------------VAVRG---------
A0A2T2USC0      --------------------------------RR------------IEVNG---------
A0A2T2V0F3      --------------------------------KR------------IEVSG---------
A0A2T2S682      --------------------------------KE------------IQVNG---------
D5H561          --------------------------------KK------------IQITG---------
A0A2H3NWA9      --------------------------------QR------------IQISG---------
A0A2A8CVB6      --------------------------------HR------------IEVSG---------
A0A2P6C1S6      --------------------------------KR------------IEING---------
A0A2T2UTM4      --------------------------------QR------------IEVNG---------
A0A1T5MMH4      --------------------------------LA------------ELKKE---------
A0A2W4R1L8      --------------------------------LT------------ELRDS---------
A0A2E5CV79      -----VQQLIAQGITSQDPLAERQKIISDILSLD------------AEIFG---------
A0A2A4G4B1      --------------------------------LE------------GYIGQ---------
A0A2D4ZVH1      LSSGSDLYLSFIGSGDGTLTQRIAEISQKLIELK------------VEQAQ---------
A0A0E3V905      --------------------------------IL------------TMKNM---------
A0A1M6GR99      --------------------------------IA------------AAARS---------
A0A1M5BA90      --------------------------------IQ------------NQRMS---------
A0A1V9F098      --------------------------------LR------------AQRIN---------
A0A1V9FHD0      --------------------------------LR------------MHRIN---------
A0A1T5CS78      --------------------------------VK------------SQRQN---------
A0A0Q9Z8F1      --------------------------------VK------------SQKQN---------
A0A2N0U0M7      --------------------------------VK------------SQRQN---------
A0A1M6TTV4      --------------------------------LT------------SYLDN---------
A0A1Q6IT42      --------------------------------VS------------KAKES---------
K0X1U5          --------------------------------VS------------KAKES---------
A0A416XAH0      --------------------------------VS------------KAKES---------
R5EXK3          --------------------------------VS------------KAKES---------
A0A401UAP7      --------------------------------LT------------ELEKI---------
A0A1W2GF52      --------------------------------LL------------AYKNN---------
A0A2G5L7B8      --------------------------------LV------------SYQEN---------
A0A0D3LFR6      --------------------------------LQ------------LYESD---------
M7N6D4          --------------------------------IQ------------GYESG---------
A0A364XUP5      --------------------------------IN------------ALRTD---------
A0A1M5RLA9      --------------------------------LE------------EQRAE---------
A0A385SFR9      --------------------------------LE------------EQRAE---------
L8JW09          --------------------------------LE------------KLKTR---------
A0A1Q3ZMZ7      --------------------------------IE------------VLEKK---------
A0A2D8JJW3      --------------------------------LD------------IRVKV---------
A0A2W2AFF7      --------------------------------LA------------SLKRE---------
A0A2N5YXE2      --------------------------------IG------------STIER---------
A0A2I0QZ80      --------------------------------ID------------ALIER---------
A0A2U2XBJ3      --------------------------------ID------------LLSQR---------
A0A3E1F1A3      --------------------------------VV------------LLSSR---------
A0A1V9F383      --------------------------------LK------------NYRLS---------
G8TRZ6          --------------------------------LR------------NYRIS---------
A0A2W1NDY9      --------------------------------LK------------AIKNQ---------
A0A1G0CI31      --------------------------------VD------------AIEER---------
F2IKD6          --------------------------------IE------------VIQER---------
A0A1I7BM74      --------------------------------IN------------ALEEK---------
A0A2G2FJ17      --------------------------------II------------VLKDR---------
A0A416X8R7      --------------------------------MD------------SYLST---------
K0XJ09          --------------------------------MD------------SYLST---------
R5EUZ0          --------------------------------MD------------SYLST---------
W0EQS0          --------------------------------LN------------NYIST---------
A0A1Y3WE15      --------------------------------LS------------NYIST---------
A0A1Y4GUK3      --------------------------------LS------------NYIST---------
A0A2U1FKU2      --------------------------------VD------------NYIKT---------
A0A0A2F954      --------------------------------VD------------NYIKT---------
A0A0A2FW91      --------------------------------VD------------NYIKT---------
A0A2D2N2N1      --------------------------------VD------------NYIKT---------
Q7MWZ2          --------------------------------VD------------NYIKT---------
T2NDT6          --------------------------------VD------------NYIKT---------
W1R7P9          --------------------------------VD------------NYIKT---------
A0A1R4AFZ0      --------------------------------VD------------NYIKT---------
A0A1R4DVZ7      --------------------------------VD------------NYIKT---------
A0A1G9E2A9      --------------------------------ID------------FNRTQ---------
A0A2T2YJE8      --------------------------------LA------------QNIVL---------
A0A3M9N829      --------------------------------IN------------SNKAL---------
A0A0P0CSF9      --------------------------------IN------------GSKGL---------
A0A3M9MNC3      --------------------------------IN------------GSRSL---------
A0A2M6GH67      --------------------------------LQ------------QNIDL---------
A0A127B287      --------------------------------LK------------EGRGY---------
A0A369QP10      --------------------------------LA------------QNKLL---------
A0A418R9X5      --------------------------------LS------------KDRQL---------
A0A428JSJ3      --------------------------------LR------------KNQQL---------
A0A428KI59      --------------------------------LR------------KNQQL---------
W8F1I6          --------------------------------LR------------KNQQL---------
A0A246FQC0      --------------------------------LR------------KNQQL---------
A0A372E5P8      --------------------------------LR------------KNQQL---------
A0A1H3EMW1      --------------------------------LR------------KNQQL---------
A0A1H9ZSN3      --------------------------------LR------------KNQQL---------
A0A0M3RW20      --------------------------------LQ------------QSMQV---------
A0A1S9B3W0      --------------------------------LQ------------QDVKL---------
A0A1W1VRL3      --------------------------------LE------------QNKLL---------
A0A1M6R305      --------------------------------LK------------QSRDL---------
A0A2M9B9H9      --------------------------------IQ------------QNRRL---------
A0A126PDF2      --------------------------------IT------------QARKA---------
A0A2Z3GKA1      --------------------------------IT------------QARKD---------
A0A328BL48      --------------------------------LQ------------QTLKL---------
A0A3S0QKV1      --------------------------------LQ------------QNAEL---------
A0A3R9P8H7      --------------------------------LR------------KDQQL---------
A0A212UCJ7      --------------------------------LR------------QNEQL---------
A0A238WIA7      --------------------------------LV------------QNQQL---------
A0A0W8EDI5      --------------------------------LQ------------QASQL---------
A0A3B7RBP8      --------------------------------LQ------------QARQL---------
A0A1I5WSL8      --------------------------------LR------------QSQKL---------
A0A0U3JVM7      --------------------------------LQ------------QNQKL---------
A0A1G1SSV2      --------------------------------LR------------QNQIL---------
A0A1G1SXV7      --------------------------------LR------------QNQVL---------
A0A243WHR7      --------------------------------LQ------------QNRRL---------
A0A076HRT9      --------------------------------MR------------QNQEL---------
A0A1M6DHW8      --------------------------------LQ------------QNRQL---------
A0A3D1KEX9      --------------------------------LD------------NYVNS---------
A0A358Y7S2      --------------------------------MK------------VIEDR---------
A0A1X7J248      --------------------------------LS------------SKVSI---------
E4TQD2          --------------------------------LN------------NKVEI---------
A0A2J6HHN3      --------------------------------AA------------SLLDK---------
A0A1Y3WMT8      --------------------------------VS------------KAKES---------
A0A1Y4GQU1      --------------------------------VS------------KAKES---------
A0A1V5W8T5      --------------------------------IK------------ISNDR---------
A0A2T8HKA9      --------------------------------VD------------NAVSG---------
A0A3B8INU3      --------------------------------ID------------QERSM---------
A0A098LL25      --------------------------------ID------------INKRI---------
A0A1Q3Q573      --------------------------------TE------------YVIDN---------
A0A357YNR3      --------------------------------LQ------------NEKNN---------
F4KK08          --------------------------------ID------------NLIST---------
A0A3N2N6F7      --------------------------------LN------------TQLRM---------
A0A419VXB7      --------------------------------LD------------NLIFN---------
A0A2V1ILM4      --------------------------------LT------------NQERA---------
A0A3N2L0E8      --------------------------------LT------------NQERA---------
A0A3N2LFC5      --------------------------------LT------------NQERA---------
C3J7R8          --------------------------------VD------------NLIKS---------
A0A0B0BTJ4      --------------------------------IE------------NVANS---------
A0A3B9CNN6      --------------------------------IE------------NVANS---------
R5X290          --------------------------------IE------------NVANS---------
A0A1Q6E6I7      --------------------------------IE------------NVANS---------
A0A2G2F510      --------------------------------VS------------AIENR---------
A0A316JZ08      --------------------------------IA------------TIKLR---------
A0A1I1FXP9      --------------------------------IN------------ETTRF---------
A0A3B9FXJ0      --------------------------------LV------------NAQEQ---------
R5GSU5          --------------------------------VH------------SLVNT---------
A0A2P8EAX2      --------------------------------IR------------SNRSN---------
A0A3N4H5N3      --------------------------------IS------------STKTN---------
A0A2A3UE91      --------------------------------LD------------GVRLK---------
A0A0A2G557      --------------------------------ID------------NYIKS---------
A0A2N2WFW8      --------------------------------AS------------GIIAK---------
A0A1F3IU95      --------------------------------TI------------GLLTK---------
A0A3D0VUF6      --------------------------------TI------------GLLTK---------
A0A1T4PT95      --------------------------------ID------------NYIKS---------
A0A3Q9FR88      --------------------------------IK------------FAEEF---------
A0A150ADJ9      --------------------------------IK------------FAEEF---------
A0A1B1FWQ4      --------------------------------IR------------FAEQF---------
A0A1S1Z228      --------------------------------IK------------FAEQF---------
A0A1F3SJM1      --------------------------------VS------------TIRNR---------
A0A2G2EB96      --------------------------------IG------------AIENR---------
A0A2G6PRA9      --------------------------------IA------------AIEER---------
A1ZKR2          --------------------------------LA------------RVRKN---------
A0A1Q3GX01      --------------------------------IT------------KARKS---------
A0A349DQI4      --------------------------------IA------------KARKG---------
A0A2N3IIZ0      --------------------------------ID------------RYKKK---------
A0A2A4PYG9      --------------------------------IK------------SLSRK---------
A0A2A5FYT6      --------------------------------LK------------AMKDK---------
A0A2E6SYP1      --------------------------------VS------------NLIVE---------
A0A2E5RLE8      --------------------------------TK------------NIILD---------
A0A2E7TQF6      --------------------------------TK------------NIILD---------
A0A2E6GVY9      --------------------------------TK------------NIILD---------
A0A350JJ90      --------------------------------LE------------VLQKR---------
A0A3M1CDV2      --------------------------------LY------------TLKQK---------
A0A2E2TFD1      --------------------------------II------------SMEVN---------
A0A2E4ELE6      --------------------------------IN------------SSSNK---------
A0A2E3XZI5      --------------------------------IK------------KAVKL---------
A0A2M7NLQ9      --------------------------------IT------------LNQRM---------
I4AFR0          --------------------------------IT------------LHQRL---------
A0A2N2Y3E5      --------------------------------LQ------------TSINR---------
A0A2D9D7T6      --------------------------------LI------------IIEER---------
A0A1F3PPL5      --------------------------------IK------------NTIKT---------
A0A357QK06      --------------------------------IK------------NTIKT---------
A0A2A5B3B0      --------------------------------IN------------SSISK---------
A0A0F2NS19      --------------------------------IN------------SLISK---------
A0A2A5H8X6      --------------------------------IN------------SLITK---------
A0A2H0GAU8      --------------------------------IS------------SLVVK---------
A0A2M8FTK1      --------------------------------IS------------SLVVK---------
A0A0S2HYK8      --------------------------------VK------------NNINR---------
A0A2N5ZWN6      --------------------------------VN------------NNLSR---------
A0A2E0FJ09      --------------------------------IK------------SLLNK---------
A0A1F3FZ62      --------------------------------LK------------SYKSN---------
A0A1F3K211      --------------------------------LK------------SYKSN---------
A0A1F3KLL5      --------------------------------VK------------TTIIR---------
A0A359D1M1      --------------------------------VK------------TTIIR---------
A0A2E7CT70      --------------------------------IS------------KAIEL---------
A0A2D5V560      --------------------------------IK------------KAVKL---------
A0A2D7K5A8      --------------------------------IK------------KAVKL---------
A0A2E1XQ82      --------------------------------IK------------KAVKL---------
A0A1V6I2U9      --------------------------------TR------------STIKR---------
A0A1F3C1M2      --------------------------------IS------------STLSR---------
A0A1F3DS87      --------------------------------IS------------STLSR---------
A0A2H0B957      --------------------------------IK------------SNYNR---------
A0A1F3CFW6      --------------------------------IK------------SNYNR---------
A0A2M7E2T8      --------------------------------IK------------SNYNR---------
A0A2M7NC69      --------------------------------IK------------SNYNR---------
A0A1F3K695      --------------------------------IT------------SAISR---------
A0A353KZR1      --------------------------------IT------------SAISR---------
A0A2N2WYB5      --------------------------------IN------------STVQR---------
A0A1F3K4G0      --------------------------------VN------------STIVR---------
A0A356H8Y3      --------------------------------VN------------STIVR---------
A0A351HSA6      --------------------------------VN------------STIVR---------
A0A1F3Q014      --------------------------------IN------------SVKNN---------
A0A2A4YXP3      --------------------------------IN------------SSNDK---------
A0A2D5KD44      --------------------------------IN------------SLIDK---------
A0A1F3R158      --------------------------------IL------------SLVEK---------
A0A2M8ADX2      --------------------------------II------------SLVEK---------
A0A1J5B2H0      --------------------------------IK------------SLKNN---------
A0A1V5N756      --------------------------------IK------------IALDN---------
                                                                            

A0A1I3J6V0      --------------------------------------------------------DSAR
A0A1H4ADG3      -------------------------LEAGI--------------GSMQQNEGA---LNNK
A0A3D5KRY6      -------------------------AKLEQ--------------KTLDDQQAR---INSE
A0A1V5IPN7      -------------------------VLMRIVQAEVELEIARTHVNGLEQTKAI---FEDR
A0A1V3WH52      -------------------------LLEKR--------------RTLEEEKAK---LNDR
A0A2K8Z965      -------------------------LLSTR--------------QQYLAKNGE---VEGA
A0A418M8U8      -------------------------LMSSQ--------------QQYRTKNAQ---LESS
I2GTA4          -------------------------LMSSQ--------------QQYRAKNAQ---LESS
A0A2K8ZAJ2      -------------------------LISNR--------------NQLVANNQR---MEGM
A0A368JPA3      -------------------------LTNTR--------------SQLLAANKR---LEAR
A0A3P1BT12      -------------------------LTNTR--------------SQLLATNKR---YEAR
A0A3P1CI15      -------------------------LINTR--------------SQLLATNKR---YESR
A0A1Q3PII2      -------------------------LALSI--------------AAIRTYGKE---FDTQ
A0A351BXT2      -------------------------VAQRLLEAGVGVQSLNTKVNTLSKMLGK---YEVQ
A0A3D0MYJ7      -------------------------LTTELFKANIQKQAIQNKIGIVNSLSSQ---YNAQ
A0A3D3LS70      -------------------------ITAELLRSGISIQSSNARFNSLRNLLGK---YEGE
A0A1G7ZF38      -------------------------LTLSI--------------AAIREYGRG---FENA
C6VS52          -------------------------LALRL--------------ASVHAYGKG---FHAE
A0A1G1TM36      -------------------------LLTTI--------------RELRSFNSG---FKSS
A0A1V3WH27      ----------------------------------------------LERERER---LNNR
A0A0D3L8Q3      -------------------------MEITR--------------NNLQSNYAQ---FESK
A0A0K8QSK7      -------------------------AEVRL--------------DDLNRRIRA---RESQ
A0A1V6CN82      -------------------------NHQML--------------ADLQRRTAM---VEAR
A0A1M4XZ45      -------------------------SDMAL--------------GNLNQRIRQ---FEGE
A0A399D319      -------------------------SDMAL--------------VNLNKRVRQ---FEAQ
A0A0P7X1V8      SDGNVSNRFMTLRNEVLLLEVERQQLEAQR--------------NLLEERAAE---YRAF
A0A3B0C2S4      -------------------------LKLSL--------------RQLNREKSQ---ANSM
A0A416GA42      -------------------------LQLRL--------------RSTVQQEVR---SSGK
A0A3N2M1H3      -------------------------LKTRL--------------RSFREEKIK---TTGK
A0A1T3IYP5      -------------------------LRIKL--------------NNAQREEGV---AQSK
A0A212K7W5      -------------------------LDTQI--------------RNIQKSETK---INER
F5IU11          -------------------------LDTQI--------------KHTQKSETK---INER
A0A352Z1R7      -------------------------LNKQQ--------------SSVTHQLDI---YESK
A0A0A2F501      -------------------------LDNQA--------------RSLKTRSGQ---ATAR
R5B7P0          -------------------------LNTKY--------------ENLKGTARQ---NTAR
R5B0L5          -------------------------LETQM--------------RNLQSSKAG---TTAR
A0A374THP7      -------------------------LKTQL--------------GTLQANEAA---TTTQ
A0A3R5XWG1      -------------------------LRTQL--------------GTLQANEAH---TTSQ
A0A414YFM3      -------------------------LRTQL--------------GTLQANEAH---TTSQ
A0A0A2EVS5      -------------------------LSNQI--------------KTLRAQESK---STSR
A0A1T4NAJ7      -------------------------LSNQI--------------KTLRAQESK---STSR
A0A2V1IJY1      -------------------------LNMQI--------------SSLQGSQAS---TTSK
A0A3N2KCL3      -------------------------LNMQI--------------SSLQGSQAS---TTSK
A0A255T941      -------------------------INSQI--------------NSNRQQEAT---SINK
A0A1Y4CHN5      -------------------------LNTQI--------------ETLEQTNEQ---IMAK
A0A1Y3V692      -------------------------LNTQI--------------RSIRQQEAA---TTSQ
A0A174TYU6      -------------------------LNTQI--------------RSIRQQEAA---TTSQ
A0A1M6I2S6      -------------------------LNTQI--------------RSIRQQEAA---TTSQ
F3PXM2          -------------------------LDTQL--------------QSVRRREAA---TTGQ
A0A3E4ZNL4      -------------------------LNTQI--------------RSIRQQEAM---NTQQ
A0A174AHH7      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A174JCE8      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A3E4JMC4      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A412SND6      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A414IEQ9      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A415UKN5      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A0M1W8D8      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A3R6GKX5      -------------------------LNTQI--------------RSIRQQEVA---TTQQ
A7V4S1          -------------------------LNTQI--------------RSIRQQEVA---TTQQ
B0NU19          -------------------------LNTQI--------------RSIRQQEVA---TTQQ
D4V601          -------------------------LNTQI--------------RSIRQQEVA---TTQQ
A0A397WLT5      -------------------------LNTQI--------------RSIRQQEVA---TTQQ
A0A3R6GM96      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A015XH67      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A078RZN2      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A6L0K5          -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A7ACT5          -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A6KY94          -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A173UQR8      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A3R6HK75      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A412B7D1      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A412VNY9      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A414LTU9      -------------------------LNTQI--------------RSIRQQEAT---TTQQ
I9Q4U4          -------------------------LNTQI--------------RSIRQQEAT---TTQQ
A0A373ISF0      -------------------------LNTQI--------------RSIRQQEAT---TTSQ
U6RF62          -------------------------LNTQI--------------RSIRQQEVT---TTSQ
A0A073I794      -------------------------LNTQI--------------RSIRQQEAA---TTQQ
A0A108TH71      -------------------------LNTQI--------------RSLRRQEEA---TTNR
I8VXH0          -------------------------LNTQI--------------RSLRRQEEA---TTNR
A0A412S0N6      -------------------------LNTQI--------------RSLRRQEEA---TTNR
A0A412IIJ0      -------------------------LNTQI--------------RSLRRQEEA---TTNR
A0A0P0FM97      -------------------------LNTQI--------------RSLRRQEEA---TTNR
R6KTP3          -------------------------LNTQI--------------RSLRRQEEA---TTNR
A0A139LU87      -------------------------LNTQI--------------RSLRRQEEA---TTNR
A0A1C6B3Y5      -------------------------LNTQI--------------RSLRRQEEA---TTNR
E2NMQ4          -------------------------LNTQI--------------RSLRRQEEA---TTNR
A0A412YDB9      -------------------------LNTQI--------------RSLRRVEDA---TTTR
R7DY01          -------------------------LNTQI--------------RSLRRVEDA---TTTR
A0A414LGK8      -------------------------LNTQI--------------RSLRRVEDA---TTTR
A0A016E4F9      -------------------------LNTQI--------------RSIRQQEAA---TTSQ
A0A413PP50      -------------------------LNTQI--------------RSIRQQEAA---TTSQ
A0A3A5TI83      -------------------------LNTQI--------------RNIRQQEAT---TTSQ
A0A415NEB6      -------------------------LNTQI--------------RNIRQQEAT---TTSQ
A7AJ60          -------------------------LNTQI--------------RNIRQQEAT---TTSQ
A0A015UXN7      -------------------------LNTQI--------------RNIRQQEAT---TTSQ
A0A395YYT3      -------------------------LNTQI--------------RNIRQQEAT---TTSQ
A0A415IPQ4      -------------------------LNTQI--------------RSIRQQEDA---TTNR
A0A3E5BRW7      -------------------------LNTQI--------------RSIRQQEEA---TTNR
K9DXS6          -------------------------LNTQI--------------RSIRRQEEA---TTSR
A0A1M6KFV3      -------------------------LNTQI--------------RSILRQEEA---TTNR
A0A1Q6G7L3      -------------------------LNTQI--------------RSILRQEEA---TTNR
A0A413H235      -------------------------LNTQI--------------RSINRQEEA---TTNR
A0A1M5B2J8      -------------------------LEAQI--------------RSQQSYGGQ---ATSQ
A0A255RCT5      -------------------------LEAQI--------------RSQQSYGGQ---ATSQ
A0A1Y4GLF5      -------------------------LNAQI--------------KSLQYSEQQ---TTSR
A0A1H3XSC0      -------------------------LNAQI--------------ESLQRSEQQ---TTSR
B3JI46          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A174UR09      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A6LE40          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
R6NN15          -------------------------LNTQI--------------HSLEKSDQR---ATER
A0A358R8U0      -------------------------LNTQI--------------ASLQQNEQK---TTAR
R6WSB6          -------------------------LNTQI--------------ASLQQNEQK---TTAR
A0A401LPX7      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A3A5Z900      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A3R6I893      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A3R6EGW5      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A285TGL6      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A3A5RFX4      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A1Q6IUW9      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A3R6NPG7      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A413XDP6      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
K6AP24          -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A076IQN8      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A078RYI7      -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
C7XEQ8          -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
D7INX6          -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
K5ZG55          -------------------------LRAQI--------------RSLEAIGGQ---ATSQ
A0A3N2N9B8      -------------------------LNTQL--------------RSLQATQAS---TTSK
A0A3N2NMI0      -------------------------LNTQL--------------RSLQHSQAS---TTSK
A0A359I8H7      -------------------------LNKSL--------------RNMEGAKGA---AESQ
A0A3N2KA63      -------------------------LNKSL--------------RNMEGAKGA---AESQ
A0A3B9FAU3      -------------------------IDLQL--------------SHAQQNENQ---ATAK
A0A3C1E5L7      -------------------------IDLQL--------------SHAQQNENQ---ATAK
A0A354SN68      -------------------------LKLEL--------------SLQKKHEQK---TAKK
A0A0A2DUD9      -------------------------IETQL--------------MSLRSSERK---NAGR
A0A3N2N595      -------------------------LQAQI--------------NSLNSAQVS---TTSK
R5FHS9          -------------------------LDNQI--------------GAYGSQEST---NNAK
A0A3P1ZBJ5      -------------------------IKTQI--------------RNLEAQEKM---LTSK
A0A413TW79      -------------------------LNSQL--------------GNLQANEAQ---TTSQ
A0A3E5E9M7      -------------------------LNSQL--------------GNLQANEAQ---TTSQ
A0A3E4SK73      -------------------------LNSQL--------------GNLQANEAQ---TTSQ
A0A415GGC6      -------------------------LNSQL--------------GNLQANEAQ---TTSQ
A0A413DBH9      -------------------------LNSQL--------------GNLQANEAQ---TTSQ
G9S1S8          -------------------------LNAQI--------------KNLERSGQQ---TTTR
A0A354M4S6      -------------------------LNAQI--------------KNLERSGQQ---TTTR
R7DH52          -------------------------LNAQI--------------KNLERSGQQ---TTTR
A0A396N3D5      -------------------------LNAQI--------------KNLERSGQQ---TTTR
A0A415ZDP9      -------------------------LNAQI--------------KNLERSGQQ---TTTR
A0A016CWA4      -------------------------LNAQI--------------RSLQQTERQ---TTSR
A0A1C6H117      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A415TAH7      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A0M1W0V2      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A139KA16      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A174VQ92      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A1Q6HCG0      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A1Y4JYM9      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A5QW67      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A5RQE6      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A6BP07      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E5E153      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3Q9IP20      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A412WV15      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A413ICP6      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A414KYB9      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A416X133      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
E5WX00          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
K0X3P3          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A5Z014      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A1M4YZ07      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A078S3Q8      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A069SJV7      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E5DXI5      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E5EM98      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E5F453      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
I9T3G6          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A0P0FQW1      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
C3RFN5          -------------------------LNSQI--------------KSLQQTEQQ---TTSR
A0A3E4SYU0      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A6LGY1          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
K5ZSH4          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A078T2W6      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3R6D1V4      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3R6EAF7      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A412MJT7      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E4WKT5      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A5YY33      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A078TAH2      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A1E9CFZ7      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A373FYU5      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A5TZ72      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A5XBP2      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3A6MEG9      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E4JP35      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E4KP40      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E4NX82      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A3E4XFU8      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A412RG70      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A412TD37      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A413GAA4      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A414M7I4      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
E5UZA2          -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A069SMG6      -------------------------LNSQI--------------KSLRQTEQQ---TTSR
A0A1Y4PQK7      -------------------------LNTRI--------------RDLQRSEQQ---TAGR
A0A1Y3ZDB3      -------------------------LNTRI--------------RNLQRNEQQ---TTDR
A0A3A6AAP4      -------------------------LNTRI--------------RNLQRNEQQ---TTDR
A0A1Y4IH41      -------------------------LNTRI--------------RNLQRNEQQ---TTDR
A0A1Y4DYA7      -------------------------LNTQI--------------KALQQSERQ---TTAR
A0A1Y3X4I9      -------------------------LNTQL--------------RALQQSERQ---TTAR
A0A1Y4FNK8      -------------------------LNTQL--------------RSLRQSEQQ---TTAR
A0A355FD59      -------------------------LNTQT--------------ANLQKSEQQ---TTAQ
A0A359CEZ9      -------------------------LNTQT--------------ANLQKSEQQ---TTAQ
A0A353Q7B4      -------------------------LNTQT--------------ANLQKSEQQ---TTAQ
A0A1M3KVR9      -------------------------LNTQT--------------KNLQSNEQE---TTAQ
F8X3A5          -------------------------LNTQI--------------KNLQSNEQE---TTAQ
A0A3C1ITV0      -------------------------LKIQA--------------DRLSAQENA---IENR
R7HN19          -------------------------LKIQA--------------DRLSAQENA---IENR
A0A415EEZ4      -------------------------LQIKL--------------NDAQRQEAL---TAHR
A0A060RD97      -------------------------LKIKQ--------------QNIRNEENL---SNRR
A0A350IHV0      -------------------------LQMQV--------------DKIEAQEND---IMSR
A0A077ENE7      -------------------------LNIKL--------------NNTKQEESV---AQGK
T0NN57          -------------------------LAIKQ--------------GNAQREENI---AQGK
X5K347          -------------------------LAIKQ--------------GNAQREENI---AQGK
A0A1T5K9D4      -------------------------LNVQK--------------RDLLRQEAT---AMEK
R5RVP0          -------------------------LQLQA--------------DQLESEENL---IMSH
A0A285T4L1      -------------------------INMKR--------------NDARSRQAQ---AQAR
A0A3E5BU42      -------------------------INMKR--------------NDARSRQAQ---AQAR
A0A414ZBF2      -------------------------LKMQV--------------RNMKRKELE---NMNR
R5KD55          -------------------------LSTRI--------------GHIQNDEQK---TNTD
A0A174QNT3      -------------------------IRLRL--------------QNARKVESQ---VNQS
R9I0H0          -------------------------IRLRL--------------QNARKVENK---VNQN
K5BUT9          -------------------------LHLRL--------------DKAKVVENR---LASS
A0A174FPA3      -------------------------LRLRL--------------DKAKAVENR---LASS
R6S9Y6          -------------------------LRLRL--------------DKAKAVENR---LASS
C9KX15          -------------------------LRLRL--------------DKAKAVENR---LASS
A0A3L8AAP1      -------------------------LRLRL--------------EKTRAVERQ---INSE
R6DAG6          -------------------------LRLRL--------------EKTRAVERQ---INSE
A0A1G8BVM8      -------------------------LKIQL--------------KKYNSEEQK---SNSK
A0A416GGJ1      -------------------------LNVRR--------------RDALSRETR---AQVR
A0A3D1NQW3      -------------------------LQIQL--------------AALRKEEAL---TNQR
B0MT10          -------------------------LQIQL--------------AALRKEEAL---TNQR
R7JGW9          -------------------------LQIQL--------------AALRKEEAL---TNQR
A0A0E2M2Y7      -------------------------LNLQL--------------REVNREMSR---TKEQ
A0A0K2J6Z0      -------------------------LNLQL--------------REVNREMSR---TKEQ
B2RKZ8          -------------------------LNLQL--------------REVNREMSR---TKEQ
A0A212GC82      -------------------------LNLQL--------------REVNREMSR---TKEQ
A0A254MU12      -------------------------LNLQL--------------REVNREMSR---TKEQ
R6CQ93          -------------------------INMKR--------------SDARSRQEQ---AQKR
A0A3D2BF46      -------------------------LEIQL--------------NNIRREESL---ARTR
A0A358R538      -------------------------LTLQR--------------DAMRGEEAT---ADDR
A0A1Y4AAB8      -------------------------LEIQR--------------NALRSEEEQ---ANRR
A0A1Y3WWY9      -------------------------LEIQR--------------DAMRREEEL---ANRR
A0A1Y4U5L4      -------------------------LEIQR--------------DAMRREEEL---ANRR
A0A1Y3VCJ1      -------------------------LEIQR--------------NAMRNEEES---ANRR
A0A1Y3QTW7      -------------------------LEIQL--------------TNMRKEEAL---ANHR
R6XWY7          -------------------------LEIQL--------------TNMRKEEAL---ANHR
A0A174AVF1      -------------------------LEIQL--------------SNMRKEEAL---ANHR
A0A373HTL7      -------------------------LEIQL--------------SNMRKEEAL---ANHR
A0A1Q6EIY0      -------------------------LEIQL--------------ETMRKEEAQ---VNRR
E4M8L3          -------------------------LEIQL--------------ETMRKEEAQ---VNRR
I3YQ50          -------------------------LEIQL--------------ETMRKEEAQ---VNRR
R5UEY8          -------------------------LEIQL--------------ETMRKEEAQ---VNRR
A0A1H4D866      -------------------------LIIQR--------------DAMRKEETQ---ANRR
A0A374A9J5      -------------------------LEIQR--------------DAMRKEETQ---ANIR
A0A1Q6E9S3      -------------------------LEIQR--------------DAMRKEETQ---ANIR
D4IJ36          -------------------------LEIQR--------------DAMRKEETQ---ANIR
A0A414Q925      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A415PUS9      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A108TCU0      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A413BA42      -------------------------LEIQV--------------VNMKNKERE---NSNK
S3Y344          -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A413MY74      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A412TGL3      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A413VJ33      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A414L0W6      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A412DP39      -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A413ZSE8      -------------------------LEIQV--------------ANMKNKERE---NSNK
B0NP84          -------------------------LEIQV--------------ANMKNKERE---NSNK
R6AK43          -------------------------LEIQV--------------ANMKNKERE---NSNK
A0A412N2D9      -------------------------LEIQA--------------ANMKNKERE---NSDK
R6LHA4          -------------------------LEIQA--------------ANMKNKERE---NSDK
A0A1Q6FL18      -------------------------LEIQA--------------ANMKNKERE---NSDK
A0A1Y4JYS9      -------------------------LEIQA--------------ANMKNKERE---NSDK
A0A3E5HPT8      -------------------------LRLKK--------------QDYMRQESH---VRQK
C6IJ48          -------------------------LRLKK--------------QDYMRQESH---VRQK
Q8A3U2          -------------------------LRLKK--------------QDYMRQESH---VRQK
A0A3R6S1H6      -------------------------LNAQL--------------QRIEQQERQ---ANRR
A0A3R6SD81      -------------------------LNAQL--------------QRIEQQERQ---ANRR
A0A413VXJ7      -------------------------LNIKL--------------KNNREHEEQ---TQKR
I9RSN9          -------------------------LNIKL--------------KNNREHEEQ---TQKR
U6RJK5          -------------------------LNIKL--------------KNNREHEEQ---TQKR
A0A1Q6GA32      -------------------------LNIKL--------------KNNREHEEQ---TQKR
I9RPU6          -------------------------LNIQL--------------KNIREQEEQ---TSKR
I8Y597          -------------------------LNIQL--------------KNIREQEEQ---TTKR
I8YFS5          -------------------------LNIQL--------------KNIRDQEEQ---TTKR
A0A1Q6GBF5      -------------------------LNIQL--------------KNIREQEEQ---TTKR
I8YFZ3          -------------------------LNIQL--------------KNIREQEEQ---TSKR
A0A1Q6GDH2      -------------------------LNIQL--------------KNIREQEEQ---TTKR
U6RSB0          -------------------------LNIQL--------------KNIREQEEQ---TSKR
I9SIK1          -------------------------LNIQL--------------KNIREQEEQ---TTKR
I9GXM2          -------------------------LNIQL--------------KNIREQEEQ---TTKR
I9TP59          -------------------------LNIQL--------------KNIREQEEQ---TTKR
A0A0J6CIR2      -------------------------LNIKI--------------KNIREREAQ---TSRR
A0A3D8HG59      -------------------------LNIQI--------------KNVRSREEQ---NVRR
A0A3R6S408      -------------------------LNIQI--------------KNVRSREEQ---NVRR
A0A354WXN6      -------------------------LNVKI--------------NNVQNQAAQ---TSRR
R5IP14          -------------------------LNIRM--------------KSIQEQEQI---ARHK
A0A316SZX7      -------------------------LKISM--------------EQIREQENR---TMNR
A0A1Y4AIY1      -------------------------LNISI--------------RNVQAQEEQ---LQKR
F3ZRU7          -------------------------LNLKL--------------KNIRARDKQ---TNQR
A0A1C5Q1F3      -------------------------LDMKI--------------QNIRGEEER---AMKR
R7A239          -------------------------LDMKI--------------QNIRGEEER---AMKR
A0A1M6K7I9      -------------------------ININL--------------KNLREQERQ---TAKR
A0A3R6HIK7      -------------------------LEINI--------------KNIQMQEAQ---TAKR
K5ZVW7          -------------------------LEINI--------------KNIQMQEAQ---TARR
A0A1Y4D5Z0      -------------------------LNINI--------------ENVRAQEAQ---MERR
R5S343          -------------------------LDIKI--------------KSVREKESE---TNRK
A0A3R5ZMK1      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A3E4ZTK7      -------------------------LNIKI--------------KNVQAQEEQ---TNRR
A0A1Y3ZIA4      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
K5Y1A4          -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A3R6K8X4      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A1Q6I3T6      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A414XX40      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A412DM15      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A7AEU7          -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A415BDM7      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A3R5ZYK4      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A414GI87      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A3R6BKI7      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A414LPI6      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
A0A412M2W1      -------------------------LNIKI--------------KNIRAQEEQ---TSRR
K5ZX55          -------------------------LNIKI--------------KNIRAQEEQ---TSRR
K5ZBN2          -------------------------LNIKI--------------KNIREREVQ---TTRR
A0A0J6CKW3      -------------------------LNIKI--------------KNIREREVQ---TTRR
A0A0F5IQM7      -------------------------LNIKI--------------KNIREREVQ---TTRR
S0GLB0          -------------------------LNIKI--------------KNIREREVQ---TTRR
A0A3R6NLC1      -------------------------LNIKI--------------KNIREREAQ---TTRR
A0A416WYC9      -------------------------LNIKI--------------KNIREREAQ---TTRR
A0A0F5IT40      -------------------------LNIKI--------------KNIREREAQ---TSRR
S0GSI7          -------------------------LNIKI--------------KNIREREAQ---TSRR
K5YB65          -------------------------LNIKI--------------KNIREREAQ---TSRR
A0A0F5IWP9      -------------------------LNIKI--------------KNIKEREAQ---TSRR
A0A0F5IZT8      -------------------------LNIKI--------------KNIKEREAQ---TSRR
A0A417LKQ2      -------------------------LNIKI--------------KNIKEREVQ---TTRR
A0A416TME1      -------------------------LNIKI--------------KNIKEREVQ---TTRR
A0A416XPE8      -------------------------LNIKI--------------KNIKEREVQ---TTRR
L8JI02          -------------------------TTIAL--------------NDLDQRILR---IRRE
A6EBM4          -------------------------TRKSI--------------DYLAGQIAQ---INGQ
A0A2N3U785      -------------------------LIVTR--------------NNLQKSYAQ---FQTK
A0A0E3ZG78      -------------------------LLITS--------------NNLRANSDE---FESK
A0A1I6BRK6      -------------------------LRISV--------------NNLKASSRQ---FQSK
A0A243WAB1      -------------------------LQITS--------------NNLRSTSGQ---FQSK
A0A399SH26      -------------------------LLASR--------------KNLTNTKGS---YTTA
A0A0E3ZGV6      -------------------------LVSSR--------------SKLSSTNSS---YSSV
A0A1I2N4S1      -------------------------LLASR--------------DKVASTSSQ---YSHV
A0A2T5YE44      -------------------------LLASR--------------DKVASTSSQ---YSHV
A0A1M4YED3      -------------------------LQASK--------------GDLARTNGM---YNSM
A0A3P1Z8V4      -------------------------IELEL--------------RAARSTQSR---FDGQ
A0A2L2WX98      -------------------------VEMEL--------------KEAGQNEAA---INSQ
G5GD56          -------------------------IEMQV--------------NAARSNEKS---LMGQ
R6A0L2          -------------------------LEVRL--------------QAARANENM---LTGR
R7LG80          -------------------------CKLQL--------------DDAKAAENM---LTGR
A0A1M6XHU0      -------------------------LERQI--------------EAFNQELAK---YEDQ
D0MHQ9          -------------------------LERQV--------------EAFNQELAK---YEGQ
G2SF81          -------------------------LERQV--------------EAFNQELAK---YEDQ
A0A2H3NSN0      -------------------------LQGQV--------------SRLNNRIGG---YEDR
A0A2P6C324      -------------------------TEAQI--------------QALEDRISG---YQGR
A0A126PFG0      -------------------------LLATV--------------RELESFNSR---FESS
A0A3M1N7Z3      -------------------------LLYEL--------------STISQNFLR---ERAQ
R7PCR1          -------------------------VSLKA--------------QKARTNENV---LNSA
A0A2A8CVM9      -------------------------IEAQI--------------AGLESAIQS---YEPR
A0A3C0ZQC7      -------------------------LQSKK--------------DALQVVLTQ---YERH
A0A2E3R1D0      -------------------------LEAEV--------------SQVSSRLGQ---YESE
A0A2T2USC0      -------------------------LQAQL--------------ETVQERLDQ---YQQE
A0A2T2V0F3      -------------------------LQAQL--------------ETVKQRLAE---YQQE
A0A2T2S682      -------------------------LRAQI--------------STVERQIEE---NRTR
D5H561          -------------------------LNSRI--------------DVLSERLSE---YEQE
A0A2H3NWA9      -------------------------MEARL--------------SNIDEQLAE---NRTR
A0A2A8CVB6      -------------------------LEARL--------------DAIQNQLEQ---RRAA
A0A2P6C1S6      -------------------------LQARI--------------GAISDRLQE---NRQS
A0A2T2UTM4      -------------------------LKARI--------------AAITNRLAE---TRKK
A0A1T5MMH4      -------------------------WMRRL--------------QEMNQQKSS---MESA
A0A2W4R1L8      -------------------------LLDRL--------------RRLNEQKQR---AEQE
A0A2E5CV79      -------------------------FLQKE--------------QQIENLLSL---YQNK
A0A2A4G4B1      -------------------------IGQQI--------------KGAGSFQGQ---TSTA
A0A2D4ZVH1      -------------------------LKTQE--------------NIISKRYAE---VNNR
A0A0E3V905      -------------------------LLSTQ--------------RQYVEKNGS---VEGA
A0A1M6GR99      -------------------------NEISI--------------NEMQSRIER---IERE
A0A1M5BA90      -------------------------LQASK--------------ANLNSGTST---YVSM
A0A1V9F098      -------------------------LEASK--------------KDLASISGG---YNSM
A0A1V9FHD0      -------------------------LEAGK--------------KDLTSTSGN---YNSM
A0A1T5CS78      -------------------------LQSRL--------------SSLNSNNRR---FNST
A0A0Q9Z8F1      -------------------------LQSRL--------------ANLNSNNRR---FNST
A0A2N0U0M7      -------------------------LQSRL--------------ANLNSNNRR---FNST
A0A1M6TTV4      -------------------------LISTQ--------------KELAEKRKF---LESN
A0A1Q6IT42      -------------------------SDIAR--------------TDLKKQEQE---FRAR
K0X1U5          -------------------------SDIAR--------------TDLKKQEAD---FRSR
A0A416XAH0      -------------------------SDIAR--------------TDLKKQEED---FRSR
R5EXK3          -------------------------SDIAR--------------TDLKKQEED---FRSR
A0A401UAP7      -------------------------VLDQA--------------RRADTRRRL---LERE
A0A1W2GF52      -------------------------LAQDL--------------ADLNKKRTI---LENN
A0A2G5L7B8      -------------------------LVTSQ--------------EELSKKRKI---LESN
A0A0D3LFR6      -------------------------LRKQV--------------DDLQFRHRE---LLSS
M7N6D4          -------------------------IRKEL--------------NNLQNRQKQ---LQST
A0A364XUP5      -------------------------IMKRS--------------QEVAQQKNL---LESE
A0A1M5RLA9      -------------------------WIKRL--------------DQINQKKAR---LEHE
A0A385SFR9      -------------------------WIKRL--------------EQINQKKAR---LEHE
L8JW09          -------------------------DESEV--------------RDLLVRRRR---LEDN
A0A1Q3ZMZ7      -------------------------YDRTY--------------SSAIEKRNA---LELE
A0A2D8JJW3      -------------------------SNNRI--------------ENINREIED---YQTF
A0A2W2AFF7      -------------------------LQTGI--------------RELQARTGG---LDEK
A0A2N5YXE2      -------------------------LKSEK--------------SEYSRKISE---MENQ
A0A2I0QZ80      -------------------------TEEKL--------------KITSKDIKE---LENR
A0A2U2XBJ3      -------------------------IEEKL--------------AIIREDLEE---FEDS
A0A3E1F1A3      -------------------------IKEKL--------------AIIRKDLAE---IEEL
A0A1V9F383      -------------------------LEAGK--------------RNLASISSG---YNSE
G8TRZ6          -------------------------LEAGK--------------RNLASTSND---YNSM
A0A2W1NDY9      -------------------------VKTRK--------------DAVNKRVAN---LELK
A0A1G0CI31      -------------------------ISNNI--------------KVIQAKVNQ---YQGE
F2IKD6          -------------------------IRSQV--------------QVISGKIGE---IEGE
A0A1I7BM74      -------------------------TAERI--------------DFLENEVKE---ARSQ
A0A2G2FJ17      -------------------------LKEKI--------------KVVNTEIAK---LENS
A0A416X8R7      -------------------------LKLKL--------------KKAREVESQ---TLDH
K0XJ09          -------------------------LKLKL--------------RKAREVESQ---TLDR
R5EUZ0          -------------------------LKLKL--------------KKAREVESQ---TLDH
W0EQS0          -------------------------LKLKL--------------GKARSVEEQ---TLSY
A0A1Y3WE15      -------------------------LKLKL--------------EKARKVEAQ---TLDY
A0A1Y4GUK3      -------------------------LKLKL--------------EKARKVEEQ---TLNY
A0A2U1FKU2      -------------------------LSLQL--------------RDVNKEMSR---TREQ
A0A0A2F954      -------------------------LNLQL--------------REVNKEMSR---TKEQ
A0A0A2FW91      -------------------------LNLQL--------------REVNREMSR---TKEQ
A0A2D2N2N1      -------------------------LNLQL--------------REVNREMSR---TKEQ
Q7MWZ2          -------------------------LNLQL--------------REVNKEMSR---TKEQ
T2NDT6          -------------------------LNLQL--------------REVNKEMSR---TKEQ
W1R7P9          -------------------------LNLQL--------------REVNKEMSR---TKEQ
A0A1R4AFZ0      -------------------------LNLQL--------------REVNKEMSR---TKEQ
A0A1R4DVZ7      -------------------------LNLQL--------------REVNKEMSR---TKEQ
A0A1G9E2A9      -------------------------TQERI--------------KEIDRLTEE---LEST
A0A2T2YJE8      -------------------------LQKEV--------------ALVNSNIRH---IQQE
A0A3M9N829      -------------------------VQAQI--------------ENIDRTQGE---LTGK
A0A0P0CSF9      -------------------------VQTKI--------------NNIDRNQSE---LTGK
A0A3M9MNC3      -------------------------VQTKI--------------ENINRNQTE---LTGK
A0A2M6GH67      -------------------------LQNQT--------------ATLTRDINA---IEAE
A0A127B287      -------------------------IQDQI--------------SSIDRNQSL---LTGQ
A0A369QP10      -------------------------LQKEV--------------NLIDTNIRN---IQQE
A0A418R9X5      -------------------------VRRKI--------------AKMAAKKAE---LESK
A0A428JSJ3      -------------------------VRRQL--------------AKMSAKRAE---LEGK
A0A428KI59      -------------------------VRRQL--------------AKMTQKKTD---LEAK
W8F1I6          -------------------------VRRQL--------------AKMAEKKAD---LEAK
A0A246FQC0      -------------------------IQEQI--------------AKLSGKRAE---LDTK
A0A372E5P8      -------------------------LKAQE--------------AKLLGKRAE---LESK
A0A1H3EMW1      -------------------------LKAQE--------------AKLLGKRAE---LETK
A0A1H9ZSN3      -------------------------LKSQE--------------AKLLGKRAE---LEAK
A0A0M3RW20      -------------------------VREQL--------------ATLNQQRGQ---YSAQ
A0A1S9B3W0      -------------------------VREEI--------------SALDRRNGE---FNSQ
A0A1W1VRL3      -------------------------LQEQI--------------EKMNRQRDE---LNAK
A0A1M6R305      -------------------------LAGQL--------------AALDRQRNS---ITSE
A0A2M9B9H9      -------------------------VQTQI--------------DRMNQQRDQ---FNAE
A0A126PDF2      -------------------------LLNKI--------------ALLDRQQNK---LDAK
A0A2Z3GKA1      -------------------------LLSKI--------------ALLDRQQNK---LDAK
A0A328BL48      -------------------------TNDEL--------------NALTRQQQQ---LGGE
A0A3S0QKV1      -------------------------VRQEI--------------AALDRRSAE---FNSE
A0A3R9P8H7      -------------------------LQKQL--------------NKLDAKRAE---MEGR
A0A212UCJ7      -------------------------LQRQL--------------NEMDNKANS---LQGR
A0A238WIA7      -------------------------LQRQL--------------AEMDAKQGA---LQGR
A0A0W8EDI5      -------------------------VRSEV--------------SKLNQQQRE---LEGR
A0A3B7RBP8      -------------------------LQSEL--------------AELDRQQRE---FESR
A0A1I5WSL8      -------------------------LRNEL--------------SRLDQQRNR---LNGD
A0A0U3JVM7      -------------------------LRNEL--------------SRLDQQRSK---LTGA
A0A1G1SSV2      -------------------------LKKEL--------------ARLDQQRAK---LNGA
A0A1G1SXV7      -------------------------LQKEL--------------ARLDQQRAK---LNGE
A0A243WHR7      -------------------------LAQQL--------------SEKSAEQNE---LKNK
A0A076HRT9      -------------------------LRSQL--------------AALDRQRNL---FNSE
A0A1M6DHW8      -------------------------LQNQL--------------GQMSQLQAQ---FNSE
A0A3D1KEX9      -------------------------LQLQL--------------KKIQSVDNR---FQSA
A0A358Y7S2      -------------------------IKSDK--------------LIYSRKLGE---TEQE
A0A1X7J248      -------------------------LKDRK--------------VTALARKRK---IESN
E4TQD2          -------------------------LQDRK--------------STILNRKRE---IENK
A0A2J6HHN3      -------------------------MESDL--------------RQQVNERNK---IAAI
A0A1Y3WMT8      -------------------------SEIAR--------------ADLRKQEVD---FRNR
A0A1Y4GQU1      -------------------------SDIAR--------------ADLKKQEAE---FKNR
A0A1V5W8T5      -------------------------IKTEL--------------DAAKAKTKVEKAIE--
A0A2T8HKA9      -------------------------LQIRV--------------RNAQRDMAS---AQKD
A0A3B8INU3      -------------------------IDEQV--------------RDLVSQRAK---LEAS
A0A098LL25      -------------------------LHQQT--------------AEINAKMVQ---LEQE
A0A1Q3Q573      -------------------------AELEL--------------GKQRERYQK---LMSK
A0A357YNR3      -------------------------LEIQF--------------RDIAAVYNQ---NRAR
F4KK08          -------------------------LEVER--------------QGILSEQSS---YKGR
A0A3N2N6F7      -------------------------LGTQL--------------AALERSDRK---TNAK
A0A419VXB7      -------------------------TENEL--------------KSIKQDIEE---VDKQ
A0A2V1ILM4      -------------------------LQTQL--------------NSLIRSDRV---TSRK
A0A3N2L0E8      -------------------------LQTQL--------------NSLIRSDRA---TSRK
A0A3N2LFC5      -------------------------LQTQL--------------NSLIRSDRA---TSRK
C3J7R8          -------------------------LSVQA--------------ASINRQAGL---NEGR
A0A0B0BTJ4      -------------------------LQIQN--------------ESLRQQLAQ---VSDK
A0A3B9CNN6      -------------------------LQIQN--------------ESLRQQLAQ---VSDK
R5X290          -------------------------LQIQN--------------ESLRQQLAQ---VSDK
A0A1Q6E6I7      -------------------------LQIQN--------------ESLRQQLAQ---VSDK
A0A2G2F510      -------------------------LMQNA--------------RVLKGNLAK---YKDD
A0A316JZ08      -------------------------LNSEA--------------VRLRQEISR---RKFK
A0A1I1FXP9      -------------------------LGKKI--------------SLVNSEIRQ---YENR
A0A3B9FXJ0      -------------------------LEVRK--------------NYLAEQERK---YMGQ
R5GSU5          -------------------------LRLRA--------------ESARRNENT---FNTI
A0A2P8EAX2      -------------------------FEITR--------------KNLEENLNV---NRSQ
A0A3N4H5N3      -------------------------LQIRN--------------NNLVENLDE---STAK
A0A2A3UE91      -------------------------YKSKY--------------KSLLEKSSS---YKNR
A0A0A2G557      -------------------------LNIKL--------------SSINKQSDK---NEGK
A0A2N2WFW8      -------------------------LRREQ--------------QRYIAEKNK----ISR
A0A1F3IU95      -------------------------YKRQY--------------QRYVAEKNN----ILR
A0A3D0VUF6      -------------------------YKRQY--------------QRYVAEKNN----ILR
A0A1T4PT95      -------------------------LNIKL--------------NSINKQSNK---NESK
A0A3Q9FR88      -------------------------LDGNI--------------RDLQREISK---LKTV
A0A150ADJ9      -------------------------LTENI--------------SELQGEIGK---LKHV
A0A1B1FWQ4      -------------------------LDENI--------------NDLQREISK---LRAV
A0A1S1Z228      -------------------------LDDNI--------------KDLQKEISK---LRRV
A0A1F3SJM1      -------------------------LTTNI--------------AIIRSKIGA---EEGE
A0A2G2EB96      -------------------------LSRNI--------------NAIRRKIGS---LEGE
A0A2G6PRA9      -------------------------FSRNI--------------SALRAKIGV---LEGE
A1ZKR2          -------------------------IYKKI--------------VAIQSTINE---LEAD
A0A1Q3GX01      -------------------------IYKKI--------------VDIQSRIRE---LENA
A0A349DQI4      -------------------------IYKKI--------------VDIEARINA---LETA
A0A2N3IIZ0      -------------------------ILKEL--------------TEITQKLAE---IEAN
A0A2A4PYG9      -------------------------FDAKK--------------ETLGAKIKQ---IEDK
A0A2A5FYT6      -------------------------ISARK--------------KNIQKKIKE---YEKT
A0A2E6SYP1      -------------------------LRENI--------------QLIDERLTS---YVVA
A0A2E5RLE8      -------------------------LQENL--------------QLIDERLQS---YRLA
A0A2E7TQF6      -------------------------LQENL--------------QLIDERLQS---YRLA
A0A2E6GVY9      -------------------------LQDNL--------------QLINDRLES---YRIA
A0A350JJ90      -------------------------LIALQ--------------KQTTGKIQS---IEDN
A0A3M1CDV2      -------------------------YRTQY--------------KNLLERKKE---VKTE
A0A2E2TFD1      -------------------------LKNRI--------------TSLKQKIGE---IEGT
A0A2E4ELE6      -------------------------IESRM--------------QNVEQKIKD---IEDT
A0A2E3XZI5      -------------------------LKERY--------------EKSKLKIIN---RKNL
A0A2M7NLQ9      -------------------------IYERL--------------SEIAINIYK---LQSS
I4AFR0          -------------------------IYEQL--------------SEITINIYK---LQSS
A0A2N2Y3E5      -------------------------STEKK--------------NILLEQLKI---FDSQ
A0A2D9D7T6      -------------------------VKESM--------------ALLQGKILE---LESE
A0A1F3PPL5      -------------------------LEKKS--------------IDYEEKILQ---YQNE
A0A357QK06      -------------------------LEKKS--------------IDYEEKILQ---YQNE
A0A2A5B3B0      -------------------------LSIRR--------------VEILKSIDD---VEKK
A0A0F2NS19      -------------------------LELRR--------------KEVVKKVNE---IQAK
A0A2A5H8X6      -------------------------LELRR--------------KEVVKKVNE---IQAK
A0A2H0GAU8      -------------------------LDARR--------------KEVSRRVEE---IQSK
A0A2M8FTK1      -------------------------LDARR--------------KEVSRRVEE---IQSK
A0A0S2HYK8      -------------------------LEEKR--------------AEYQSKIEE---YEEK
A0A2N5ZWN6      -------------------------LKEKR--------------AEYQKKTEE---YENK
A0A2E0FJ09      -------------------------TMTRK--------------ETLTGKLNK---IESK
A0A1F3FZ62      -------------------------MKKRK--------------SQLDDMLDKYTRLDSE
A0A1F3K211      -------------------------MKKRK--------------SQLDDMLDKYTRLDSE
A0A1F3KLL5      -------------------------LNDSK--------------NDYLLKIKE---FEAR
A0A359D1M1      -------------------------LNDSK--------------NDYLLKIKE---FEAR
A0A2E7CT70      -------------------------INKQK--------------RKENKALQQKILLLEK
A0A2D5V560      -------------------------LKKNY--------------KEKAKKLERKIYNYGS
A0A2D7K5A8      -------------------------LKQSY--------------KEKAQKLKRKITYVGN
A0A2E1XQ82      -------------------------LKKSY--------------KEKALKLERKITYVGN
A0A1V6I2U9      -------------------------LNAEK--------------VELDKKNKE---LENI
A0A1F3C1M2      -------------------------LASQK--------------EDYKKKLAE---YEEQ
A0A1F3DS87      -------------------------LESQK--------------EDYKKKLAE---YEEQ
A0A2H0B957      -------------------------ALERK--------------STLTKRLVE---YELK
A0A1F3CFW6      -------------------------ALDKK--------------STLTKKLVE---YELK
A0A2M7E2T8      -------------------------ALDKK--------------STLTKKLVE---YKLM
A0A2M7NC69      -------------------------ALDKK--------------STLTKKLVE---YKLM
A0A1F3K695      -------------------------LSNKK--------------DDYKKKLNE---FEGQ
A0A353KZR1      -------------------------LSNKK--------------DDYKKKLNE---FEGQ
A0A2N2WYB5      -------------------------LESRK--------------NDYKTKIAE---YEER
A0A1F3K4G0      -------------------------METKK--------------GDYQKKIAE---YESK
A0A356H8Y3      -------------------------METKK--------------GDYQKKIAE---YESK
A0A351HSA6      -------------------------METKK--------------GDYQKKIAE---YESK
A0A1F3Q014      -------------------------VKSRK--------------EDLKRKALE---FEGK
A0A2A4YXP3      -------------------------LTTKR--------------IELLAKIDK---LEGK
A0A2D5KD44      -------------------------LNDRL--------------SDLNERVER---SQKE
A0A1F3R158      -------------------------LETRR--------------KDAVNKIEE---IQNK
A0A2M8ADX2      -------------------------LEARR--------------KDAINKIDE---IQNK
A0A1J5B2H0      -------------------------IQHRK--------------SELKIKIQG---Y-EK
A0A1V5N756      -------------------------IINKK--------------KELEKQLAS---Y-NK
                                                                            

A0A1I3J6V0      LPTSP-------------------------------------------------------
A0A1H4ADG3      IRRVP----AQERTFTEYSRQQAIKQELFLFLLQKREESLIA-KSSTVSNARIIVPG-RV
A0A3D5KRY6      LSKLP----KTEQNLIGIKRNFDLNNELYTFLLQRRAEAEIT-RASNTPDATVLDPV-DQ
A0A1V5IPN7      LITLP----DKELEYARLLRSMTLDEKIYGIMMEKYEDARIA-EQAKIGNIRVLDYA-EM
A0A1V3WH52      VTAMP----KTQQEIVRLTRDVESGQQVYMQLLNKQQELKIT-EASTVGDVRIVDPA-IT
A0A2K8Z965      IRTIP----LKERMLMDITRQQAIKNSLYTYLLQKREETAVA-FASAIGDTRTIDFA-LS
A0A418M8U8      IRTIP----QKERTLLTISRQQAIKNNLYTYLLQKREETAVS-HASSISDSRTIDVA-QS
I2GTA4          IRTIP----QKERTLLTISRQQAIKNNLYTYLLQKREETAVS-HASAISDSRTIDVA-QS
A0A2K8ZAJ2      IRTVP----GKERALLNITRQQGIKNNLYTYLLQKREETALS-AASRVSDSRIVDPA-HT
A0A368JPA3      IGVIP----GKERALMNITRQQAIKNNLYNYLLQKQEETALS-FASVASNSQVIDAA-SG
A0A3P1BT12      IRVIP----GKERMLMNITRQQAIKNNLYNYLLQKQEETALS-YASIASNSQVIDAA-SS
A0A3P1CI15      VRVIP----GKERMLMNITRQQAIKNNLYNYLLQKQEETALS-FASIASTSQVIDAA-SG
A0A1Q3PII2      IARVP----EHQRAFLAQSREQGIQQELYLFLLKKRMETAIS-RSANIANARIVDPP-KA
A0A351BXT2      FSKLP----TQSIEYAKLERNRKATEKLYLILEEKYQEAKIN-ERIKLGTVLVIAPG-VI
A0A3D0MYJ7      IKTLP----SQVIEYAKLERDKLAAEKLYAALESNYQESLIN-ERTQTIKSYVIDPG-YD
A0A3D3LS70      FSKLP----SQSIELAKLERNRRADEKLYLLLEEKYQESVIN-EKSQLGNVSIIDKA-SL
A0A1G7ZF38      ITRLP----GNQRAFLSQSREQGIQQELYLFLLKKRMETAIS-RSANIANARVVDAP-KA
C6VS52          IIQIP----THQRALLTHSREQGIQQELYLFLLKKRMETAIS-RSANIANARVIDPP-KA
A0A1G1TM36      IKSMP----GQEQQLVNRKRQLTIKENLYNYLLQKREEAALS-YAATLTNSRTIDSA-YV
A0A1V3WH27      VSAMP----STQQEILRLSRDVESGRTIYLQLLTRQQELNIS-RSSAVGNVRIIDEA-VT
A0A0D3L8Q3      IEQVP----GMEREIQAISRQQGIKEGLYLYLLQKREESALS-LAATVSNSRIIDPA-SA
A0A0K8QSK7      VRQLP----TTERNLVNIERKYKLNNETYTFMLEKLSTAQIA-KASNMPDSKVVSEA-I-
A0A1V6CN82      VGKLP----VTERDLFKIERRYNMNNETYTFLLEKLSEAQIA-KAANQPESQLVESA-S-
A0A1M4XZ45      IRRLP----ATERNYVNIERKYKLNNETYTFLLQKLSEAQIA-KASNIPDSQMIEEP-QM
A0A399D319      VRRLP----ATERNYVNIERKYKLNNEIYTFLLQKLSEAQIA-KASNIPDTQLIEEP-QM
A0A0P7X1V8      FEDLP----DNMIEMARYQRNMQINEQLFLLISQQAAETALW-EQTQSGLARVVDMS-FI
A0A3B0C2S4      FSRLP----EKEKTLRAIERQQSIKENLFLLLLQKREEAAMN-YATTAPSIKVVDYA-LT
A0A416GA42      AANIP----NHQKVVLSAERQQKVKEQLYVYLLQKREENALA-EYIAESNARVVDRA-KG
A0A3N2M1H3      IAGTS----EKALPLLSDTRQQKVKEGLYLFLLQKREENELS-QKFTAENTRVITPP-MG
A0A1T3IYP5      VLQMP----QKERTMLSIERQRRVKEDLYMFLLNKREENALN-EAITEANLRIIDPP-VG
A0A212K7W5      IASSP----EQAKYLLSVERQQAVKEALYLFLLQKQEENQLS-QTFTVYNTKIITPP-SG
F5IU11          IASSP----EQAKYLLSVERQQAVKEALYLFLLQKQEENQLS-QAFAVYNTKIITPP-SG
A0A352Z1R7      LRKLP----KAERDLARLTRVSNVNAGIYTFLLQKHEEARIA-KATTVSNINIVDPA-IT
A0A0A2F501      ISANP----TQAEYLISVERQQKIKEALYLFLLQKREENELS-QAFSAYNTRVITPP-IG
R5B7P0          IAANP----NQAKQLLSVERQQTVKQALYLFLLQKREENELS-QAFTAYNTRIIKHP-IS
R5B0L5          IAANP----TQANYLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTEIIQRP-TG
A0A374THP7      IASNP----NQAKYLQTVGRQQKVKESLYLFLLQKREENELS-KAFTAYNTRIITPP-TG
A0A3R5XWG1      IASNP----NQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRVITPP-TG
A0A414YFM3      IASNP----NQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRVITPP-TG
A0A0A2EVS5      IASSP----TQAQYLLSVERQQKIKEALYLFLLQKREENELS-QAFTAYNTRVITPP-MG
A0A1T4NAJ7      IASSP----TQAQYLLSVERQQKIKEALYLFLLQKREENELS-QAFTAYNTRVITPP-MG
A0A2V1IJY1      IASNP----SQAKYLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTRVVNKP--A
A0A3N2KCL3      IASNP----SQAKYLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTRVVNKP--A
A0A255T941      LASSP----NQAKYLLSVERQQKVKEALYLYLLQKREENELS-QAFTAYNTRVITTP-RG
A0A1Y4CHN5      IAASP----SQAKDLLSDERQQKVKEALYLFLLEKREENELS-QAFTAYNTRIITPP-TG
A0A1Y3V692      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A174TYU6      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A1M6I2S6      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
F3PXM2          LASNP----DQARYLLSVERQQKVKEQLYLYLLQKREENELS-QAFTAYNTRIITAP-RG
A0A3E4ZNL4      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVVTTP-RG
A0A174AHH7      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A174JCE8      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A3E4JMC4      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A412SND6      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A414IEQ9      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A415UKN5      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A0M1W8D8      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A3R6GKX5      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A7V4S1          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
B0NU19          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
D4V601          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A397WLT5      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A3R6GM96      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A015XH67      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A078RZN2      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A6L0K5          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A7ACT5          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A6KY94          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A173UQR8      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A3R6HK75      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A412B7D1      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A412VNY9      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A414LTU9      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
I9Q4U4          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRMITAP-RG
A0A373ISF0      LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
U6RF62          LASNP----SQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A073I794      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A108TH71      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
I8VXH0          LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A412S0N6      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A412IIJ0      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A0P0FM97      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
R6KTP3          LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A139LU87      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A1C6B3Y5      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
E2NMQ4          LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A412YDB9      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
R7DY01          LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A414LGK8      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A016E4F9      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A413PP50      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A3A5TI83      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A415NEB6      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A7AJ60          LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A015UXN7      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A395YYT3      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRVITAP-RG
A0A415IPQ4      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A3E5BRW7      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
K9DXS6          LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A1M6KFV3      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A1Q6G7L3      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A413H235      LASNP----NQAKYLLSVERQQKVKEELYLYLLQKREENELS-QAFTAYNTRLITAP-RG
A0A1M5B2J8      IASNP----KQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIISQP-DG
A0A255RCT5      IASNP----KQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIISQP-DG
A0A1Y4GLF5      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A1H3XSC0      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-SG
B3JI46          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A174UR09      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A6LE40          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
R6NN15          IAANP----SQAKYLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTRVITPP-TG
A0A358R8U0      IAANP----SQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRVITPP-SG
R6WSB6          IAANP----SQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRVITPP-SG
A0A401LPX7      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIIAKP-GG
A0A3A5Z900      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A3R6I893      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A3R6EGW5      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A285TGL6      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A3A5RFX4      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A1Q6IUW9      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A3R6NPG7      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A413XDP6      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
K6AP24          IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A076IQN8      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A078RYI7      IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
C7XEQ8          IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
D7INX6          IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
K5ZG55          IASNP----KQSKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITKP-GG
A0A3N2N9B8      IATSP----EQAKYLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTRVINRP-GP
A0A3N2NMI0      IATSP----AQAKYLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTRVINKP-GP
A0A359I8H7      LASGS----TQAKYLLSVERQQKVKESLYLYLLQKREENELT-QKFTADNTRIITPP-TG
A0A3N2KA63      LASGS----TQAKYLLSVERQQKVKESLYLYLLQKREENELT-QKFTADNTRIITPP-TG
A0A3B9FAU3      IASSP----KQEKYLTSVGRQQQVKEQLYLFLLQKREENEMN-QAFTAYNIRIITAP-FG
A0A3C1E5L7      IASSP----KQEKYLTSVGRQQQVKEQLYLFLLQKREENEMN-QAFTAYNIRIITAP-FG
A0A354SN68      VKTNP----KQQQYLLSVERQQKVKEALYLFLLQKREENELN-QAFTAYNTRIVATP-NG
A0A0A2DUD9      IAASP----EQANYLIAEGRQQTVKEALYLFLLQKREENQLS-LAFTANNTRLISAP-TG
A0A3N2N595      IASSP----TQAKHLLSVERQQKVKESLYLFLLQKREENELS-QAFTAYNTRVIRKP--A
R5FHS9          MAASP----TQAKYLLSVERQQKVKEQLYVFLLQKREENELS-KAFTAYNTRIITPP-MG
A0A3P1ZBJ5      IAQNP----TQTSYLTSIGREQAVKEALYIYLLQKREENELS-IAYTASNLRVISPP-MG
A0A413TW79      IASNP----SQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRIITPP-TG
A0A3E5E9M7      IASNP----SQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRIITPP-TG
A0A3E4SK73      IASNP----SQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRIITPP-TG
A0A415GGC6      IASNP----SQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRIITPP-TG
A0A413DBH9      IASNP----SQAKYLQTVGRQQKVKEALYLFLLQKREENELS-KAFTAYNTRIITPP-TG
G9S1S8          IAESP----AQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITPA-GG
A0A354M4S6      IAESP----AQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITPA-GG
R7DH52          IAESP----AQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITPA-GG
A0A396N3D5      IAESP----AQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITPA-GG
A0A415ZDP9      IAESP----AQAKYLLSVERQQKVKESLYLYLLQKREENELS-QAFTAYNTRIITPA-GG
A0A016CWA4      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A1C6H117      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A415TAH7      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A0M1W0V2      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A139KA16      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A174VQ92      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A1Q6HCG0      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A1Y4JYM9      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A3A5QW67      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A3A5RQE6      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A3A6BP07      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A3E5E153      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A3Q9IP20      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A412WV15      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A413ICP6      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A414KYB9      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A416X133      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
E5WX00          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
K0X3P3          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVAPP-HG
A0A3A5Z014      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A1M4YZ07      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A078S3Q8      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A069SJV7      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E5DXI5      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E5EM98      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E5F453      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
I9T3G6          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A0P0FQW1      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
C3RFN5          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E4SYU0      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A6LGY1          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
K5ZSH4          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A078T2W6      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3R6D1V4      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3R6EAF7      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A412MJT7      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E4WKT5      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3A5YY33      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTHIVTPP-HG
A0A078TAH2      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A1E9CFZ7      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A373FYU5      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3A5TZ72      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3A5XBP2      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3A6MEG9      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E4JP35      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E4KP40      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E4NX82      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A3E4XFU8      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A412RG70      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A412TD37      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A413GAA4      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A414M7I4      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
E5UZA2          IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A069SMG6      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIVTPP-HG
A0A1Y4PQK7      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRVITPP-TG
A0A1Y3ZDB3      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIITPP-MG
A0A3A6AAP4      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIITPP-MG
A0A1Y4IH41      IAANP----TQAKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIITPP-MG
A0A1Y4DYA7      IAANP----TQGKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRIIMPP-SG
A0A1Y3X4I9      IAANP----SQGKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRVIMPP-TG
A0A1Y4FNK8      IAANP----TQGKYLLSVERQQKVKEALYLFLLQKREENELS-QAFTAYNTRVITPP-SG
A0A355FD59      IAANP----DQAKYLLSIGREQKVKEALYLFLLQKREENELS-QAFTAYNTRIITPP-YG
A0A359CEZ9      IAANP----DQAKYLLSIGREQKVKEALYLFLLQKREENELS-QAFTAYNTRIITPP-YG
A0A353Q7B4      IAANP----DQAKYLLSIGREQKVKEALYLFLLQKREENELS-QAFTAYNTRLLTPP-TG
A0A1M3KVR9      IAANP----DQAKYLLSVGRQQKVKEALYLFLLQKREENELS-QAFIAYNTRMITSP-YG
F8X3A5          IAANP----DQAKYLLSVGRQQKVKEALYLFLLQKREENELS-QAFIAYNTRMITPP-YG
A0A3C1ITV0      ISAGP----GKAKELLTIERQQKIKEELYLYLLQKREENELQ-ASIVVNNTRLLKPA-TG
R7HN19          ISAGP----GKAKELLTIERQQKIKEELYLYLLQKREENELQ-ASIVVNNTRLLKPA-TG
A0A415EEZ4      IGTVP----TQERYIMSVERQQKIKEELFLYLLNKREENALS-MATVEDKIRVIDTP-YS
A0A060RD97      IASVP----TKEKDVAGIVRQQKIKEELYLYLLNKREENALN-LAITIPEARVVDAA-DG
A0A350IHV0      IANTS----GQELQLLSIERQQKIKQELYVYLLQKREENEIA-SLVNVGNTRMVMSP-NG
A0A077ENE7      MLQMP----QKERTMVSVERQRRVKEDLYMFLLNKREENALN-EAVTEANLRIVDPP-VA
T0NN57          VLQIP----QKQREMLSVERQHKVKEELYLYLLNKREENALN-EAMTDESIRIVDPA-SG
X5K347          VLQIP----QKQREMLSVERQHKVKEELYLYLLNKREENALN-EAMTDESIRIVDPA-SG
A0A1T5K9D4      FTEMP----EKAIEMRQMERQLSIKEDLYIYLLNKREENELS-QAMVDDNAIMFDSA-EG
R5RVP0          IANTS----GQELQLLSIERQQKIKEELYIYLLKKREENEIA-SLVNVGNTRMVMAP-NG
A0A285T4L1      FTTVP----TKERQMLSIERQQKIKESLYMFLLNRREENALS-QAMADNNARTIDSV-DG
A0A3E5BU42      FTTVP----TKERQMLSIERQQKIKESLYMFLLNRREENALS-QAMADNNARTIDSV-DG
A0A414ZBF2      KAFVP----TQQKYVISIERQQKIKEELYLYLLNKKEESELQ-LSITESNCRIVDPA-DG
R5KD55          ISTNP----TQAKELLAVERQQKVKEALYLFLLQKREENQLS-QSFTADNTQIVKSP-TG
A0A174QNT3      IERIP----QQEKYALDVMRQQSIKETLYTYLLQKREETAMQ-LAVTEANIRIVEAP-FG
R9I0H0          IENIP----QQEKYALDVMRQQSIKETLYTYLLQKREETAMQ-LAVTEANIRVVEAP-FG
K5BUT9          IQAVP----KQEKMALSIMRQQSIKETLYTFLLNKREENALQ-LAITEANIRVVEEP-FG
A0A174FPA3      IQAVP----KQEKMALSIMRQQSIKETLYTFLLNKREENALQ-LAITEANIRVVEEP-FG
R6S9Y6          IQAVP----KQEKMALSIMRQQSIKETLYTFLLNKREENALQ-LAITEANIRVVEEP-FG
C9KX15          IQAVP----KQEKMALSIMRQQSIKETLYTFLLNKREENALQ-LAITEANIRVVEEP-FG
A0A3L8AAP1      IQAVP----KQEKMALSIIRQQSIKEALYTFLLNKREENALQ-LAVTEANIRVVESP-FG
R6DAG6          IQAVP----KQEKMALSIIRQQSIKEALYTFLLNKREENALQ-LAVTEANIRVVESP-FG
A0A1G8BVM8      IADVS----SQYKFMVNIERQLKIKEELYLYLLKKQEESEIQ-LTTTESNCTVVDVA-DG
A0A416GGJ1      FSSIP----KKERKMLSIERQQKIKESLYMFLLNRREENALT-QAMADNNARLIDEA-DK
A0A3D1NQW3      ISSVP----TQEKQILDIVRQQKIKEELYLYLLNKREENAIT-MVITESNSRTIDSA-YG
B0MT10          ISSVP----TQEKQILDIVRQQKIKEELYLYLLNKREENAIT-MVITESNSRTIDSA-YG
R7JGW9          ISSVP----TQEKQILDIVRQQKIKEELYLYLLNKREENAIT-MVITESNSRTIDSA-YG
A0A0E2M2Y7      ISAVP----TQEKIMSTILRQQKIKEELYLYLLNKREENALR-LAITESNAKIVDAA-DG
A0A0K2J6Z0      ISAVP----TQEKIMSTILRQQKIKEELYLYLLNKREENALR-LAITESNAKIVDAA-DG
B2RKZ8          ISAVP----TQEKIMSTILRQQKIKEELYLYLLNKREENALR-LAITESNAKIVDVA-DG
A0A212GC82      ISAVP----TQEKIMSTILRQQKIKEELYLYLLNKREENALR-LAITESNAKIVDAA-DG
A0A254MU12      ISAVP----TQEKIMSTILRQQKIKEELYLYLLNKREENALR-LAITESNAKIVDAA-DG
R6CQ93          FTTVP----TKERQMLSIERQQKIKESLYMFLLNRREENALS-QAMVDNNARTIDSV-DG
A0A3D2BF46      IASAT----RQSTELLDNTRQQRIKEELYLYLLNKREENELT-KAIADNNARIIDPA-YG
A0A358R538      IAAMP----SQEKAMLGIARQQKIKEELYLYLLNKLEETQLN-YAVAESNARIIDTA-YG
A0A1Y4AAB8      ISTVP----SQEKEMLGIARQQKIKEELYLYLLNKQEETQLN-LAVAESNARVIDLA-YG
A0A1Y3WWY9      ISTMP----SQEKVILGITRQQKIKEELFLYLLNKQEENQLN-YAVAESNSRTIDTA-YG
A0A1Y4U5L4      ISTMP----SQEKVILGITRQQKIKEELFLYLLNKQEENQLN-YAVAESNSRTIDAA-YG
A0A1Y3VCJ1      ISTMP----SQEKIILGITRQQKIKEELFLYLLNKQEETQLN-YAIAESNSRTIDVA-DG
A0A1Y3QTW7      ISTMP----SQEKVLLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDQA-YG
R6XWY7          ISTMP----SQEKVLLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDQA-YG
A0A174AVF1      ISTMP----SQEKVLLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDQA-YG
A0A373HTL7      ISTMP----SQEKVLLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDQA-YG
A0A1Q6EIY0      ISTMP----SQEKVMLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDMA-YG
E4M8L3          ISTMP----SQEKVMLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDMA-YG
I3YQ50          ISTMP----SQEKVMLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDMA-YG
R5UEY8          ISTMP----SQEKVMLDIMRQQKIKEELFLYLLNKQEETQLN-YAVAESNSRTIDMA-YG
A0A1H4D866      ISTMP----SQEKVILGITRQQKIKEELFLYLLNKQEETQLN-YAVAESNARIIDLA-YG
A0A374A9J5      ISTMP----SQEKIILGITRQQKIKEELFLYLLNKQEENQLN-YAVAESNSRSIDYA-YG
A0A1Q6E9S3      ISTMP----SQEKVILGITRQQKIKEELFLYLLNKQEENQLN-YAVAESNSRSIDYA-YG
D4IJ36          ISTMP----SQEKVILGITRQQKIKEELFLYLLNKQEENQLN-YAVAESNSRSIDYA-YG
A0A414Q925      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A415PUS9      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A108TCU0      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A413BA42      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
S3Y344          IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A413MY74      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A412TGL3      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A413VJ33      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A414L0W6      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A412DP39      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A413ZSE8      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
B0NP84          IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
R6AK43          IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A412N2D9      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
R6LHA4          IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDPA-EG
A0A1Q6FL18      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELH-LSITESNCRIIDSA-EG
A0A1Y4JYS9      IAFVP----TQLKYVVSIERQQKIKEELYLFLLNKKEENELQ-LSITESNCRIIDSA-EG
A0A3E5HPT8      VQAVP----GKQREMLSIERQQKVKESLYIFLLNKREENALS-QAMVDNNARILDPV-SG
C6IJ48          VQAVP----GKQREMLSIERQQKVKESLYIFLLNKREENALS-QAMVDNNARILDPV-SG
Q8A3U2          VQAVP----GKQREMLSIERQQKVKESLYIFLLNKREENALS-QAMVDNNARILDPV-SG
A0A3R6S1H6      ISAVP----SQQKYVLSVERQQKIKEALYLYLLNKREENALS-QSITSSNARVIDPA-MC
A0A3R6SD81      ISAVP----SQQKYVLSVERQQKIKEALYLYLLNKREENALS-QSITSSNARVIDPA-MC
A0A413VXJ7      IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDPA-SG
I9RSN9          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDPA-SG
U6RJK5          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDPA-SG
A0A1Q6GA32      IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDPA-SG
I9RPU6          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDSA-SG
I8Y597          IEAVP----TQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDPA-SG
I8YFS5          IEAVP----TQQKYVLTVERQQKIKEELYLYLLNKREENGLT-LAITESNARIIDPA-SG
A0A1Q6GBF5      IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDSA-SG
I8YFZ3          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDSA-SG
A0A1Q6GDH2      IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDSA-SG
U6RSB0          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDAA-SG
I9SIK1          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDSA-SG
I9GXM2          IEAVP----AQQKYVLTVERQQKIKEELYLYLLNKREENALT-QAITESNARIIDAA-SG
I9TP59          IEAVP----AQQKYVLTVERQQKIKEEL