BYKdb

Dataset for cluster orphancd of phylum balneolaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A345UMN6      MELENNERRKSMRSNGASEDPFNPGAIPGEEDDQNDPFDPQLILYSLWDGKWIILACVVI
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      LGALGYYYTQTLPNQYRTTGLFLIENQRADRGLNLFEFTRARNLTWDEVGTEMQFIVNSH
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      ELAENVGRRLIQELVNPVTGDTLPMLRQNGLGFMPEEQVLQRLARRLPNRISLHQIDQMN
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      LVEIRTTSFDPQEAAFIANFYIEEYRILDETITRSNLTSAASYLEQLEERNTMTLGEQDE
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      QIRMFLDSDWTLITDEQGTAAAQELRGLFREAEELRFRKVAVSDFLDRLREEKDMVLNML
A0A3D2IJ12      ------------------------------------------------------------
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      YDGATDNDMELVNAFEQAILDLRLQAESFYIEQPQLRTNPEGNSVLSQILRRIDYLEGLR
A0A3D2IJ12      ----------------------------------------------NEILKVKRQIKDRT
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      DERLESQRDRVRDRQGLDQASLASYLTDIRSEIRSNEARLVDMQLREDFIAERVDDIQSD
A0A3D2IJ12      NNLLSSGSDLYLSFIGSGDGTLTQRIAEISQKLIELKVEQAQLKTQENIISKRYAEVNNR
A0A356WWN1      ------------------------------------------------------------
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      MSSIMERSAELQRLRRNQVISEELYLNLLKRLQETQIAIQSEVSRVREIRAASVPSSPFS
A0A3D2IJ12      LEDLPDEIIQLARLKRNVRVNEEMYLQVSSQFAEMSLWEKTQFGLGRPLDYAVPAKEPVK
A0A356WWN1      ----------------------------------MNLWERTQFGMGRPLDYAVVPNNPIK
A0A3D4V2H8      ------------------------------------------------------------
                                                                            

A0A345UMN6      PNRLRNYILSLILGFGLGAGIVLLRNLLDDLIHDPGQLRNAGFNVIGVIPDFTDYINTHF
A0A3D2IJ12      PKKKIIVVVGFFMGCVLAVGFVLVREMLNDTITSTDALKEFQKPVLGAIPDFS--VIGEL
A0A356WWN1      PQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALRSYKVPFLGNIPDYN--IIDSF
A0A3D4V2H8      PKKKIIVVVGFFMGCVLAVGFVLVREMLNDTITSTDALKEFQKPVLGAIPDFS--VIGEL
                *:.    ::.:::*  *..*::::.: *:* * ... *..    .:* ***:.  :   :

A0A345UMN6      KNTERLPIRGRSVDVNLISLIDPISAGAEAYRRLRTSIEFSNADREYQTLVVTSSKPGEG
A0A3D2IJ12      DPNERQYIGKKSVSNQLITLFDHISPISEAYRRLRINVVYANPDKDYKILMVSSATKGEG
A0A356WWN1      DPGQKQYVQGKPVSNQLLTFLDHISPISEAYRRLRINTIYANPDKDYKVLMVTSSTKGEG
A0A3D4V2H8      DPNERQYIGKKSVSNQLITLFDHISPISEAYRRLRINVVYANPDKDYKILMVSSATKGEG
                .  :.  :  ..*. :*::::* **. :******* .  ::*.*.:*: *:*:*:. ***

A0A345UMN6      KSLTSINLALTYAQFGKRTLVIDCDLRKPTIHKKLGLDKSPGLTDILFDKDTLENCLIDA
A0A3D2IJ12      KSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDALFDST-IDARLS-T
A0A356WWN1      KSTIAANLAVTFAEAEKSVLIIDLDLRRPTMHKIFGENKEPGIVEMLFDTAGFDSTINPT
A0A3D4V2H8      KSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDALFDST-IDARLS-T
                **  : ***:*::   * .*:** ***.** ** :* :*.**: : ***.  ::  :  :

A0A345UMN6      STDNFFVITAGNSIPNPAETMGSKRMQELLSSLKKEFDIIILDTPPLLVVSDAMPLAVAT
A0A3D2IJ12      VAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLI
A0A356WWN1      IAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDKYDHIILDTAPYGIISDSASLLRLT
A0A3D4V2H8      VAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKSEYDHIILDTAPYGIISDSASLLRLI
                 : *. ::*.*:. *:**..:.*.*:::::.. *.::* *****.*  ::**: .*    

A0A345UMN6      DATVLVSKMDETELSILKETRQDLRNLGVNIAGSVLNAYDTNSVKSYYKYNYKYNYKYKY
A0A3D2IJ12      DGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSE
A0A356WWN1      DGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLNAFDPKKSSDYYTNYYYYKRAYSD
A0A3D4V2H8      DGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKSTDYYTNYNYYKRTYSE
                *. ::**.:  *    *: * :.* :*..:: * ****:*.:. ..**.    *:  *. 

A0A345UMN6      DYAYKDYKLDYTDQPDQK
A0A3D2IJ12      YYKYR-------------
A0A356WWN1      YYEEDKA-----------
A0A3D4V2H8      YYKYR-------------
                 *                

© 1998-2019