BYKdb

Dataset for cluster tadcd of phylum balneolaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N0VGH6      ------MSDIIRSDREGRGPNNGSKFEFVPTTPMSNQAQENSLNPKYLVSLILKYKWLIL
A0A1B6Y5X7      -------------MHYNGNSHNSSNSILSSHTNQQNSDDDQEIDLLKVFNVLFLYKWTLI
A0A371QRZ8      -------MSQSIQKNNNGNGEDRNGYDQISTFSIPKQDQNDGLDPKTIVFTIFRYKWLIL
A0A2N0VKD0      -------------MGQFERGNGFSANKNLYNGDYPNELDPDEIDLIKLFSIILRYKWIIA
A0A371QNR3      MSDNNVDPSSNYRSGSNNGNRGYYSNGSQQGRGDRGHSPDDEIDLKHLFAVLMRRKWAVI
A0A2D9FS21      MDSSSNEHHYPHKNGNNNGF--YTGPNFNSGNNFQQNAEDDEIDLFKLFSTLLQNKWTLL
A0A3M8G9D1      ----------MHLNGSNG------TPKNPSHIENNFSSEEREVDLLKLANLLLLNKWKII
                                                          ::   :   ::  ** : 

A0A2N0VGH6      LFVILGGTGAWFYADTVTPTYESTGTILINAGTS----GDDELSKIISQTTGVGTSSTLA
A0A1B6Y5X7      SITGLVTILSAIYASMQIPIYESKGTIIISESKNRYSYAGAGIENLLTSTYGIGVGSTIA
A0A371QRZ8      LFLIAGGTAAWFYADTITPEYQTTGTLLISSPDR---GGQNELSRIINQTTG-GTNATLA
A0A2N0VKD0      GITLMFTIASVIYSYSIIPVYESDGTILIKDDQNRYPGGGAELSNLLSATYGIGMGSTLS
A0A371QNR3      GITLLFTIGALAYAYNTIPVYESNGTLLITESQSSRGQIGGDLSELLSATYGFGMGSTLG
A0A2D9FS21      VFLGVFTVIAAVLAISQTPIYKSEGTIFITESENRYSYAGSDLSNLLTTTYGIGAGSTIA
A0A3M8G9D1      AITSVFTIGAMIFSLSLTPIYSSSGTIIISESKNRYSYAGSDLSNLLTTTYGIGVGSTIA
                 :       :   :    * *.: **::*.            :. ::. * * * .:*:.

A0A2N0VGH6      NEVQVLRSRDFARQIARSLIEEEPGDY-RDFPVLWNEDENGNISRASEEAVTGRIRRNLS
A0A1B6Y5X7      NELQIMQSRQLSLNLAKRINDIEFDEHGRKFPILWKNYPEDST-SIDIESIASRFRSNIS
A0A371QRZ8      NEMQIIQSRSFARQVARKLMEDDEVDI-NELPAFWRESDDGSVYQRELEGVANSIRSGIK
A0A2N0VKD0      NELQVFRSRSMSFTLANRVIQEDVMKNGSRFPILWRAFPDDST-VVTRDSVATRIRNNMD
A0A371QNR3      NELQIMRSRRMSNMLADKVMQQDLMENGQRFPVLWQEYPIDST-VVSAGAVATRIRNNIS
A0A2D9FS21      NELQIIKSRTLSEDLADSVLAKKFTESGHKYPVIWRAYPDDST-TIGRDTVAMRIRNNLT
A0A3M8G9D1      NELQILRSVSLSYQLAEKILEIQKDETGNIYPIVMRSYPDNPV-STSVDTVAMRFRGLIS
                **:*::.*  ::  :*  :   .  .     * . .    .         ::  :*  : 

A0A2N0VGH6      IVRPERDSELLEVSFESPSPIETSHISNKAMEIYVESSTQENRRAAELTAEFLEREKRDI
A0A1B6Y5X7      FEKKDPNADIVEISYTSPLPTEAATIINLTMNTYSALSTDQNRNMAVSALDFLSDERSRL
A0A371QRZ8      LQLVNRDSDIIEVSYISESPVETATMVNAAMNVYVEQSTAQNRQAADSTTSFLERERAEL
A0A2N0VKD0      IVRQDQDTDMLRITFKSYSPLEAAWMVDQAIEGYTDLSQQQNRGAASSALDFLERERELI
A0A371QNR3      YGRVDRDTEVVEIRFRSYSPMEAQWMVDEAINSYSELSTDQNRMAANSAMRFLEDERRQI
A0A2D9FS21      AERVDQQTDIVSIGFESPLPEETAYISNLTMDTYSRLSTAQNRTMASSALSFLRQERSSI
A0A3M8G9D1      FSQIDPEADLVRISFESPSPYEASEIVNMTMDTYSSISTDQNRRMAVDALTFLRGEKSKI
                    : ::::: : : *  * *:  : : ::: *   *  :**  *  :  **  *.  :

A0A2N0VGH6      EQKLQESERRLQEFMDNTGIVQMDEQASGIVTRQTSIEMELQQVNLELESVNQAIQNHEQ
A0A1B6Y5X7      KEELISTEDSLQLFMNRTMLVALDPQSEKLVSSIASIEVEKQNLEVELVAVNSGIEQYKN
A0A371QRZ8      KSRLAEAEQELENFMDRTGIVRVDNQATSAVNRREQIRAEIEEVQLDLEATELAIQNQEE
A0A2N0VKD0      REELNENEQRLRVYMNETGLIQVDEQTSAAIERISELEAQRQELQVRKVAVTSAISAYEQ
A0A371QNR3      EENLREKEEQLKQFMDRSGIVAVDGQTQQLITRISELESQKQQVRTRLVAINTAIENYER
A0A2D9FS21      EEQLRETENELQAFMDSSNLLAVDAQTEQLINNISTLETKKQEIEVQLVSVNSAISTYEN
A0A3M8G9D1      QEQLEVVEDSLKTFMDQSQLIAVDPQTEKLIVNISGAEVERKEVEIALVAVNSSLEEYQQ
                 . *   *  *  :*: : :: :* *:   :        : :::     :   .:.  : 

A0A2N0VGH6      RMESLKPGLSEQFSEAVGPRIRNSQEQLARYESERTLILTKNPNVRERETTPPRLKYLDE
A0A1B6Y5X7      QLNEIKPGLANQYSEAIGPIIERYQYALAELETNKLLLLTKNPDISENN---PEIVRIDR
A0A371QRZ8      ELERIRPGLINDFSEAIAPRIQGYQETLREYERERYLILSNYPNVRQREEPPSRLKFLDE
A0A2N0VKD0      QLDEIKPGLADQFSDNVGTTLERYQYRLAELETEKLLLLQRNPSLRDQPDQEPYLVEIED
A0A371QNR3      QIDEIRPGLAQQFAEGVGSSMERLQFQLAELETERMLLLNRNPGLRENPEREPQLVQINN
A0A2D9FS21      QLEEVKPGLADKISESLGPQLTNFQFRLAELQTEKLMLMQRNPELRENPEH-PELVKIEN
A0A3M8G9D1      QLNEIKPGLANQYSEAFGAIIERYQFALSELETEKLLLEVKNPNITD--EH-SEIIRIQS
                 :: :.*** :. :: ... :   *  *   : :. ::  . * : :     . :  :: 

A0A2N0VGH6      EIERVKNEIRELSAQLFTEDEE----YTGMDSEERAQMIATIQTRLTELRIQQNQLQSRS
A0A1B6Y5X7      QIEQVKKQIKDRTNALLTSESDLYLSFIGSGEETVTQRIAEITKTLLELEVKRTQLQTQG
A0A371QRZ8      QIDDLKERIAELSSEIFSEEDE----YMGMETAERTRMVTDIQNRLVELRLQKNQQESRI
A0A2N0VKD0      QIQLLRREINRIASTLVDESADAYIGFLSNTDNGIAGRITELRTQLIELRIEESQYLAQE
A0A371QNR3      NIAMLKEEINRVASRLVDESEEY-LTFLRSSDGGIAGRLLDLRTRLIELNVEKSQHEAQQ
A0A2D9FS21      QIEATQDQIKSIANRLINSSSSLALSFLGSESGGIAEKIIQINEKLIQLRVEKSQYEAQI
A0A3M8G9D1      QIDQFKLRIKSVTDDLLENDSALNLSFASRGDGSVMKRLAEISEKLIELEVEKTKYKTQL
                :*   .  *   :  :. ..      :           :  :   * :* :: .:  :. 

A0A2N0VGH6      QALAQSKEEIDQDLNSLPEGMMQLARLQRDVALNEELFVNVSENYAEMSVLKQSQFGFGR
A0A1B6Y5X7      DVINDRYQKTNTRFEKLPDEIIQLARLKRNVRVTEEMYLQVSAQFAEMSLWEKTQFGLGR
A0A371QRZ8      QVLEERRREADDSFRTLPNEMIQLVQLQRNVEEQEQLYLDVSRQYAEMSTWRETRFGNGR
A0A2N0VKD0      TAIDERMAAENEFFNNLPDNMIELARLKRDAEIQEELFLTISQQYAETALWEQTQFGQGR
A0A371QNR3      EVLDERLTEENRFFENLPQNMVEFARLQRDVQINEQLFLTVSDQYAETAFWEQTQFGLGR
A0A2D9FS21      EALTKRAAMFNRQFDGLPREIIELARLKRDVKINEELYLLVSNQFAEMNLWERTQFGMGR
A0A3M8G9D1      NFLNEYYESLNLEFEKLPNDIIELAKLQRNVKINEELFLLVSSQYAEMSLWEKTQFGLGR
                  : .     :  :  **  ::::..*:*:.   *:::: :* ::**      :.** **

A0A2N0VGH6      IVDSALTPTIPVSPNKKILLIIGIMLGGIVSGGFIFIREFMDNSVNNLEMLKTSYLPLLA
A0A1B6Y5X7      PLDYAIPTKAPIKPKKKIIILAGFLLGGVLATGCVLVLEMMNDRITSTDVLRDFNKPVLG
A0A371QRZ8      IIDLATVPGGPISPNKILILMMGIVLAGMVAGAIILVREFFDNTISSIGTIKTQDLPMLA
A0A2N0VKD0      PLDYAFVPDKPTEPKKRMIVIVGFLLGGIVSLGAVFTRELFNNTLDSVDHLKERGYPLLT
A0A371QNR3      PVDYGMMPGRPVEPRTRMIGLIGLLLGGVVGMGYAFGREALIKVIDGTEKMRKLNYPVLS
A0A2D9FS21      PLDYAVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALRSYKVPFLG
A0A3M8G9D1      PLDKALVPLEPIKPRKKIITIIGFFFGGFLAVGFVLIRNLIDDKITSTDSIKDFKLPLLG
                 :* .  .  * .*.. :  : *:.:.*.:. .  :  : : . : .   :.    *.* 

A0A2N0VGH6      AVPVLDKVSKKSKKSFKN----GSGKIPDELVLLRDRSNLASEAIRRLKNNLIYQNGDYP
A0A1B6Y5X7      AIPDFS--VVGEFNPNER-QYIGDKSISNQLVTFFDHISPISEAYRRLRINVVYANPDKE
A0A371QRZ8      AIPSLKKISVKNGNGSGD-YKVGKGKIPNEMVLFRDRSHVISESIRRLKNNIIFQNSDNI
A0A2N0VKD0      VIPDMTNRMKEIFGDSKT-VTIQGKSISTSLLSITDSISPVSESFRRLHNNIIYSHPDEN
A0A371QNR3      VIPDIKKVVKEKFKGDDTIPVADGRKVSSTILTLVDRISPVAESFRRLHNNIVYSQPDEK
A0A2D9FS21      NIPDFN--IIDSFDPGQK-QYVQGKPVSNQLLTFLDHISPISEAYRRLRINTIYANPDKD
A0A3M8G9D1      TIPDFS--ILDGLDSNER-QFIDDKSVSNQLITFLDHISPISEAYRRLRINVVYANPDKV
                 :* :                     :.  :: : *     :*: ***. * :: : *  

A0A2N0VGH6      PKTIAITSAEKGDGKSTVVSNLAVSFAEDGYKTLLIDTDFRRPKLHSYFGHDNESGLTDY
A0A1B6Y5X7      YKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPGLSDA
A0A371QRZ8      PKTIAITSSEKGEGKSTIACNLAIAFADEGYKTLMIDTDFRRPRVHTLFGLPNEKGISNL
A0A2N0VKD0      FKRILITSSAKGEGKSTVSTNLAVILADSGKKVLIIDSDLRRPNLHKLLGENRIPGLIDT
A0A371QNR3      FQTILVTSSAQGEGKTTIVSNLAVALTEAGKKVLIVDLDLRRPKLHILWKESQRPGLIEV
A0A2D9FS21      YKVLMVTSSTKGEGKSTIAANLAVTFAEAEKSVLIIDLDLRRPTMHKIFGENKEPGIVEM
A0A3M8G9D1      HRVIMVTSATKGEGKSTLAANLAVTFSEAEKSVLLIDLDLRRPTQHKIFGENREPGLTDS
                 . : ::*: :*:**:*:  ***: ::    ..*::* *:***  *      .  *: : 

A0A2N0VGH6      LS-GRIKLVKLMKDTDINMLKLITSGGRHEAPDTVVNSKKFNDFLNQMEEVFDIIILDTP
A0A1B6Y5X7      LFDASI---DVRLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKAEYDHIILDTA
A0A371QRZ8      VK-GDSAASEIIQSSEIKFLKVISAGSNILRPESIVNDKKFNEFLEKMDKLFDVIILDTP
A0A2N0VKD0      LFNDDIELSQVIRETVVPNLDLLTTGQEPPNPSAVLQSEKLKGLIDQVEEHYDHIIIDTA
A0A371QNR3      LF-EDVTLEEAIKPSAAPGIDLLMAGTKTPNPAAINQSEALRKLIIELKERYDHILIDTA
A0A2D9FS21      LF-DTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDKYDHIILDTA
A0A3M8G9D1      LF-ETIKISDITRETIAPNVDLITVGKKTPEPATVLDSKRLKQLIDKLSERYDHIILDTA
                :        .    :    :.::  *     * :: :.  :. .: : .  :* *::**.

A0A2N0VGH6      PFGIVSDSTALLKRAKSTVLVTKYRKTNRGVFQKTVEDLERINANISGIVVNGFDHKKET
A0A1B6Y5X7      PYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIVLNAFDPKKST
A0A371QRZ8      PFGIISDSTSLLRKADATVMVAKYRKTNKEVYMHTLDELRRINANVCGMVLNDFEPKKDP
A0A2N0VKD0      PYGIITDAAPLIPIVDGVVLIARFGETPINELNQSIENLERVHAKIIGTVLTAYNYEKSG
A0A371QNR3      PYGIITDAAPMMRLADGIVVAARFNKTKETQLEHTLGNLERIHANILGTVLLGFDHHKSS
A0A2D9FS21      PYGIISDSASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLNAFDPKKSS
A0A3M8G9D1      PYGIISDSASLLRLVDGIVVVSRFNVTTKRELKYTLEGLNHLNADVLGVVLNAFDPKRST
                *:**::*::.::   .. :: :.:  *       ::  * .::*.: * *:  ::  .. 

A0A2N0VGH6      SGYYGSGYYKSMYESYESYV-----
A0A1B6Y5X7      DYY---TNYNYYKRTYSEYYKYR--
A0A371QRZ8      ASHYGSGYYKSLYDGYGAYA-----
A0A2N0VKD0      DYYTRSNGHYDYQRAYKDYNRSI--
A0A371QNR3      DYYYGNDNYYYAYEAYDEYHKEKA-
A0A2D9FS21      DYY---TNYYYYKRAYSDYYEEDKA
A0A3M8G9D1      DYY---TNYSYYKRTYSEYYQEEV-
                  :     :      *  *      

© 1998-2019