BYKdb

Dataset for cluster orphancd of phylum calditrichaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      MALEEFEILDQPQQSSIPIDFGKFIAGIWRRKWLILFL-SVGMTIPFYFHAK-NQVPQYK
A0A3M2FHF6      --MNNNVPAASGDLA---FKLKKIIRLLKRKKITLLSVFSVTFVVVFLAALKFGPQQQYK
H1XXC2          --MNNQKKSTDLNLTDSKMDWQHYIKLFKRKKWLMLLLFIFGFLFSAAFLYKISPRPVYQ
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      SKVVIQSKQY-------GSEEKSFFDAETQAEITSQSFTERMARVLGLAI-LSSDTLYRN
A0A3M2FHF6      ASALLQIDDKRALTSVGGARGRQQNDSKLGL-IMSRSFLKRVVDKTNFQFQVSGQPRYNV
H1XXC2          TQALLQFQDTRSLNEL-DSRRRPDFESKLGI-LMSRKFLGKIVDDLSLVVRFSGVDRYEA
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ------------------------------------------------------------
A0A3N5KHL3      VSDVFAEYHTTSEPVVSRYKIEVDDLGVYYLYQKNETSRVLVDSANVWDA---VDALRNA
A0A3M2FHF6      IDSVVLD----DQLKYGKYLIKKDENNLKVFYTDPTKT---IDEELVLETSVPTDHKLSY
H1XXC2          VDSVFLH----PNYLKGRFVLKKQGNKLLLFYTSQDHS---IEDKKVLEVDYPEDRLIVY
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      -----------------------MVQKVIENLKNIISYKLDQTSRTVMTVLVKHRSPEMA
A0A3N5KHL3      NGLSFRLQPTFVHQAGEFHFRVQPFSKGVKVIQLGIKMDF-SRSGKFMIMEMKGENPNYI
A0A3M2FHF6      GGFTVYFKKNFWENNKKIVFHLLKSSKAVEALRASIKPMFKNRARTMMEVGISGVDRFYI
H1XXC2          GGVGLKLKDRYWQQHDKLIYTVNSRPRAIESLLSSLGYQFKNRARTLLVLTLKGEDRYLI
A0A3M1A6F3      -------------------------------------------MKLSKLQKLPSLDKIIK
A0A3M1AUM6      -----------------------------------------------------------M
                                                                            

A0A3M1NH38      ALIANTLAKRFVELNREVARYKSDKIMEILENQLKIAKQELDEATQKLRAFQERYPWVRL
A0A3N5KHL3      TSELNRIADAYLIEVQKLKSVDSDTYREALRRRLAAAETNMKVSEENLRNFYSQYP-LSL
A0A3M2FHF6      TEVLNVLVDEFVQQNIDVKKYHTREVLTVLTTQLEQAKKDLDAASEELKRFRERNPYVGL
H1XXC2          TATLNKIVDYFVQENLNLKKYQTREVLSVLEEQLQTAKVELDRAAQELKQFREKNPWVGL
A0A3M1A6F3      NNNHEKIYRGY-------------------------------------------------
A0A3M1AUM6      QSFVGNIVDYF-------------------------------------------------
                      :   :                                                 

A0A3M1NH38      SADAQMQIATITELEETEQKLQNKIRDVQGLLQKLEM-SGNTLDLEEMLSLCNEMITLLS
A0A3N5KHL3      DAEKTELMGQLKLNEQALRDLPLQRKQLTSLLARLQAENNADYSAQYRRVVVNQIANYAA
A0A3M2FHF6      AGEATAAVTRISSSENQKNEVLRKKKELSELITRLNTAAGDE-----RYSILNELLAWLA
H1XXC2          TPDATGAISSVSALESQKSQLVNLKNELQSLINRLQAKSGEE-----RYSILNEIISFLG
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      SSGELAREQFEYPLASVFSAEYEKLTAERRDLLASYAPTHPVVKENEQKIWALLEKVKKG
A0A3N5KHL3      MSNE--------PEMTIYRQNLEQLEARYRELSGLYSSDNEEVKGLEEKIGETQAHIIQF
A0A3M2FHF6      ANGS--------PTVPALASEYTTLNEERIRLANNYAPEHPTVLENKKKIRDLEKKVLYT
H1XXC2          AQDA--------PTAPALASEFTTLTTDRSRLLASYAPSHPYVKENTKKLNELEKKVLLT
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      ARDYVNKLEQELVGLSQNLQVERKKLRRLPATSLQYAELQREHDLKERVYSTVLVRYNQN
A0A3N5KHL3      ASNYRNVLAERESTLRREKLELESKLKSLPNDEYRLMELERNKKIDEDLFKFLYTEVQKL
A0A3M2FHF6      ANNFLAQYDESLANIESMMRQEQGKIRSLPAKELQYAELQRKKNVADGVYSDLLIRHNKA
H1XXC2          AQNMINAWNKQINDLEQKIVENTNKIKRLPAKELKLAELERQRAVTDEIYSSLLVRYNQA
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      KLESEVDISDVFIIDPAIPPPEQDVLFALIMKSLMGLLISVGIGFIVAVIVEVFNKTAEN
A0A3N5KHL3      QVSEASQDRGVRILDYAVPPTKPINPSKKSQI-MLGGGLGLLLGLLLSIVIDLADRSLQS
A0A3M2FHF6      KVADAVEVGDIIIIDHAVPPPRVSALGVFLKYGFVALALGLIISIGFVLVADFFDKTVRT
H1XXC2          KIADAVEVGDVVVLDRAVVPLRISQFKTYFKIMLIGLVVGLGLSVVVVIVIDFFDKTVRS
A0A3M1A6F3      ------------------------------------------------------------
A0A3M1AUM6      ------------------------------------------------------------
                                                                            

A0A3M1NH38      VEELQEMLDIPVVGEIPMIKVEQGDGEGIQELRGKRDPKLITLDYSPTLASESYRDLRTK
A0A3N5KHL3      VKDVERHLKLPVLGTIPEVLFKDIPEYRDDQKAEQIDKQLVTHDYSPTPIGEAYRALRTH
A0A3M2FHF6      ADELEKAVPIRVVAKIPVVGTTKEITMEDFAKNKRIDPKLVTADYSPTPMGEAYRSLRTQ
H1XXC2          AEELEKAIPIKVIGKIPVIKTEKEIVDVKFDDAVRIDPKLVTADYSPTPVGEAYRSLRTQ
A0A3M1A6F3      --------------------------------------------YKDSAFNAESERVLSK
A0A3M1AUM6      --------------------------------------------EEESPEATEFRRLYSK
                                                             . :        : ::

A0A3M1NH38      VLFMNQNEDLSSLMVTSLRPNEGKSLTTANLAITVAQ-QKISTLLIDGDLRRGVLHNTFG
A0A3N5KHL3      LLFSKDTEQLRSLLITSICPEEGKSFTAANLAIIMAQ-QRTNTLLVDADLRRGVQHNTFN
A0A3M2FHF6      LLFNNEDKRNRSLFVTSLNPNEGKSLNASNLAITFAQ-QKIPTLLVDADLRRGVLHSSFA
H1XXC2          LLFNS-DKKLRSVFITSLNPDEGKSLNAGNLAITFAQ-QKLPTILLDADLRRGVLHNSFA
A0A3M1A6F3      IDTFRRGRTKQSVMVTSAILGEGKSTISSHIALASARNRKSPTLLIDLDLRRPRIHEIFG
A0A3M1AUM6      LQNLYSGQNIKNLLITSATMNEGKSTTAALLACTIARYRETKTILVDCDLRRPRVHQLFN
                :          .:::**    ****  :. :*   *. .   *:*:* ****   *. * 

A0A3M1NH38      NKKTPGLSDFLISSATVDFDNLSKLIQPTFIPNLFLITCGSPIPNPTEMLGGDRFVAFLK
A0A3N5KHL3      VPREPGLTNYLS-----NKGTLNTLIHSTHIPNLSVMSCGSLVPNPSELLGSIQMKRLLS
A0A3M2FHF6      CNKKPGLADFLYSSADINDENINKVIQQTHIPNLYLMSSGMAVPNPSEILGTQRAADLFK
H1XXC2          CKKKPGFSDFLYSNADITDENVRKIIQTTHIPNLYLISSGVPIPNPSELLGSTRAQELIR
A0A3M1A6F3      QNKTPGLAEILS-----RKLTLHSCIRDSEIENLKIITSGSLQGNPLNIINAETIHAFFN
A0A3M1AUM6      LAKEDGVADVLM-----SKRRLDACFKQSPLENLKILTSGGIVDNPTELFNSSKMKDLFS
                  .  *.:: *          :   :. : : ** :::.*    ** :::.      :: 

A0A3M1NH38      LLRSRFGMVIMDTPPIQASSDAAILARYFDGVLTVIKAGSTDIGQLRQKLNEYPNLRKKV
A0A3N5KHL3      DVKRKFDFIIFDAPPLDAATDSVVIGTVVDAVTIVLRAGKTNRKIAKERLEIFQNVPAKI
A0A3M2FHF6      FLAERFGFLIVDTPPIMVTSDSVVLSRYVEQGLFVIRAGQTNVESVKEKLAEYKNFEKRL
H1XXC2          FLSHRFGFVIIDTPPLAVASDAVIVSRYVDGGLLVVRAGKSNIVQLKSKIEEYQDLRKNL
A0A3M1A6F3      EIYKYFDFIVVDAPPVIPVSDPLILGKVVDHVVMVVRVGKTPKPIAKRAIEMLQSVEVNI
A0A3M1AUM6      EIKFYFDAVIVDSPPINPVTDALILSSEMDGALMVVKAGKTPKDVVRRAVDLMRNTGLNI
                 :   *. ::.*:**:   :*. ::.  .:    *:..*.:     .  :    .   .:

A0A3M1NH38      IGAVLNMVQMNIKKNQYQYSYYNY--------------
A0A3N5KHL3      IGTIINGTDEAI--LKSTYSYYHY--------------
A0A3M2FHF6      FGIILNCAELDMKSDHYKYSYYNY--------------
H1XXC2          VGIVLNFAKEDMDHKKYRYTYYNY--------------
A0A3M1A6F3      LGIVLNDVD-SLLPAYYNNRYYKYPYYSEVEESNNNLE
A0A3M1AUM6      LGVIVNNMK-GVLPYYYDYKYYGYKYYTKDLKA-----
                .* ::*  .  :        ** *              

© 1998-2019