BYKdb

Dataset for cluster tadcd of phylum calditrichaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1XW99      ------------MNYPKLENGKAPSRRIVTGAEQEVFRYLRIIRKRKTVIAITAFVVLAI
A0A3M1AHA0      -----------------MEQFYLDDENSYQDEKIDLQKYIRVLIRRWKLVFSVTILVTVP
A0A1F4MQ28      -------------------------MEHTSAQGLDIRLIFQVIERKKNYLIGVVLFFLVL
H1XPL7          MSSEKMNMGEGYPGNGKPLAQSYTGFEN-EEEVMKLQDYLQIILRRKWIVLVSFLVVFLT
A0A3M1P834      -----------------MDSYFLDEEESLDVETLDLRRYYRALIKKWWLVAIITLAVTVP
A0A3M1NQ37      ------------MNMTNGQPKNFQKTENVAEQEI--KKYLRILKKRKWVILTVWFVLFLI
A0A3N9NLG8      -----MIIFFTFDVIGEYTLFEENELELESGSQVSISDYLKIIYRRRWLIIITFLVVFGI
A0A1J1CCX0      -----MNMGEGYPGNGKPLAQSYTGFEN-EEEVMKLQDYLQIILRRKWIVLVSFLVVFLT
A0A3N5JLC6      -------MNEYNTYPGDGNGKVQSLPARPPERKMTLNDYRRIFFRGRYVVLITFGIILLL
A0A3M2FFC7      ----------------MNHPSVEAGIENPGQQNVTLTDYLRIIYRGRWIVLFSFLVVFTG
A0A3M1AH62      -------------------------MEEQLEREITLKDMMRILYRGRWVITSCFLAVMAL
H1XXK6          -------------METRVPGNFETDTWEGDEQPLHLTDYIRILYRGRWLIILSFIAVFSA
A0A1F4N1P8      -------------------MNEFEDLQQPEEEQVSLQDYLRILYRGRWIIIISFLVVMIA
A0A3M1XV95      -------------------MENQFEFQQ-DEQQITLQDYLRILYRGRWIIVASFLSVLLV
A0A3M1NWV5      -------------------MENFAEFQE-NEQQISLQDYLRILYRGRWIILTSFVVVVLA
A0A3M2I7J5      -------------------MENYPELME-QEQQITLQDYLRILYRGRWLILGSFVVMLLG
                                                        . : . .  :      .   

A0A3M1XW99      WLGFIVAFQATPVYESSVILTFQDTK-------NTSVAEGGSKKDVNWSRASLVLTHSLL
A0A3M1AHA0      WVIYT--LKQPPVYEAKAVIRFKSYE--------------GKDPTLTESRTTVLTSRTFA
A0A1F4MQ28      VLLYN--FLATPVYQSSVLIKKEQIY-DYRDPDPLNRIMSRQTTDEIDTEIEINKSRSVL
H1XPL7          AVVYT--INSQPVYQAQATVLVNTQSKGQGGLLLFDPTGLGFAQN-LNNELEILKSRSVA
A0A3M1P834      WAIYL--KSQPPIYEAAALIRFKNFA-------------GGDDVSLIQTRNTELRSRSFA
A0A3M1NQ37      WEVFISFFSKGPLYTAKTLLSYQDPR---------TMSALEGRVVNYKSPMNLITSNKVL
A0A3N9NLG8      TCFVT--FTTEPEYEASTTIMIKSTG-AME-RTLFEFDYMGAQTTLISNQIEILKSRTLA
A0A1J1CCX0      AVVYT--INSQPVYQAQATVLVNTQSKGQGGLLLFDPTGLGFAQN-LNNELEILKSRSVA
A0A3N5JLC6      TALYT--FLQKPVYEANVRLMLQDNS-SVG-QSLFDLTSAMKQETMLNNQVEILKSRTVA
A0A3M2FFC7      TVYYT--FTTDPVYDATTTLIIDKSN-AME-NALFDFNSFGNQSTHISNQIEIIKSRTIA
A0A3M1AH62      TVYYT--FTVTPEYEASAKVMIRTDA-TSGIPSLFDMGGVLKQETVINNQVEILKSRTLA
H1XXK6          TVLYT--FTTDPTYEASAVLLVESND-SMD-RALFNLTTFGTQTNLLNNQIEILKSRNIA
A0A1F4N1P8      TVYLT--FTTPKVYEAVGTLIVESQG-SME-RNLFDFAYSGNQTTLITNQVEILKSRKLA
A0A3M1XV95      TAYVT--FTADPVYESTAKIMVESQG-SME-RALFDVTYLGNQTTLITNQVEILRSRMLA
A0A3M1NWV5      TAYFT--FTATPVYEATAKILIEDKN-SME-KALFDINYLGNQSTVIQNQLEILKSRTLA
A0A3M2I7J5      AFYLN--YSTEPEYQASAKILVENPS-ANK-LALFNVDYLNMPSTFITNQVEILQSRTLA
                             * :   :                            .      :. . 

A0A3M1XW99      SKVV---------------------------------------EKLQLNFSMITDNVDQD
A0A3M1AHA0      EQVV-------------------------------------------AQMGLSMKIKS--
A0A1F4MQ28      EKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYEQWLGIESPWKEQLPRFENIQLKPDEV
H1XPL7          NAVA-------------------------------------------RELLAKKYYDNSQ
A0A3M1P834      QRVV-------------------------------------------AQLGLC-------
A0A3M1NQ37      GEVI-------------------------------------------EELQLNLSIQTGF
A0A3N9NLG8      ERVI-------------------------------------------KSLNLSDVRDS--
A0A1J1CCX0      NAVA-------------------------------------------RELLAKKYYDNSQ
A0A3N5JLC6      ERVI-------------------------------------------RNLLKSPYSHR--
A0A3M2FFC7      ERVI-------------------------------------------KRMELSNVRDS--
A0A3M1AH62      ETVL-------------------------------------------HRLQQSDLADK--
H1XXK6          ERVV-------------------------------------------KRLEKSAYRDS--
A0A1F4N1P8      EKVV-------------------------------------------RTLEEDVYRDS--
A0A3M1XV95      ERVV-------------------------------------------HYLESVPYRDS--
A0A3M1NWV5      ERVV-------------------------------------------LRLQSAVYRDS--
A0A3M2I7J5      ERVV-------------------------------------------AELESADFRDS--
                  *                                              :          

A0A3M1XW99      EVFRYLKVSKEAKTG-------------------------YYRLVHEGGEFQIYYSKDDD
A0A3M1AHA0      ----------------------------------------DAMKRLKRKEIFQHFSTTKD
A0A1F4MQ28      SHDYHLKLFGDN----------------------------QYLILDAEKDNVIMSGSDLN
H1XPL7          EILHCIRAPEEDELG-------------------------REILSEEELTGVLIRTVEFE
A0A3M1P834      -----LVLEQKTEDG-----------------------------FLNRSDIFAEFSTTQT
A0A3M1NQ37      ISKSRLFDFLDVDRNSVVGDYKLVRKGET-----------FDLLYKYEPHGIKEYKLLTF
A0A3N9NLG8      -----LNLFKPNEKG-------------------------EYLSMRGMIGVIRG-NMDVS
A0A1J1CCX0      EILHCIRAPEEDELG-------------------------REILSEEELTGVLIRTVEFE
A0A3N5JLC6      -----LRVLQRPDTLNASLQMLNWLSLDSKKDWS------ESEVFDEQVKNLRE-ELDVR
A0A3M2FFC7      -----LSLFHPNDDG-------------------------EYLTLREMAQIIRE-NMEVI
A0A3M1AH62      -----LEILGNGEHGHRSPGMIASFTGFIKGIFGIESEESNEYTFEDMVQELLDERLSVT
H1XXK6          -----ISFFKKLEDG-------------------------SDLTFNQRVAIVMS-SLEVE
A0A1F4N1P8      -----LKIFQPADDG-------------------------SYMTSRSQVNWIME-HLEVN
A0A3M1XV95      -----LQIFQPDESG-------------------------VYMTFRDQVEWVMD-NLEVT
A0A3M1NWV5      -----LEIFQPDENG-------------------------DYMVLRDQVDWILD-RLTVT
A0A3M2I7J5      -----LSIFQPTSRG-------------------------DYLTLREQIDWILD-HLTVT
                                                                            

A0A3M1XW99      DNPGELLKRFAASD-------------------------TIDVNQLVLAVNPGFFEQHNI
A0A3M1AHA0      PVPGDYLLRLNNDATYSLFILLDDKRKRKIKEGLVNQILDSPLSANGFNLQISPNLLNVP
A0A1F4MQ28      ---------------------------------------NSAFNLPNLIFTMQWSAASAG
H1XPL7          PVRD-----------------------------------S--------------------
A0A3M1P834      PVSGDYFLRLTADGRYSLSMIIPDTEREKQLKTGSVADITNGLCVVNGLSFRLVRNVPLP
A0A3M1NQ37      AVDD-----------------------------------TVAVNKMKFKLNKPFVLGYSK
A0A3N9NLG8      HRKD-----------------------------------T--------------------
A0A1J1CCX0      PVRD-----------------------------------S--------------------
A0A3N5JLC6      HIRN-----------------------------------T--------------------
A0A3M2FFC7      NKKE-----------------------------------T--------------------
A0A3M1AH62      PIRD-----------------------------------T--------------------
H1XXK6          PRRD-----------------------------------T--------------------
A0A1F4N1P8      PKKD-----------------------------------T--------------------
A0A3M1XV95      PKKD-----------------------------------T--------------------
A0A3M1NWV5      PKQE-----------------------------------T--------------------
A0A3M2I7J5      PKTE-----------------------------------S--------------------
                                                                            

A0A3M1XW99      HELRWQVRDVNEAVDKLRNKINYMLDKSR-TILTITVSHKNPKRAAQIANTLAELFVDMN
A0A3M1AHA0      QDIEFTILPFREAVKEFQSKTNVSWNRSG-TLMTLTMTDEDPYLAAKMTNRLAEIFVEES
A0A1F4MQ28      SEVYFNVQNLEIVVEQLAERISIRKIGKT-KIFQLSVKSDSPFEAQLLAATVVDKFREVR
H1XPL7          ------------------------------EVIKIIAKSGDPRDAALIANQFARAYYERN
A0A3M1P834      LEVPFRIMSFRSAVESFQSRINVRWEDRAGTLMRLTLTDTDPKVVAEMTNRLAEIYIAQS
A0A3M1NQ37      DEIEFKIRPFEMVIESLRRLIQFRSEDRYGTIFTISVKHYNPNRAAKIANTLAKKFIDLN
A0A3N9NLG8      ------------------------------DIITLTYTSNSSFDAAFIANTIAEEFRSLN
A0A1J1CCX0      ------------------------------EVIKIIAKSGDPRDAALIANQFARAYYERN
A0A3N5JLC6      ------------------------------DMMQINFRAHSAFEAYFVANALADVYERIS
A0A3M2FFC7      ------------------------------DIIEITYSAPSAFEAAYTVNAIAQEYADAS
A0A3M1AH62      ------------------------------EMIEIKVRAVSPEEAAFITNTLTAAYREKN
H1XXK6          ------------------------------DIITLTYRAGSPFEAAFLANVISEEFAKLN
A0A1F4N1P8      ------------------------------DVIEVKFQAGSPFEAKNIANEVIQNFRMLN
A0A3M1XV95      ------------------------------DIIEIKFSSRTPFEAAAICNVIAEAFRDLN
A0A3M1NWV5      ------------------------------EIIHVTFQARSPFEAARICNEVVVTYQQLS
A0A3M2I7J5      ------------------------------DIIEIVYVASTPFEAATVCNVIAESFQKLN
                                               :: :      .  .      .   :    

A0A3M1XW99      LHLRRRQSDEVVSILQNQLRVAKADLDAANERLRRFRERNPWVTLSKGDNAQINVVSSLQ
A0A3M1AHA0      ASLKKKAVEKKRELLEEQVRLAKAKLDESERALKEFKEKYA-INLDAEQQTQLNQMVAAE
A0A1F4MQ28      LEQKQQTVKYSYDFADQQLQQIDQKLKAAEDTLSKFKSKHKITSIDDNSAEVVDFLSKLE
H1XPL7          LRMSRTRSKAAREFLEKQLIAKQEQLAKAEEALQRYMEQTGIVSVDDESQKVIEQLATVQ
A0A3M1P834      SSVKKEMSQARVKILEEQLQKAREELEASERELVQFKKKYE-VALDADQKGQLNQLALLE
A0A3M1NQ37      IKLRHHKGAQKLKILENQLQLAKKELDEANAKLKAFRKRYPWVVLTPTAGSYVTSVSNYE
A0A3N9NLG8      AEENSGELSELRNFVERQLEKKSEELKLSEDRLREFQEKEKLTSLDENTSELVNTLSGYE
A0A1J1CCX0      LRMSRTRSKAAREFLEKQLIAKQEQLAKAEEALQRYMEQTGIVSVDDESQKVIEQLATVQ
A0A3N5JLC6      QEESQAEVRQVKEFLEEQLKLYEQELKHSEEQLKSYQESAHVVALDNETIELVQKITDFE
A0A3M2FFC7      VEFNQGELKDLRKFLEEQLRKKGQELTSSEELLRDYQERERVASLDEETSELITRLSAVE
A0A3M1AH62      RLMSQEEVRQVKNFLEEQLQVVKKQLAESENKLKQFKETQKVVALSHETEELIKKLAEFE
H1XXK6          AETNRMEVSEMRKFIEDRLAIKAKELKESEEALKEFQEREKIASLDAETQELVTRLSETE
A0A1F4N1P8      IELNKQELVDLRDFLEEQLQIKREELRNSEEALKNYREKEKLISLDKETSEAISRYAESQ
A0A3M1XV95      REFNRSEFRELRQFLEKQLASKEKELRSSEEALKNYREEHRLVHLDEETSDLVSRVADIQ
A0A3M1NWV5      KEVNLSEFKDLRQFLELQLRKKSEELKQSEEALRLYREREKLVSLEESTKELISQLAESQ
A0A3M2I7J5      RDFSRSELRELRRFLEFQLKKKSEELRQSEEALREYREREKLVSLDAVTSELISRLAEVQ
                             : : .:     .*  ::  *  : .      :       :      :

A0A3M1XW99      LTKNQIEQTLNDLQALVERTAQAADPAVKFSTA-----RELVTYLTDMKVALAPAFEKEY
A0A3M1AHA0      QEKENLVAYKKALKGLLAR------LDSETLSS------------SGDGNTQAQLNRRYI
A0A1F4MQ28      TEKVNTDLELTEYENKIQE------MRREVKNRGYFDQTYLTPESNNESYSPFSVLLRQL
H1XPL7          AQYENVSIELESVKESLNF------YRKQIARQ----EPNVARIMSDASDPYIRLLQEEI
A0A3M1P834      KKRDDLETTLKT-------------LNDLLQKK----EEEERALAGPDADPYATDLRYVM
A0A3M1NQ37      EKKQQAEMTVADIQNYLKNLNNSQGLDEKINNT----RELLTY-LGGQGRPVIPEYLRRF
A0A3N9NLG8      AKLEQAQIELRSNLELKKS------LEQQLNER----KETLSTDLSEISSGYLLSLQSQL
A0A1J1CCX0      AQYENVSIELESVKESLNF------YRKQIARQ----EPNVARIMSDASDPYIRLLQEEI
A0A3N5JLC6      TLYNSARTDLLAARQRLDY------IDSELARQ----NTNFDIE-TISKTTALEEFTRKI
A0A3M2FFC7      AELEQSQVMLQASLEMKNS------LEKQLDER----RETVSSELSEISTPYIQTLQEEL
A0A3M1AH62      TLYNEAKTELNSFKERLSY------IDKQLGKS----KQNFDIE-SISATTYFEELKKEM
H1XXK6          SFLEQARIELNSKLQLKKN------LEEKLNER----KETLPANLSEISTPYIQTLQQEL
A0A1F4N1P8      AQLEQALVEMDAYLEQKKS------LEDQLENR----RSSFSTEISVVSSPILEQLQSEY
A0A3M1XV95      SQLDAAMVELEAAQENKRN------LEKQIDER----RQSLSIEVTQVSSPLLKELQEQY
A0A3M1NWV5      AELEASMVELESLQEQKRN------LEKQLEER----RKALSSEVTQVSSPLLVELQQEY
A0A3M2I7J5      AELETAAIELEAAQEKKHN------LEKQLEER----RETLAVEVSQISSPLLQELQKEY
                                                                            

A0A3M1XW99      NDLVVKRNTLLQQYAPTHP---------FVVQVEKDFESFRSKLLQAAQD----------
A0A3M1AHA0      FRQIAEHPVFDN--------------NATMLVYRAKLLDLEDQWKQVVDVSSAENP----
A0A1F4MQ28      SDLELKRLELL---------QKRKDTHPDVVTINEQISQIKAQLTDYNQN----------
H1XPL7          ARLEVEK---DITISQNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVLPGQL
A0A3M1P834      NEIAS---------------HPAFDGSAAMLIKRSRLKDLETQWRAIVNSTTERNI----
A0A3M1NQ37      NELETERNTLLSTYAPSHPLV--------------------------------------L
A0A3N9NLG8      AQAEAEKTKYMMAIQSEVQDASKQHFESRLKVYDERINALREKLNEEAKKISSSNM---V
A0A1J1CCX0      ARLEVEK---DITISQNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVLPGQL
A0A3N5JLC6      AEKEAQLAVYQSETIQK---GESQFTRRQIETLQRQIDALKAQFKQNVKNIAANQF---V
A0A3M2FFC7      ARIVAEKTKYETAVASQATGVNSDYFNAQIAEYDSKIKSLKQRLEEEAKKLSTSSM---V
A0A3M1AH62      ATLQTKRASYVANMINQGV-YNKND--IQLQKYDEQISILTDKMKSELAKLASQEI---L
H1XXK6          ARVVAERTSYVTALETQVQ-SKREFFTPELVRYDERIKALKKKIREEAAKIANSEM---I
A0A1F4N1P8      AKLVSEKVTYETLIAQDR--VDPAEYNLQLQSLENRLKAQEKRLQDEAKKIAATSM---V
A0A3M1XV95      AELVAEKLKYETLVKQDLS-IDPQEYQLQLSSMTSRIKAIQKKLLEEAQRIATTSM---V
A0A3M1NWV5      ARMVNDKVKYEALIAQDHT-IDPQEYQMELLSRANRIKAIQKRLQEEAQRIANTSM---V
A0A3M2I7J5      ARMVSEKVKYETLIAQDRT-IDPQEYQMQLQSMSSRIKAVQDKLQEEAQRIANTSM---V
                                                                            

A0A3M1XW99      -----------------------QLNVLRQRLASTQQQIEESKKKLQRLPQKELELAELV
A0A3M1AHA0      -KAKEIDAEISLTHLQIKKLALQEIDDLNKQIARLESKINQLKFKLKQLPAQQQKLNELT
A0A1F4MQ28      ------------TIIAYQI----IINSLREKQNRLLSLIQKYSGRIESLPAEESQLAELI
H1XPL7          TDPAKYLVEVKQKIFDTQI----QVQALEAKKKALAVVLLDYQKQFDRIPKRSIEFARLQ
A0A3M1P834      -KARQVLAQIRSLHTEIEQIARREMIGIQQELEQTKREIAQQEYKLKQLPARESELSELT
A0A3M1NQ37      KNQEAIEDLIQKIITEAHI----FLKIVQDQIGTYSAKIESEKQRLAGLPTKELQLAELV
A0A3N9NLG8      SDPFQLSQQLLTQYLDVES----KVKAGTATINALQEVVSEYGGRLNFLPEKTLELARLE
A0A1J1CCX0      TDPAKYLVEVKQKIFDTQI----QVQALEAKKKALAVVLLDYQKQFDRIPKRSIEFARLQ
A0A3N5JLC6      -DPAKVSSALFTSKIEVET----EIRSLEPKVSAFEKILEQYNAELEGLPTKKLQLARLA
A0A3M2FFC7      QDPFQLTQELVSRIINLDA----EIKANTAKINTLQEVINTYNAQLESLPVKVLELARLK
A0A3M1AH62      -NPVAVNEELFARKVEVEA----NIEALKPKVTSLKKIVDDYEAQLETLPDKSLKLARLE
H1XXK6          SDPLRISQDLVNQLINLSG----EITATEAKIAALEDVLKVYNQRLENLPDKVLQLVRLE
A0A1F4N1P8      QDPLLIAQNLTVKILEAET----QIKGLRAKITALQNIMKDYDIQLSKLPNQSLELARLT
A0A3M1XV95      ADPLQIIQDLLAKELTVDN----EIKALRAKIEVLSDILSQYEAKLADLPEQSLELARLE
A0A3M1NWV5      SDPLQIAQELITTKLQLET----QIKGLRAKMDALRDVVQQYESQLEVLPSQGLELARLE
A0A3M2I7J5      ADPLQIAQKLIAEILDVET----QMKALQAKVDALREVVDEYELELERLPGQGLELARLQ
                                        :             :      :  :*    ::  * 

A0A3M1XW99      RDQEVKNDIYLKILSRLNAAKIENQVEVSDVFIVDYATPP-TPKDPLSDLIKKG-LFGVL
A0A3M1AHA0      RTNQVLEKQYTDLLAMYRDAQITEAVETEDIEILDPAIEPEFPKNLNKKIQA---GLGGI
A0A1F4MQ28      RQKEVYAKMFSLLLDKREEMRMAELSKLQDIIVVDPAQKPLKPISPRKSLNV---ILALL
H1XPL7          RARLSAEKLYLLVEEKYQEATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNL---MLGAL
A0A3M1P834      RRNSVLAKKYQDLLAKSQDATISAAVETGDIEILDPAIVPDAPTNKDKKQKA---ILGGL
A0A3M1NQ37      RNQSLKSNLYEAILGRYNAAKIDNEVVVSDIVVIDEAIPP--PWQPEIYVLIKQSLMGFF
A0A3N9NLG8      RKRKVDEETYVMLTQKLEETKIQAAAQSRNVHVIDQAIEPMAAVRPKTNMNI---MLGVL
A0A1J1CCX0      RARLSAEKLYLLVEEKYQEATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNL---MLGAL
A0A3N5JLC6      RSAQVAEKLYVMLQEKYQESRITEVGQLGNVRVIDPAKEPYEPILPRKGLNM---LLGVL
A0A3M2FFC7      RRQMVDEQTYMLMTKRLEETKIQEAGQRKEVRVVDEAIEPLFPTKPKKKLNL---ALGVV
A0A3M1AH62      RSARVDEKIFIMMKEKYEESRINEVGQLGDVRIIDPAKPPSEPIKPKKKLNM---ILGML
H1XXK6          RRKQVDEQTYMMLTQKLEEAKIQESAQARNVKIIDRAIKPNRPVKPNKRMNL---MLGAM
A0A1F4N1P8      RELEVDQETYNLMTKKLEETRITEAGQEENIQILDLAILPDSPIKPKKRLNL---MLGAL
A0A3M1XV95      RQLQVDQNTYVLMTEKLEETKISEAGQKENIRIIDLAVEPLNPVKPKKRLNL---LLGAL
A0A3M1NWV5      RQVQVDQNTFILLTQKLEETKIAEAGQRETIRIVDPAIEPKFPVSPKKKLNL---LLGAV
A0A3M2I7J5      RRVEVDQNTYILLTQKLEETKIADAGQKDIIRILDRAIEPLSPIKPKKKLNL---LLGAL
                *      . :  :        :        : ::* *  *  .             :. .

A0A3M1XW99      IALGAGLGMGVVVDFFDKTVKDVEDLNQKVQYPVLGQIPVIQVVEPDE-----KNLEESR
A0A3M1AHA0      FGLILGIGLAFLLEFLDKSIKNADEVKKFLKLTVLGSIPQIDFSDVYD------------
A0A1F4MQ28      AGVMLGLTAIFVLEHFEKRLTNLDDVERLFSVTLMGILPVYDAQLREQ------------
H1XPL7          LGLGLGVGLVFLLEYLDVSIRTPEDL-KRRGWQPLSVIPSMDSQMI-------AELAQNK
A0A3M1P834      FGILLGMGVVVVTEFLNKTLRSVDDVRRYLKLPILGTIPQIDFSDVFD------------
A0A3M1NQ37      VALAIGIALAIVIDFFDKTVDNAEDLQQKLYYPVIGTIPVIQNDESVP-----ENIEEIK
A0A3N9NLG8      IGLGLGIGLVFLMEYFDNSVKTSEEL-EAMGFNILASIPKIEMDKYEEKLE--SKLEKLG
A0A1J1CCX0      LGLGLGVGLVFLLEYLDVSIRTPEDL-KRRGWQPLSVIPSMDSQMI-------AELAQNK
A0A3N5JLC6      LGLGFGIALAFTMDYMDDSITSMEDM-DSLGLPLIATIPMIKPDTTGSLF---SRVARID
A0A3M2FFC7      LGIGLGIGITFLREYFDNSIKTQEEL-EQLGFNILATIPKIEMSKVEEKLE--ARLAKMG
A0A3M1AH62      VGIGLGIGVTFLLEAMDNSVRTIEDL-EKLGLPVLGSIPVIKEEDAMKRIKVLPQSAQNG
H1XXK6          LGLGLGVGITFMIEYLDRSVRKPEDM-ERMGYNVLATIPKIELDKVEK-----SKIKQNE
A0A1F4N1P8      IGLGLGIGLTFLLEYFDDSIKNPEEL-EKMGFPILATIPEISSKEVIE-----NVISANG
A0A3M1XV95      IGIGLGVGLTFLLEYFDDSIKNPEEL-ERMGFPILSIIPQIPLSELAQ-----KILSRNG
A0A3M1NWV5      IGIGLGIGLTILLEFFDDSIKNPDEL-ERMGLPILSIIPQISQDELSR-----PKVAVNG
A0A3M2I7J5      LGIGLGVGLTFLLEFFDDSIKNPEEL-ERMGFPILAIIPEISQEDVVS-----KKFSRNG
                 .:  *:   .  : ::  :   :::        :. :*                     

A0A3M1XW99      G---------KIDPKLITLDYSPTLESESYRDLRTKILFRNKNQNLHSFLVTSLQPNEGK
A0A3M1AHA0      --FQDSEKLKQIDQQLVTHDYSPTPIGEAYRSLRTNILFSRERGQLQSMVITSNEPGDGK
A0A1F4MQ28      -----IRNSKSIEERAVVLIKEQYAFKEMYRLLRTKIGNIPGG---KMMMFTSCEENTGK
H1XPL7          E-------NPAIDDHLIALLSPRSSVAEGYRRLRTNLQYARLDKPLKSFLVTSPNPKEGK
A0A3M1P834      --FQDSEKVKQIDQQLVTHDYSPTPIGEAYRSLRTNLMFTKETGRIRSLVITSNEPGDGK
A0A3M1NQ37      G---------KRDPKLITLDYSPTLESESYRDLRTKILFMNQNKNLSSFLVTSLRPGEGK
A0A3N9NLG8      P-----IEGKRIEARLITHLDPKSPVAEAYRTLRTNLQFSKIDRQLKTILVTSSGPKEGK
A0A1J1CCX0      E-------NPAIDDHLIALLSPRSSVAEGYRRLRTNLQYARLDKPLKSFLVTSPNPKEGK
A0A3N5JLC6      D-----PEVNAINERLVTHLKPKSPVSESYRSLRTNILFTAPENPKQVILVTSSGPREGK
A0A3M2FFC7      P-----MEGKRIEARLITHLDPKSPVSEAYRSLRTNIQFSRVDQKIKAVLVTSSGPKEGK
A0A3M1AH62      N--VDPVHIRRMAARLITHFAPKSPISEAYRTFRTNIQYTQVDKPIKSLLVTSPGPGEGK
H1XXK6          S--------AKIEARLITHIDPKSPVSEAYRTLRTNLQFSKIEKDLKTILVTSAGPKEGK
A0A1F4N1P8      E-SEEMGEARQIETRLVTHFDPKSPVSEAYRTLRTNIQFKNKKTKQHVILVTSSAPKEGK
A0A3M1XV95      DKEAEIQEGKQIESRLVTHFDPKSPVSEAYRTLRTNIQFKNLKNTNPMILVTSSAPKEGK
A0A3M1NWV5      N--GELNEGEVIESQLITHFDPKSPISEAYRTLRTNIQFQNLGTDNLSLLVTSSAPKEGK
A0A3M2I7J5      Q--GQLSEEQLLESRLVTHLDPKSPISEAYRTLRTNIQFKNLRQKENTLLVTSSAPKEGK
                              . :.         * ** :**::           .:.**     **

A0A3M1XW99      SLLTSNLAITIAQQKISTLLIDGDLRRGVQHSTFGNKKK-PGLSDFLVSRATIDYDNVSK
A0A3M1AHA0      SFTAANLSITFAQLKSNTLLIDGDLRRGVLHNTFGVPKE-PGFSNYLTSMIPIQ-----H
A0A1F4MQ28      TTVISNLALSFAKMGKKVLVLDCDLRKGKIGKFFDLPENARGMIDYLSNNQNRP-----E
H1XPL7          TTTASNLAITFSQAGLNTLLVDTDLRRPAIHRLFGLPKE-PGLTNHLFGQNTLD-----E
A0A3M1P834      SFTAANLSITLAQLRSNTLLVDGDLRRGVLHNTFGVAKE-PGFSNYLQDVVPLQ-----S
A0A3M1NQ37      SLTASNIAITIAQQKISTLLIDGDLRRGVLHNEFGNKKR-PGLSDFLISKATVDHDNVNK
A0A3N9NLG8      STTAANLAIAMAQVGNKVVLVDADLRRPVIHSIFGIDKE-DGVTNYLMGKNNFE-----E
A0A1J1CCX0      TTTASNLAITFSQAGLNTLLVDTDLRRPAIHRLFGLPKE-PGLTNHLFGQNTLD-----E
A0A3N5JLC6      STSVANLAIIFAQMGAKTLLIDADLRRPMLHKLFRVNQQ-PGLTNVLIGQKQLE-----E
A0A3M2FFC7      STTSANLAIAMAQSGKRVVLIDADLRRPVVHSIFGMDKD-EGLTNYMMDDIDYD-----T
A0A3M1AH62      STSVANLAITMAQMGSRVILVDADLRRPVLHSVFDTDRR-IGLTNVLVGRVSLD-----D
H1XXK6          STTAANLSIALAQAGNRVVIVDADLRRPILHSVFGTTKE-EGLTNHLAGSISYE-----Q
A0A1F4N1P8      STTVANLAITMAQMGNKTVLIDGDLRRPVIHSIFNMKKE-NGLTNYLIGNATLK-----E
A0A3M1XV95      STTVANLAITLAQMGARVLLVDTDLRRPVIHSIFNLKKE-KGVTNFLLGKMTFE-----E
A0A3M1NWV5      STTLANLAITMAQMGSRVLIVDTDLRRPVVHSIFKLKKD-KGITNYLMGKLPFE-----D
A0A3M2I7J5      STTIANLAITMAQMGSRTLLVDTDLRRPVLHSLFNLKKD-KGISNYLVGKLTFD-----E
                :   :*::: :::    .:::* ***.      *       *. : : .           

A0A3M1XW99      VIHPTF-I--PNLFLIPAGSPIPNPTEVIGSTRMQDLLQLLGTKFGMIVLDTPPISASSD
A0A3M1AHA0      IIHETH-I--PNLSLITCGSLIPNPSELLASHQMKRFLDEMRRKFDLIIFDSPPLNAATD
A0A1F4MQ28      VYNNFSFLTQQTLAVVPNGGYTDDSSELLSAMAVKSMLEDFQKAYDYILIDTPPITKVSD
H1XPL7          ITHKEV-I--PHLSVMTSGLVPPNPSEILAAPQTHELIDRLKSMYDLVIFDTAPVLAVTD
A0A3M1P834      ILNPTQ-I--PNLTLISCGSLIPNPSELLGSHQMQRFLDEVRRKFDLIVFDTPPLNAATD
A0A3M1NQ37      LIQKTF-V--PNLYLISTGSPIPNPTEMLGSERMVNLMNLLKSRFGMIILDTAPFQASSD
A0A3N9NLG8      TIKSTF-H--ENLFIFTSGILPPNPSELLASQKMEQLLHKLNENFDTIILDSPPVIAVTD
A0A1J1CCX0      ITHKEV-I--PHLSVMTSGLVPPNPSEILAAPQTHELIDRLKSMYDLVIFDTAPVLAVTD
A0A3N5JLC6      AITAVPDV--LNLSLLTCGINPPNPAELLGSERMNILLQKMRQEYNMVLIDTPPVNAVTD
A0A3M2FFC7      MIKKSI-M--DNLYVIPSGVLPPNPSEMLESEKMKKLLERLRNDFDFVLFDTPPIIAVTD
A0A3M1AH62      AVKETE-I--NNLYLLPSGTLPPNPSELLGSTAMKQLLDELKQRFDMVLFDSPPIIAVTD
H1XXK6          VFKETV-V--ENLSLVTSGVLPPNPSELLASKKMEDFLNKLCEDFDIVVLDSPPVIAVTD
A0A1F4N1P8      IVRPTF-V--EHLAVIPSGPLPPNPSELLGSDEMKKLLEDLKNQFEVILFDSPPVIAVTD
A0A3M1XV95      VIKPTI-I--DNLFVCTSGPLPPNPSEILSREEMKEFITIAKQQFDYLLFDSPPIIAVTD
A0A3M1NWV5      IVKPSF-V--ENLYIVTSGPLPPNPSELLASEAMENFVQEARNNFDVVLFDSPPIIAVTD
A0A3M2I7J5      IVKSTF-I--DNLFIVTSGPLPPNPSEMLSLETMDEFIDRARREFDVVLFDSPPIIAVTD
                            * : . *    :.:*::       ::      :  :::*:.*.   :*

A0A3M1XW99      VAILANLVDGALIVVRAGYTNVEELVGRLHEYPSVEEKIMGLVLNMVKVDRKKNQ-----
A0A3M1AHA0      AVVIGTQVDATILVIRAGKTDRDLARQKLELFSNVPANIIGVVLNGTTADLAHPG-----
A0A1F4MQ28      VLILGDFVKDIILIVRPFLTYKEAIRGALEEMRQAGLNLQGVVVNGFNVGKS--------
H1XPL7          ASILATQVEGTLLIILAGTTIFDELEHSIEQLERVNAHILGVAMNNFDIKRAYGSYYGQY
A0A3M1P834      AVVLGTQVDGTVIVIRAGKTHRDLAKSKLELFSNVPARVIGAILNGTTADMAHPG-----
A0A3M1NQ37      SAILSTLVEGTIVVVRAGYTNVDLLNKKIAEYPNIQEKLIGVVLNMVKINVKKDE-----
A0A3N9NLG8      AAVLSTKVDGTILVVSSGQTNKDALGKAFNLLNSVNSKLLGVLLNGVDVKGLYGS-----
A0A1J1CCX0      ASILATQVEGTLLIILAGTTIFDELEHSIEQLERVNAHILGVAMNNFDIKRAYGSYYGQY
A0A3N5JLC6      PSVLARAVDGVILVVRSASTQRGSAFVAVEQLRRVEAPLLGIILNSVSRTSYYGS-----
A0A3M2FFC7      AAILGTIVDGAILVVKAGQTNYDALVRAKSLLDAVNTRILGALLNGVEVGGMYGS-----
A0A3M1AH62      AAVLSSKLDAVIVVVKSAQTDREAAFRATALLKNVKTHVLGALLNGVRIESMYGS-----
H1XXK6          ASILSTKVDGTLLVVYAGQTERDAIKRAANMLNSVSARLLGIVLNGFDVQGIYGS-----
A0A1F4N1P8      AAIMSTLVDGIVLVIKAHQTHREAIKRAKSLLDTAEARIFGSLLNGVNIQKTYGT-----
A0A3M1XV95      AAILASMADGCLLVIKAHQTRKDVVQRAKTLLENVNAKIFGCLLNGVNVERAYGSY----
A0A3M1NWV5      AALLSSKVEGVILVIRAHQTQKEAVKRAKTLLDNVHARIIGCLLNSVDIERAYGS-----
A0A3M2I7J5      AAVLSTKVDGMLLVIRAHQTQRNAIKRAKNLLDNVNAPIVGCVLNSVSIDRAYGS-----
                  ::.   .  :::: .  *                  : *  :*               

A0A3M1XW99      ---YTYSYYNY----------------------------
A0A3M1AHA0      ---YSYYHY------------------------------
A0A1F4MQ28      ---AYYYRYGHGYNYQTISES------------------
H1XPL7          KSRYYGYYGYYTYGHTGGKKAKKKRTETS----------
A0A3M1P834      ---YSYYHY------------------------------
A0A3M1NQ37      ---YSYSYSYYNY--------------------------
A0A3N9NLG8      ---YDYYYYHHYYTKPGKGMKRLKSS-------------
A0A1J1CCX0      KSRYYGYYGYYTYGHTGGKKAKKKRTETS----------
A0A3N5JLC6      ---YYHEEYYYYYTADGEKKHKSKAKSSQEKSVNSQKSA
A0A3M2FFC7      ---YYYYYYHHYYSKPGGKKKRRY---------------
A0A3M1AH62      ---YYYYYHYYYYGKEGDRKRKKKKKRRSKT--------
H1XXK6          ---YYYYYYHHYYGGEGKSKPKRKFI-------------
A0A1F4N1P8      ---NYYYYYYQYYQYYGHDLKRRKRSIA-----------
A0A3M1XV95      ---YYYYYYYHYYNYYGHDLQRRKKSKIF----------
A0A3M1NWV5      ---YYYYYYYHYYSYYGHDLKRRKRTKIT----------
A0A3M2I7J5      ---YYYYYYYHYYSYYGHDLKRRKKARA-----------
                                                       

© 1998-2019