BYKdb

Dataset for cluster orphancd of phylum candidate-division-ksb1

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      -----------------------------------------------WAYYLKKQPPVYE
A0A3N9NJI9      --------MPPNTNAQHGKEWNLEDYLDLVLRRKVIILVVFIVVFVIVLAYALTRPDIYS
A0A1F4QQE0      MPYQDQSYFDS--DQQDVPQIDFKKYLRGIWKRKWLPLILILVFAFPFYRSTQNQIPIYS
A0A3N9N7Z2      MGMEEIESFDQPFEKEPANQLDISKFLKGIWKRKWIILFLCGISAVPFYFIAKNQIPIYK
A0A3N9P469      MAMEDFETFEEPIDKELSSQIDFAKFFRGIWRRKWLIISLSLVFAIPFYFIAKNQVPRYR
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      SSCRIRFRNLASGAEYIIDDSRIIELTSRSFAERVVAQLGLTLQIEEDEYVTR-QRFFEE
A0A3N9NJI9      SRVTFSTEQTQDG--------------------------GLGS-----------GMPYYY
A0A1F4QQE0      AAVLIKTNAFAATEDKILSVERQLELLSRTFLERVAARMGLAIEVESSSATMYRESIFSE
A0A3N9N7Z2      CKVVIQSKKLGENENPIFDGETQAEIRSQSFTERVASVLGLAFANSDSVYTNF-EDVFLE
A0A3N9P469      CRVVIQSKKVGTDEYNIFDGDTQAEIRSQSFTERMAAVLGLAFVNLDSVYKDF-DEVFLE
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      FTTTITPVKGDYVFKWDRDGTYKIYRIIESERELVDEGQLIDAISSLHETANGFSFKLSS
A0A3N9NJI9      YYQMQKPIE--YYQAVMNSG---LFRDKVTKAALHDSILLANGGLS-TEEIYGLLGR---
A0A1F4QQE0      VYTTEEPTAGDYEIEINEFGQYFLSMIKSGKKVGLDSANVWDAVEK-PRSVNGVTFRLNS
A0A3N9N7Z2      YQTTTNPVESRYKIVIDNLGNYYLYQKYGTQKTMVDSANVWDAVDT-PRNVNGISFRLNP
A0A3N9P469      YHTTTNPVEAQYKIVIDKLGTYYLYRKDSDMATPVDSADVWEAVDT-PRSINGISYRLNP
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      EITSMPKEIFFRINKLRNTVKSFQSNINVRRTGGGGILLLSMTDANPVLVAQKINRLAEI
A0A3N9NJI9      --------------------------IGLSKEEYSDLMYMSITAFDPIVAYRIVDIASIA
A0A1F4QQE0      EFVQNASRVKFKILPFGYAVSYLKSKVNLEISRSGATMKLSMTGTNPDVLPAELNRIAET
A0A3N9N7Z2      GFCATAGEFHFRIRPFIKGFKFLEYDIQKKFSNSGKFMVLELRGEDPDLIPKQLNRVAEV
A0A3N9P469      NFSYKPGEFHFRIRPFIKGFKFLYYSVEKTFNRAGNFLVIELEDENPDLIPKLLNRIAEA
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      FVNESKLLKRNSIENYKRTVKEQLQFSEKELEITDQRLKDFKSRHKVSLGAETQEVVSDL
A0A3N9NJI9      YKDRSREIQEEQARATVEYVNRQVALAEENLENAERKLEEFKSKTKFTAVNVNDGIIQRL
A0A1F4QQE0      YVEETKKLKRRDLDNQKKLLMQRMAAAEEQVKKAEEDLKDFNTRYPLSLNAEKQAILGKL
A0A3N9N7Z2      YLQEIKKLKNIDSEDYRTMLQRTLSAAEENMKNSEEALRRFYTQYPLSLETEKNTMTSRL
A0A3N9P469      YLLEIKRLKLMDSDTYRDMLSRNLSAAEENMKNSEEGLHRFYSQYPLSLDAEKKSLMNRL
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      DQVEEGLERYIKDKSDLAELLKQVSGQTAEESGE--LKYVYQQITELQTFQFNPKMGILQ
A0A3N9NJI9      NEIENKITELSTQRELAQANLDVYNERLSQFKDQ---------NAASLWDNESEEIVWMR
A0A1F4QQE0      HSTQTYLRDLPLQRQKLTDLLDEVDKEKEGVDTDKYRRLIIRTIANFAVFNDEPQMAILR
A0A3N9N7Z2      SANEQILRDLPYQRRQLSELLMKVDNPEDGYEMD-YRRVVVHKIADFEVMADEPELTIYK
A0A3N9P469      AANESALRDLPHQRRMLSNLLMKLENPEDGYERE-YRRVVVHQLASFGAMTQEPELIIYR
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A1W9SG21      KQLKDLESNYNSVVSNFSETHADATQLEEQIKNVQNSIRIEARNHLDDLTAKIAE-----
A0A3N9NJI9      QEIEQLQNQKNALEENNAS--------SRQIQQLANEIDERKQQLRNAVLKRSAENPSAQ
A0A1F4QQE0      QTLEEQETRYNDLVKNFSENWEPVIDLKRQIKDTEEKIIKFASKYRNTLAQQETD-----
A0A3N9N7Z2      QNLENLERRYDELYSKYSAEHEDVLECANRIKETQDKIIEFASNYRNILAAKETK-----
A0A3N9P469      QNLENLEKEYDRLYSEFSAEHKDVINYAKRIQETQDKIIEFASNYRNILAEQESA-----
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      -------------------------LPEKSL---------------------RLARLERA
A0A1W9SG21      -----------MKTEKSTLEYKLGRLPEEQY---------------------QLTELERE
A0A3N9NJI9      GAIGDEQELAVYQERKIEEELNLFTLKNQERYYTSLRDTYRKQHPNMLEHSIELAKLQRA
A0A1F4QQE0      -----------YRKMYADIQAQLKNLPRDEY---------------------QLMELQRN
A0A3N9N7Z2      -----------HEKIKTELEAQLRALPDEEG---------------------RLLELERN
A0A3N9P469      -----------QRKEKVELEAKLHTLPSDER---------------------RLMELERK
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
A0A3A0BWH6      ATVDEKIYLMMQEKYEETRITEVGQLGQVRIIDTAQAPKEPVKPRKKLYLVLGALIGFGL
A0A1W9SG21      LDAKEKIHRELLAKSQLAQLTEAVETEYVDILDPAIVPDEPMSRDKKKKALMGVFFAFFL
A0A3N9NJI9      KTVNATLYNFLIQKGEEAKIKAATGTGGVKVISPPAIPERPIPKNTMRDIFVGVILGLGL
A0A1F4QQE0      KDVADGFYNSLYSQLTKTNISEIAETDEIAILDRAVRPGKPINPSTKRSVLLGSSLGFLL
A0A3N9N7Z2      KRFDEELFNSLYVEMKKLQVSDASLDPGIRILDHASRPTKPINPSRKSQVMMGSAFGLML
A0A3N9P469      KQVDEELFTTFYVEMKRLQVSGTGSDAGIRILDRAARPTTPVNPSKKRQVMLGSGLGLLF
                                                                            

A0A3N9NL50      ------------------------------------------------------------
A0A3A0DU25      --------------------MQKSLTNSIVSV----FS----------------------
A0A3A0DZV2      --------------------MKTSVAKFKKSAKPLGYY----------------------
A0A3A0BWH6      GLGLTFLFEYIDNSVRSIEDVE-HIGLTVLGSIPVIKE-DEALKRLKVLPGMNGNLDTLE
A0A1W9SG21      GVGLAFTLEFLDKAIKSVEDIKRYLKLQVLGTIPNIDF--------NEVSDYQ---DSEK
A0A3N9NJI9      GVGLAFGLDLMDQSIHTPEDVEKHLALSTIGTIPHIDYVTKKADRDKRIPVLQ---DRRN
A0A1F4QQE0      GIILSVIWELTDKTMRTVEDVERSLRLPVIGAIPVMDF--------KDVPEFH---DFEK
A0A3N9N7Z2      GLLLSIGIDIADRSLHTLKDVERHLNVPVLGTIPTVRF--------KDIPDFR---DDQK
A0A3N9P469      GLFLSIGLDIADRSLYTLRDVERYLNLPVLGTIPVVSF--------KDIPDFR---DDQK
                                                                            

A0A3N9NL50      ------------------------MIEAYRSLQLNLSFLNPDNKLKTILITSAAPGEGKT
A0A3A0DU25      --------------------DETPEANEFRRLYSKLKNLYAADEMKNFLVTSAKMNEGKS
A0A3A0DZV2      --------------------LETPELNEFKRLFNRLHTEKQKHGTKIFMITSAMMSEGKS
A0A3A0BWH6      SKKMAARLITHFA-------PKSPISEAYRTFRTNLQYTKLDRELKAILVTSPGPGEGKS
A0A1W9SG21      IKQIDQQLVTYDY-------SPTPIGEAYRSLRTNLVYSKTTGRMQSFVVTSAAPGDGKS
A0A3N9NJI9      GKPAKDGVNERIFQLLPMLGSKNPLVESYRNLRTDLQFVNVDEPIKSIMFTSATPGEGKS
A0A1F4QQE0      VRQIDKQLVTDDY-------SATPVGEAYRALRTHLMFSKNTGKFQSLLITSISPEDGKS
A0A3N9N7Z2      ALQIDRQLVTHDY-------SPTPVGEAYRALRTQLLFARGAEQIRTLLITSISPEEGKS
A0A3N9P469      ALQIDRQLVTHDY-------SPTPVGEAYRALRTQLLFARGSERIRTLLITSISPEEGKS
                                          : :. :   *         . ::.**    :**:

A0A3N9NL50      LTTLNIAQIYAR-SGIKTLVIDCDLRRPMVHKALKIRQEPGLTNLLVDKTATLDSCVQLL
A0A3A0DU25      TIAALLACTIARYRNTKTILVDCDLRRPRVHQLFGMPKEEGVADVLM-GTRKLDTCFK--
A0A3A0DZV2      TVAAYLAVTSALYQSTETVLVDCDLRRPVIHRHYELPLQQGIAEVLS-RELDLSAAIK--
A0A3A0BWH6      TSVSNLAITMAQ-MGSKVLLIDSDLRRPVLHTIFKVDRRIGLSNILV-GKVSVSEAVQ--
A0A1W9SG21      FTSANIAISMAQ-HKSNTLIIDADLRRGVLHNTFGVPKEPGLTNYLT-GMVSFQHLVN--
A0A3N9NJI9      LNTANLAISFAE-LGKKVLIVDCDMRKPVQSKIFQVEKSPGVSDYLA-RELTVDEIIQ--
A0A1F4QQE0      FTSSNLAIIVAQ-QKTNTLLVDADLRRGVLHNTFGLPKDPGFTNYLT-NKITLLEAIQ--
A0A3N9N7Z2      FTASNLAIIMAQ-QRTNTLLVDADLRRGVLHNTFSTTKEPGLTNYLS-NNATLASLIQ--
A0A3N9P469      FTASNLAIIMAQ-QRTNTLLVDADLRRGVQHNTFSTSKDPGLTNYLS-NKATLVGLVQ--
                     :*   *     :.:::*.*:*.             *.:: *      .   .:  

A0A3N9NL50      DDEQLNGHLAVLTCGAIPPNPVELLSSKSMQDLLTKAQAIYELIFIDAPPVISVSDSVIL
A0A3A0DU25      --QTPIENLRLLTSGGVVTSPTELINSARMRDLFSEIKFYFDTIIVDSPPVIPVTDALIL
A0A3A0DZV2      --PSALPHLKIITAGKPNQTPAELFSLTHLQSVVDEMREKFSIIIFDAPPIIPVSDTLLL
A0A3A0BWH6      --KTEIDNLYVLPCGTLPPNPSELLASSAMTRALEEMKDLFDIILFDSPPIIAVTDAAVL
A0A1W9SG21      --DTLIPNLSMVSCGSLLPNPSELLGSHQMQRFLDEAKRKFDIIIFDSPPLNAATDAVVI
A0A3N9NJI9      --KTAITNLSLVTAGTSPPNPAEMLDSHKMTELISKLTDRFDLLIFDSPPLIAVSDPKIL
A0A1F4QQE0      --PTHIPNLSLISCGSMIPNPSELLGSLQLRRFLEDARRKFDVIIFDTPPLDAATDAVVL
A0A3N9N7Z2      --PTHVPNLSVLSCGSLIPNPSELLGSMQMRRFIAEVKRKYDFIIFDAPPLDAATDSVVI
A0A3N9P469      --PTHVPNLSVLSCGSLIPNPSELLGSMQMRRFVAEVKRKYDFIIFDAPPLDAATDSVVI
                       :* ::..*    .* *::    :   . .    :. ::.*:**: ..:*. ::

A0A3N9NL50      GQKVDGVLLVLRSGKINREAAQKAKKILENGKINIAGTLLNDVDYKNVYGYYKDYY---Y
A0A3A0DU25      SPEMDGALLVLKAGETHKAVVQRAVDLIRNAGLNILGVIINNQKAVLPYYYDHKYYGYSY
A0A3A0DZV2      SNFVDGILIVVKAGKSQKRVTQRALDMLQTNSDKILGVVVNNLRSALPYYYDHRYYGYKY
A0A3A0BWH6      CPRLDGVILVLKSGQTDRDAAFRAYTLLKNVNARLLGSLLNGVQIESMYGSYYYYYHYYY
A0A1W9SG21      GTQVDALVLVVRSGVTDRDVAKHKLELFKNVPVRILGAVLNGTNSEFGHDGYSYYHY---
A0A3N9NJI9      APKVQNVLLVVRVGKVNYRLVKDAYSRLDKVDAKVIGAVLNGVGTKRGYGYYSRYNYYHH
A0A1F4QQE0      GTQVDAMAVVVRSGKTSRTLAKEKLEIFETVPVKLIGIILNGSETA-LVHNYSYYHY---
A0A3N9N7Z2      STLVDAVVVVVRSGKTNRNNAKERMDIFSTVPARLAGVVINGTEEANMKNSYSYYHY---
A0A3N9P469      STLVDAVVIVVKAGKTNRNNAKERLDIFNTVPANLVGVVMNGTEEANMKSSYSYYHY---
                   ::   :*:. *      .      : .   .: * ::*.            *     

A0A3N9NL50      YSDKDKIK---------------------
A0A3A0DU25      YNTEEKVK---------------------
A0A3A0DZV2      YRQIENANAKRSDH---------------
A0A3A0BWH6      YGKGDGKKSKTRRSRHSSTNAA-------
A0A1W9SG21      -----------------------------
A0A3N9NJI9      AEYYTSIEKKSADKRRKKPYIKPQFFKSS
A0A1F4QQE0      -----------------------------
A0A3N9N7Z2      -----------------------------
A0A3N9P469      -----------------------------
                                             

© 1998-2019