BYKdb

Dataset for cluster tadcd of phylum candidate-division-ksb1

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3N5J836      ---------------------MEGKDTTHQLSEFLRILFRGRWIIAVSFLAVVGAVTFLT
A0A3N9NDM0      ----MDNIDLFKEMELEGFRLQNNQKLSTVLIDYIKIMFRRKWLIALCTIAVVVPITIWI
A0A3A0DV40      ----------MGLDTFAFEDDGAMEGQKLDLGRYVQALKRRWWLALIIAAAVAIPWTIYV
A0A3A0DR05      --------------------MKEKIARQTPLADYLRVLYRGRWIILASFLAVMAITVYLG
A0A1W9SG22      --------------------MYQENERQSGMKDYIRVLYRGKWIIIISFLTVVTFVSYYT
A0A1F4RMF3      MMMNSNGKGQYSGNGHANAYGSDMQERQVSIKDYIRVLYKARWVIIISFLLVVISTAYYT
A0A3N9NPA0      --MNDHASRQTSDNGSMTPMPIETNPSRITWRDYIRIFYRGRYAILVTFLVIFIGSVFFT
A0A3N9PQN5      --MNEHLS-VIPNGNSAAPAGLNGANSRVTWRDYIRIFYRGRYAILVTFLIIFLGSIILT
                                                 ::. : . .:        :        

A0A3N5J836      YRMRPEYSSSASILILNRDMVETEFLNSRPGPVPKSRNLNALEILRSRTIVEDVIRSL--
A0A3N9NDM0      MHVPPSYRADATIIYEEANDTAF-LLDLGQTFYSKSAIVNMIEQIQSRTLAEEVVRSLPE
A0A3A0DV40      KQEKPVYEATATISFRNISAIKNP----------ETMMQRIVEELNSRTFAEQVVAALGL
A0A3A0DR05      MTAVPLYQASAKVMFKTESNIGLPGFEAMGYWQTETMISNQVEIIGGRALAKAVAQKL--
A0A1W9SG22      FTETPIYRSTVKVMVKDNGGVQKTLFNVTDFMEKEKKINNQVEILNSRTIAENVANKL--
A0A1F4RMF3      FTTEPVYEATAKLMIEEEGGMAQSMFDLTSMMKKETMINNQVEILKSRTLAENVIRDL--
A0A3N9NPA0      FSMQPLYEASVRLMLVDQSSVGPSLFDFTSMITKETMMNNQVEILKSRTLAEHVVRDL--
A0A3N9PQN5      FTMRPIYEASVRLMLVDQSSVGQSLFDFTSMMTKETMMNNQVEILKSRTLAERVIRDL--
                    * * : . :     .               :.   . :* : .*::.: *   *  

A0A3N5J836      ---ADSPYRGELEIMREAAPSGMPIT----------------------------------
A0A3N9NDM0      DMIKTFKLPERLPEHLSR------------------------------------------
A0A3A0DV40      AVTLEQESEHEKFLIRNRIFAQLSSTYNPRAGKYVLRVPGDGQFMLAMIDEDADVEIPLR
A0A3A0DR05      ---MQSEQAHELPILGANKHLQSRSGRFSRFLNALFGSSAADDSRNEMQEPV--LLE---
A0A1W9SG22      ---INSTYANNLIILGNTPDNGKKKFGLKKKLKKIVKSVFVNEEEVTIPESEIKEAL---
A0A1F4RMF3      ---MASEYADELRYLGNSPEGKEKKPGIIASTRSWLAGLIKNKDDHGLEVSE--EDD---
A0A3N9NPA0      ---RKSSIASQLEVL--------ERADTVKAAFSLARLLRSKKTEW----VE--SEI---
A0A3N9PQN5      ---RKSSIAQELDIL--------QRPDTVKAAFSISRLLGSNRKPW----AE--AEI---
                                                                            

A0A3N5J836      -------------------------------------FDNRVSTLRNKVGVTLQKDTDLL
A0A3N9NDM0      -------------------------------------DQFIVRLIREELQVEHVRGGDIL
A0A3A0DV40      TGDVFRAASDTISVNGISFQLADPQKLPQKVTFVVAPFKKVVSSLQQRVQPGLNQSLTLM
A0A3A0DR05      -------------------------------------VETVARELPGYISVAPIRSTDMI
A0A1W9SG22      -------------------------------------FNRVVGEIRRNLKIEPIRNTDMI
A0A1F4RMF3      -------------------------------------FDRYVAGLRGSINVSPIRNTDMI
A0A3N9NPA0      -------------------------------------FDDQVVTFRKRLGVRHIRNTDMI
A0A3N9PQN5      -------------------------------------FDDQVQQLRESLIVRHIRNTDMM
                                                      .  .  :   :     ..  ::

A0A3N5J836      KVSVIAYSPFESAFLTNALAEQFYRYSLQTSRGEITDVRLFLEQQLDVVRQQLSQSEEME
A0A3N9NDM0      KIIVQANDPNAAKNIANSYVDHIIDWNTQKNRKEISSIRNFVEGQLSVFQDKLRDAEEAL
A0A3A0DV40      SVKLTDNDPYVVTQTVNSLAKLYVDKSRVVGAGEDTKQLETLQEQVRQAQRDYDEIDQRY
A0A3A0DR05      LLSVVSEDPQEAMIIANAYVEAYSELNRAMSQAEVRQVKNFLENQLGVIQQQLAESELAL
A0A1W9SG22      LISMTAESPTEAAYLANTVAVAYKEQNQFESQEEVRKVKDFLKDQLNNFQSQLEKSEQAL
A0A1F4RMF3      NITVSAYSPFEAAYVTDAVANAYRRMNQAQSKDEVRQVKNFLEDQLDQYRRELSTSEEAL
A0A3N9NPA0      EIKFQAHTPTEAAFVSNAVAFAYERINQEESKAEIQQVTEFLKNQLALYQDSLQVSEDAL
A0A3N9PQN5      EIRYQAHSPEEACFIANTIALAYERINQEESKAEVQQVTDFLENQLQLYQDSLKVSEDEL
                 :      *       :: .      .   .  *  .    :: *:   . .    :   

A0A3N5J836      RTYKENQGVSALDQETTQLVGQSAEFHALYNTTQTELNAQLRRQEYLRRQ------IAET
A0A3N9NDM0      VTFKENNDVIQLSDASSKVLENLTEAEVAYSKARAEREALQQRKHIIEQK----------
A0A3A0DV40      TEAKRRAGGNVGGNRYEVTVAKLSEAEKKLEVLKQQRDGLKELLDRAANTQVSSVSGVER
A0A3A0DR05      KDYLKGETPMTLTDETNGLVTKLVEFESLYKESLADLEAARERLKFIDQQ-------LGK
A0A1W9SG22      KEYKEKEKVVALPQEIDEMVSKLAEFESLYHGAKLELNANKERLVYIDEQ-------LDK
A0A1F4RMF3      KNYKQEAKLVALDQETEELVRKLAEFESLYNGAKTDYQANLKRLEYINGQ-------LQQ
A0A3N9NPA0      KAYQERAKVVALDHETSELVRKIAEFETLYNAAKTDLEAARQRLNYIDSE-------LEK
A0A3N9PQN5      KSYQESAKVVALDHETLELVRKIAEFETLYNAAKTDLEAARQRIIYIDAE-------LER
                                   : :  *          : :.                     

A0A3N5J836      KGTMVEDISSASSPLIES------IQREIADKQTRIATLMA---------NSGPGTDVTV
A0A3N9NDM0      KQELLPSLGVPVSKITQQ------LKEELLDLERQ---YSRLQLQVGLDDQE------KL
A0A3A0DV40      EAISYVYKGIANHSLFDNNASMVVARQRLSDLESRRADELRSKTERHP----------DV
A0A3A0DR05      RG---DIAAISATSFLDE------LKKEMADLQQQRAAYLAYLAQNGRLDENNA----RL
A0A1W9SG22      NKKNINMENILNAPFLDQ------LSQQMAELETKRANYIAGLMDEGVYDPNGQDPM--L
A0A1F4RMF3      KQGNFDMESISSQPYLQE------LKKQIAEKESQLASYMASMAEIGAYDQIKN----EI
A0A3N9NPA0      QNTDFDIEAISKTTALEE------FTKRIAEKESKLAVYQAQTLQKGLSSDTKKHTLREI
A0A3N9PQN5      QNTDFDIETISKTTALEE------FTKKIAEKESMLAVYQAQTIQKGLSADTKKHTLREI
                                :.          : : :                          :

A0A3N5J836      AALEKEVEAIKSKLIEEVRKVASGGASAIDPMRTSQRLFDELLSTDVEIKALTARAEALR
A0A3N9NDM0      ASMREKINQTKQDLIDELMHNAAQE-NLVDPLSQIRNLLQEAITIDVDLETCKAQEQALK
A0A3A0DV40      IALENEITQLYAQIQSSGR---------------------------TKLSNLAQEISRQG
A0A3A0DR05      QELDGQIERLTQKFRAELASFTAAG--LGGPANLQDEMFMRKFEVEANIETLIPKVASLK
A0A1W9SG22      RRYEERTKMLEEKYKSEITQLAAAE--TIDPIALSEALLQRKLEVEATIQSLLPQVEALK
A0A1F4RMF3      QLRERQIDAVKEKFKQEVTKIAASG--FVDPSIVSTSLFSSKIEVETELKSLEPKVKALG
A0A3N9NPA0      ENLQNQITALKEQFQEDVKAVAANQ--FMDPAQVSSSLFTSKIAVETELRSLTPKVDAYG
A0A3N9PQN5      ENLQNQIDALKERFKEDVKAVAANQ--FMDPAQVSSSLFTSKIAVETEIRALTPKVEAFG
                                .                             . :           

A0A3N5J836      EVMQNMDYDLERLPQKTLVLARLTRDRELNEKLYLMLNEKYEESRITEAGKSAGVQIVDP
A0A3N9NDM0      NAVDEHDAELQMLPQQELELARLIRAKEVNDKIYGTLLEKREEARITESGKIGDIRVIDY
A0A3A0DV40      REVALLEGQLGSLPNVESTLLGLERQWKQKSDYLQSLQEQLQKGKIAVTSDKSDIEILDP
A0A3A0DR05      HIVDDYAKKLESLPEKKLLMVRLQRSAQVDEKIFLMMKEKYEELRITEVGQLGDVRIIEP
A0A1W9SG22      KIVAQYNLQLEKIPERGLKLARLKRAAMLDEKITLMMSEKYEETRITEVGQLGSVRIIDA
A0A1F4RMF3      EIVAQYSKDLESLPAKSLQLARLVRKAQVDEKIYIMLQEKFQESRITEVGQLGNVRMIDP
A0A3N9NPA0      KILTEYNAQLESLPAKKLELARLSRSAQVAEKLYILLQEKYQESRITEVGQLGNVRIVDA
A0A3N9PQN5      KILTEYNLQLESLPAKKLELARRTRSAQVAEKLYILLQEKYQESRITEVGQMGNVRIIDP
                  :     .*  :*     :    *     ..    : *: :: .*:  .. ..: ::: 

A0A3N5J836      AKPSVEPFRPKKKLNILLGMLFGLVIGVGIAFFLEFLDDTVKTGDDVE-RLGMTLLGTIP
A0A3N9NDM0      AELPIKPVKPQKKKIFVLALMLGLSLGVGLAFFLNSLDNSLKSEQDVEKCLNLPVLASIP
A0A3A0DV40      AIEPEYPVNRNKKAKAATGGVAGLLLGMFVVVALEALDRSIKSVDDIKGNLKLNVLGTIP
A0A3A0DR05      AELPETPLGPNRKLNIILGMILGLGLGVGLAFLLDMLDNSVRTMEDLE-RMGQPVLGSIP
A0A1W9SG22      AQPNIIPIRPQIKMNIILGIIVGLGLGIGISFLLDYFDNSVRSADEIE-KMGISLLGSIP
A0A1F4RMF3      AKEPKFPVKPKKKLNLILGILVGLGLGIGIAFVMEYMDNSLRTMEDIE-ILGQSIIATIP
A0A3N9NPA0      AKAPDKPILPKKKLNLLLGLLLGLGFGIAIAFAIEYIDDSVRSMEDLE-HLRLSMIATIP
A0A3N9PQN5      AKEDEEPISPKKKLNLFLGIIIGLGLGVAIAFVMDYVDDSVRTMEDLD-ALHLPLLATIP
                *     *.  : *     . : ** :*: : . :: .* ::.: :::.  :   ::.:**

A0A3N5J836      LVYTEQII-------------------KRLKKQGKQFTDADLHRVEAKMITRFSPKSPVS
A0A3N9NDM0      NISS-----------------------NGVLRKITKKEDAD-NLYSSKLLSQLLAKSYIF
A0A3A0DV40      QINFGEY--------------------------YEFQDQEKAKLIDQQLVTHDYAPTPVG
A0A3A0DR05      MIKEGETLARLKISKNGAPNGVHHGLSNGKVSAIE--NKLEQQPTAARLITHVAPKSPIS
A0A1W9SG22      VISLDEAVKKIG--------------KNGNNRFKKNINTNEVRTIAGRLITHFAPKSPIS
A0A1F4RMF3      FIKPEGS--------------------NGALSKFKQLEDAEAQDISERLVTHLRPKSPIS
A0A3N9NPA0      HIKPEQS--------------------NGLIAKMVKLDDPEVNAINERLVTHLKPKSPVS
A0A3N9PQN5      LIKPEQG--------------------NGLLAR-IKLEDPEVNAISERLVTHLRPKSPVS
                 :                                      . .    .:::.  . : : 

A0A3N5J836      EAYRSLRTNIQFADIDKPKRVLMVTSTMSKEGKSTSIVNLAITLTQMGSRVLLVDSDLRR
A0A3N9NDM0      EAYRSLQLNFSLLNPDKNLKTVVITSAAPGEGKTLTSLNIAQLYARAGIRTLVMDCDLRR
A0A3A0DV40      EAYRSLRTNILYSKSAGRIQTFVITSTAPGDGKSFTAANLSITMAQQKSNTLLIDTDLRR
A0A3A0DR05      EAYRALRTNIQYTHIDRTLRTLLVTSPGPGDGKSTSVANLAIVMAQMGSKVLLIDADLRR
A0A1W9SG22      EAYRSLRTSIQYSQADKTIKSIVFTSPGPKEGKSTTVVNLAIAIAQMGTNVLLVDTDLRR
A0A1F4RMF3      ESYRTLRTNIMFSNPDKEIKSIVITSSGPKEGKSTSISNLAITFSQMGTNTLLIDGDLRR
A0A3N9NPA0      EAYRTLRTNILFTAPDNPKHIIMLTSTGPREGKSTSVANLAITFAQMGTKTLLIDADLRR
A0A3N9PQN5      EAYRTLRTNILFAAPDKPKQIIMMTSTGPREGKSTSVANLAITIAQTGARTLLIDADLRR
                *:**:*. .:         . .:.**. . :**: :  *::   :.   ..*::* ****

A0A3N5J836      PSLHNFFSMDKTYGLTNVLIGSL----SFDEVVKHT-EVEKLDVITSGDIPPNPAELVAS
A0A3N9NDM0      PMVHKALKIRQEPGLTNALIDKAAHLESYVQLFNDESLHDNLAVLTCGALPPNPSEILGS
A0A3A0DV40      GVLHNTFAVPKEPGFSNYLTGSV----LASEIIHET-HIPNLSVISCGSLIPNPSEMLGS
A0A3A0DR05      PVLHTVFNLDRRVGLSNVLVGRA----DIAEAVSPT-DIENLHIMPCGALPPNPSELLGS
A0A1W9SG22      PVIHSIFNLNRNKGLSNCLVGKT----SIEEAISKT-DIDNLCVIPSGTLPPNPSELLGS
A0A1F4RMF3      PILHKLFNLDKKNGLTNVLVGRA----NLDEVVQRNPDLPNLDVLSCGILPPNPAELLGS
A0A3N9NPA0      PMLHKLFQKEKEPGLTNVLVGGT----VLESVIKTVNEVPNLFLLTCGVIPPNPAELLGS
A0A3N9PQN5      PMLHKLFQKEKEPGLTNVLVGRK----SLSDSVKAVEEVPNLHLLTCGVTPPNPAELLGS
                  :*. :   .  *::* * .         . .       :* ::..*   ***:*::.*

A0A3N5J836      EAMKKFIEEARARYDYVLLDSPPVVAVTDSAILATRVDGTLLVVSSGMVSKREVQRAAGL
A0A3N9NDM0      KRMGDLLAQLEDMYGLIIIDAPPIISVTDSIILGQKVDGVLLVLRSGKITREAAQKAKKI
A0A3A0DV40      VQLRRFLDEMRRRYDLIIFDTPPLNAATDAVVLGTQVDGAVIVVRSGKTNREVARKKIEM
A0A3A0DR05      SAMQRTLEALKQDYEVVLFDSPPVIAVTDAAVLARWVDGVFLVVKAGHTSKEAAFRSYAL
A0A1W9SG22      TKMKKFISELEERFDLVLFDSPPIMAVTDAAVLSSEVDGVVMVVKEGQTNRDAVMRCYNI
A0A1F4RMF3      QQMRRLLTEAKEKYGIILIDTPPTIAVTDSSVLAPLVDGVLLVVKSGGTQRDAFLRAQEQ
A0A3N9NPA0      TLMRNLLHRAREHYEIILIDSPPIIAVTDPSVLARIVDGVVMVIRIASTQRGAAQMAVEQ
A0A3N9PQN5      NLMRELLQFARGQYDTILIDTPPIIAVTDPSVLARIMDGVILVVRTASTQRGATLMAVEQ
                  :   :      :  :::*:**  :.**. :*.  :**..:*:  .   .         

A0A3N5J836      LKNVRSSVMGVVLNGLDIKKIYGSYYYYFHYYQYYYYYGSEHKSGKSRKKKSASADYQEV
A0A3N9NDM0      LENSKIHIAGTLLNDVDLKKVYG--YYKDY--YYYSNKKMAVES----------------
A0A3A0DV40      FQNVQAKILGVILNGTTVDLAHEGYSYYQY------------------------------
A0A3A0DR05      LNQVKAKVLGTLLNSVKVESMYGSYYYYYHY-HYYTQNSNGKLPKTQRKLLSWPWS----
A0A1W9SG22      LKSVPNQLLGAVMNGINVNGFSDYYYYYQY--HYYGKEDKKKKRIFRREKV---------
A0A1F4RMF3      LHRVGAHILGVILNSIQASNVYGSYYYYYYYHYYYGQDGEKKRSKSRRRKAHKKTHPSDQ
A0A3N9NPA0      LRRVEAPLIGVMLNGISASNFYGSFYYQQYY-YYYTKDGNKKRTKKRNRKPFKHLA----
A0A3N9PQN5      LRRVQAPLVGVVLNGISTGNFYGSLYYQQYY-YYYTTDGQKKRRKVKKQQQSV-------
                :      : *.::*.           *  :                              

A0A3N5J836      T------
A0A3N9NDM0      -------
A0A3A0DV40      -------
A0A3A0DR05      -------
A0A1W9SG22      -------
A0A1F4RMF3      TIREGDA
A0A3N9NPA0      -------
A0A3N9PQN5      -------
                       

© 1998-2019