BYKdb

Dataset for cluster orphancd of phylum candidate-division-ksb3

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G6E825      MAKRRSRRKHQNLDLIWEEGVHSMAAESYRTLRTNIALSQVDKPLRTLLVTSCIPREGKS
A0A2G6KDG7      MAKHRSRRKNQDIQLIWEEGAHSIAAEAYRTLRTNIALSQVDNPLRTLLVTSCIPREGKS
                ***.*****:*:::******.**:***:**************:*****************

A0A2G6E825      TTAANLGVTFALAQQKVLIIDADLRRPILHRLFGVPNSQGLTHALSDAVEFGQVYTPTRI
A0A2G6KDG7      TTVANLGVTFALAQQKVLIIDADLRRPILHRLFGIPNSQGLTHMLSDAVKYDQIFTPTKI
                **.*******************************:******** *****::.*::***.*

A0A2G6E825      ANLWVVTCGIIPPNPSELLGSQKMRLFLERAQKQFDLVLLDSPPISSLADASVLGSLVDG
A0A2G6KDG7      ANLWLVTCGIIPPNPSELLGSQKMRTFLERVQEQFDLVLLDSPPISSLADASVLGSIVDG
                ****:******************** ****.*:***********************:***

A0A2G6E825      VLFVIKANMASRDIIGRAKEQLETVGANIIGVVLNDVDIKRDGYYKYYYYYNYEYYGGQ
A0A2G6KDG7      VLFIVKANMASRDIIEKAKDQLETVGANIIGVVLNDVDIKRDGYYRYYYYYNYEYYGSK
                ***::********** .**:*************************.***********.:

© 1998-2019