BYKdb

Dataset for cluster tadcd of phylum candidate-division-ksb3

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2G6E7M8      MFQEEVHLKDYLRILKKRQWVIITFFVVVVVSVTISSFLQKPVYKATARVLIEKDTPNVL
A0A2G6K9T6      MLQEDIHLKDYIRIIKKRQWVILTFFIVIVVSVTITSFLSDSIYKSTSRILIEKDNPNVL
                *:**::*****:**:*******:***:*:******:***...:**:*:*:*****.****

A0A2G6E7M8      SFKEVLSLDGADIDYYRTQYTILKSRTLAKKVLEESGLLQQALQARPAGFSIRGMLSGAL
A0A2G6K9T6      SFKEVLALDSADTDYYQTQYTILKSRSLAKEVLEQLGLMGEALQGQSSGFSIRGMLSGTL
                ******:**.** ***.*********:***:***: **: :***...:**********:*

A0A2G6E7M8      SLLGIKEPLSEDAQLRIKEQQAIDHFLNQTIKIEPIKGSRLVDVSAFSTHPELAANIANT
A0A2G6K9T6      TLLGLRKPLTEEAKIRIKEQQAIDRFLDTTIDIEPIKGSRLVDVSAFSTDQELAMKIANA
                :***:.:**:*:*::*********.**: **.*****************  *** :***:

A0A2G6E7M8      LVSSYIKQNLEAKLLASQDAVGWLEHQLKDAEGKVADSEASLLAYKEEHGIISFEDRQNI
A0A2G6K9T6      VVDTYIKQSLGAKLSASQNAIGWLEAQLKDSQQKVAESEAALLAYKEEHGIISVEDRQNI
                :*.:****.* *** ***:*:**** ****:: ***:***:************.******

A0A2G6E7M8      VMQKLSELNTAVNNARIKRIAVEMQYKQIQDYLNSSGDAPAAKTLKDLESISQVINNPLI
A0A2G6K9T6      VMQKLSELNTAVSNARIKRIAVETQYRQIKGYLAQDGTDASSESIQSLESMSLVINNPLI
                ************.********** **.**:.** ..*  .::::::.***:* *******

A0A2G6E7M8      QKLKIELSALESQLSELRKKFRDKHPNVIAVKSQLTSIRERIHAEVKQIITSFRNDYELA
A0A2G6K9T6      QKLKVDLSSLESELSELLKKFRSKHPNVIAIRSQIQSVHKRIQAEIGQIIASIKNEYELA
                ****::**:***:**** ****.*******:.**: *:.:**:**: ***:*:.*:****

A0A2G6E7M8      QAQEQEMTAALEAQKREALELNQKAISYNVLEREAESNKRVYNALLQRSKETTVTEQLET
A0A2G6K9T6      LAQEQEMMVALELQKQEALDLNQKAITYGVLERDAESNKRVYNALLQRTKETTVTEQLET
                 ****** .*** **.***:******:*.****:**************:***********

A0A2G6E7M8      SNIRIVDPATIPNYPVAPRKKLNIFLAMVVGLTLGAALSFFFEYIDNSIKTPDDIKHYLN
A0A2G6K9T6      SNIRIIDRATIPNYPVAPRKKLNIFLAMTVGLMMGTAFAFFFEYIDNSIKTPDDIKQYLK
                *****:* ********************.*** :*:*::*****************:**:

A0A2G6E7M8      IPFLGFIPKVSY-NGHAPSHRREGHPADTVVALDPKSTVSEAYRSLRTNVMFSSLERGPV
A0A2G6K9T6      IPFLGFIPKVAYGSGGPPAHRTVHHPVDTVVAVDPKSTVSEAYRSLRTNVMFSSLERGPI
                **********:* .* .*:**   **.*****:**************************:

A0A2G6E7M8      MLVTSAGPAEGKSITVANLAITMAQSGSHTLIIDCDLRKPRIHHIFNIPGNHGGFTEMIA
A0A2G6K9T6      ILVTSAGPTEGKSITVANLAITMAQSGSRTLIIDCDLRKPRIHRIFNIPGNTGGFSDMIA
                :*******:*******************.**************.******* ***::***

A0A2G6E7M8      ALGETRRRVTVTRTKIPNLDIIPCGKIPPNPSELLSSERTKVLIDALGKKYDKILIDSPP
A0A2G6K9T6      TLGSNGARVTVKRTKIPNLDIIPCGKIPPNPSELLSSPRAKILIEALGKKYDKILVDSPP
                :**..  ****.************************* *:*:**:**********:****

A0A2G6E7M8      INVVTDPVILSQIVGGVILVIKAGETGRDLIRRARDQILNVNANLIGSVLNSVDMQKDSH
A0A2G6K9T6      VNVVTDPVILSQVAGGVIMIIRAGETGRDVVRRARDQLLDVNAKILGGVLNSVDMQKDHY
                :***********:.****::*.*******::******:*:***:::*.********** :

A0A2G6E7M8      YYYSYYHNYYYQDDDEQEEVSSNS-------------------------------
A0A2G6K9T6      YYYSYYHNYYYQEDEKSDNRNGSRSNGNRANGKFDYAGARAQTKKRFTRESGHRT
                ************:*::.:: ...                                

© 1998-2019