BYKdb

Dataset for cluster orphancd of phylum candidate-division-nc10

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F4PXF3      ------------------------------------MASPAEKKKSPTPGFPSILSDAGS
A0A1F4QJ00      MDPDVPENNSSALPAFLFDRILRARLPGEMSGNFQEQGPTDGSRRLAPPSVPGQAVEGPD
                                                     ...  ... ..*..*.   :. .

A0A1F4PXF3      AL--------------TEAFRGLRTNLLFSGVDEPHRRIL-VTSAIPREGKTTTVANLGI
A0A1F4QJ00      ALDDHLVSLLAPASFEAEQYRTLRYGLEQMAKAGQFTPIVGITSPTVGDGKTTTAINLAG
                **              :* :* ** .*   .    .  *: :**.   :*****. **. 

A0A1F4PXF3      TMALA-GSKTLLIDADLRRPGLHRYFQLSGKVGL---------TSVLGDQAELREAIQRT
A0A1F4QJ00      ALGQAPEARVLLVDADLRRPC------VGGQLGFGDSPAPGLADAILDPGVSLDDVVRGC
                ::. *  :..**:*******       :.*::*:          ::*.  ..* :.:.  

A0A1F4PXF3      KLAELSLLPCGPAVANPAELLGSRRMAELVNHLAAQYDLLVFDSSPVITVADALVLAGVS
A0A1F4QJ00      PPFNLSILPAGRPPAAPYEVLKSPRLGELLEAARQRYDYILVDTPPVVPVPDCRLLAKWV
                   :**:**.* . * * *:* * *:.**::    .** ::.*:.**:.*.*. :**   

A0A1F4PXF3      DGVILVVRSGGAPHEVVSRAKKQLESVKANIVGAVLNAFDAKGEGYYSPYYYRYGYGYGD
A0A1F4QJ00      DGFLVVVAAHKTPRPLVAEALTVLDPAKA--LGLVFNGDDRP----FAGYYHAYGYA-PD
                **.::** :  :*. :*: * . *:..**  :* *:*. *      :: **: ***.  *

A0A1F4PXF3      SNSDGQKAK---------------------
A0A1F4QJ00      ATRGGGRARAVRAVAAFLGRRRSTWQRGAP
                :. .* .*.                     

© 1998-2019