BYKdb

Dataset for cluster tadcd of phylum candidate-division-nc10

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2U1RKY9      ---MDALVKSEGKPP--TPRELLLQRYYLQQDEETHLRDYWRIILKHRWMVLTFFAIIVT
A0A2T4TV17      MDPDNALVKVKGGSGGLAKPQLWPVQAFPEQKKDPHLRDYWQVLLKHRWIVLTCFLVTVV
D5MIF0          MDPDNALVKAKDNSESLAKPQLWPVQAFPEQKKDPHLRDYWQVLHKHRWIVLTCFLVTVI
                    :**** :. .   :  :*   . : :*.::.******.:: ****:*** * : * 

A0A2U1RKY9      TATIYTFSLTPTYRATATLKIDYERPQILSFQEIGSPGHQNYGPEFMGTQQKLLQSRSLA
A0A2T4TV17      TVATATFVQRPVYKATATIKIDRAELKILKFDDV-SPSANKETDDYYQTQYKLLTSYSLA
D5MIF0          TVATATFVQQSVYKATATIQIDKAAPNVLKFEEV-SPAANKETDDYYQTQYKLLMSYSLA
                *.:  **   ..*.****::**    ::*.*::: **. ::   ::  ** *** * ***

A0A2U1RKY9      KRVIETLTANGHSIALDPGPTDSGELAGVWLAWITDMLSGSRTSKSLPTADPVSQPEPPV
A0A2T4TV17      ERVVKRFNLDANPEFLGSGMQGPASPTWTWLTNLVDLIRPQPSTQQ--ASGEASITESPV
D5MIF0          ERVVRLLRLDVNPEFTGTDAPGSASPTWTRFTNLVNLVRPRSSMQA--ASGETSTTESPI
                :**:  :  : :.   ...  .... : ..::.:.:::    : :   ::. .* .*.*:

A0A2U1RKY9      GPTEEQVMVRKIDVLLRMLTIEPVRTTNLVKISFTTPSPALSSLLANAWAKGFIDHSLDL
A0A2T4TV17      -----------VQSFLKKLEIEPVKNTRLVKIAFLSPSPELSAQIANAMAENFIEQSIEQ
D5MIF0          -----------VQSFLKKLEIEPVKNTRLVKIAFLSTSPELSAQVANAMAENFIEQSIEQ
                           :: :*. * ****..*.****:* :.** **: :*** *:.**::*:: 

A0A2U1RKY9      KYNATAQAGEWLSKQLQDVQDKLEQSEAALHEFVKQKQILTVGEKKDIVTTKLADLSEAL
A0A2T4TV17      RLGAMKYAGDFLAKQIQEVRIKLESSDELLQRFAKQKQYLVLDEKQEQTTKQLSLLTDAL
D5MIF0          KVGATKYAGDFLAKQIQDVRIKLESSDELLQKFARQKQYLVLDEKQEQTTKQLSLLTDAL
                . .*   **::*:**:*:*. ***.*:  *: *..*** *.:.**:: .*.:*: *::**

A0A2U1RKY9      TKAQGERIAKEALYRQSQKLRFDSIPAVLENSMISNLKTEYYKLDSEYRRLGETYKPGYP
A0A2T4TV17      MKARSERLAKEALHRQTQGQDFQSIPSVLENPLISSLKTEYFRLQAEYRKLSETFLSDYP
D5MIF0          MKARSDRLAKEALHRQTQGQDFQSIPSVLENALIVDLKKEYFRLQAEYRKLSETFLPDYP
                 **..:*:*****:**:*   *:***:****.:* .**.**:.*::***.*.**: ..**

A0A2U1RKY9      KMVRLRESMDQIKRQIEVEIARIVDAIKQEYEAAVKKEQLLQAAVNEQKHLAIGLNQELI
A0A2T4TV17      RMVALKSNIDEVKIKLDGEVQRVVDGLRSSYEAGLKSEHLLQSAVDKQKTVTLKTNEDSI
D5MIF0          RMVALKSNIEEVKSRLDGEVQKIIDGLRSSYEAAVKSEHLLQSSVDKQKQVTLKTNEDSI
                .** *...::::* .:: *: .::*.:...***.:*.*:***::*::** :::  *:: *

A0A2U1RKY9      RYDILKRDVDTNRQIYSGILERQKQAGVSQGLAASNVQIVDTAEAPTTPFSPNKTRNIVL
A0A2T4TV17      QYNILKREVDINRELYSGLLQRMKETAVSAGLDSTNIMITDLAKIPLWPDRPKKLLNLTL
D5MIF0          QYNILKREVDINRELYAGLLQRMKETAVSAGLDSTNIQIADRAKVPLFPDRPKKLLNLAL
                .*:****:** **::*:*:*:* *::.** ** ::*: *.* *: *  *  *:*  *:.*

A0A2U1RKY9      GIVLGLTVAVGMAFFFDYLDNTVKQPDALERTLGIPSLALIPSLASALPKQRRGRLSRNG
A0A2T4TV17      GIVLGLGLGIGLAFFSDYLDNTVNKIEEVESTFALPILGAVPALASV---ERRRRL--KG
D5MIF0          GIVLGLSLGIGLAFFADYLDNTVNKIEEVESTFALPILGAVPALASA---ERRKRL--KG
                ****** :.:*:*** *******:: : :* *:.:* *. :*:***.   :** **  :*

A0A2U1RKY9      NNGNHNGAPAFATVAHSDLRSALAEAFRTLRTSLLFSSPGSPPKSILFTSAQPSEGKTGL
A0A2T4TV17      TTNNGQDAKSFELVMLQDQSSLVGEAIRNIRTSLLFSLPENPPKLLLVTSAEPGDGKTGV
D5MIF0          AT-NGQGAKSFELMMHQDQSSLVSEAIRNIRTSLLFSLPDNPPKLLLVTSAEPGDGKTGV
                 . * :.* :*  :  .*  * :.**:*.:******* * .*** :*.***:*.:****:

A0A2U1RKY9      SINTAITLAQLGGGVLLIDGDMRRPSCHSHLEIPLKAGLSDYLTGNADLVSVIKRTTVSN
A0A2T4TV17      SINLSVALSQLGGDVLLIDADMRYPDCHRILGQDRTPGLSNFLVGDAELSAVIKPTATSN
D5MIF0          SINLSVALSQLGSDILLIDADMRYPDCHRLLEQDRTPGLSNFLVGDAELSAAIKPTTIPN
                *** :::*:***..:****.*** *.**  *    ..***::*.*:*:* :.** *: .*

A0A2U1RKY9      LYCIPAGTIPVNPAELLASPRMRETIDLLSQRFDYIVVDSPPIFSVADALILSTVVKGVI
A0A2T4TV17      LSLLPAGQSPLNPAELLGSERMRDALELLCQQFKYVIIDAPPVLGFTDSVLLSTFAEGTV
D5MIF0          LYLLPAGQSPLNPAELLGSERMRDALELLCRQFKHVIIDSPPILGFTDSVLLSTFADGTL
                *  :***  *:******.* ***::::**...*.::::*:**::..:*:::***...*.:

A0A2U1RKY9      LVVHGGRTPRDMIQRSFKNLIELNAPVLGAVLNNIDIRGNGYPYYYRYHYSHYYQYAAPD
A0A2T4TV17      FVIRAGKTVRDAAQRAVRTLNAVNAKILGVVLNNIDLHSHGYSYYQDYH-DYYHRKSERH
D5MIF0          LVIRAGKTVRDAALRAVRTLNAVNAKLLGVVLNSLELHGNGYSYYQDYH-DYYHRKSERR
                :*:..*.* **   *:...*  :** :**.***.:::..:**.**  ** .:*:. :   

A0A2U1RKY9      TVPDPASTVQAHAPVESQPTNAGNGDRPV----------
A0A2T4TV17      GIVARGHHDRSNTPGAPHAHEHESPDSPADIPSPLAGEG
D5MIF0          DSVMSHRDSH-----------------------------
                         .                             

© 1998-2019