BYKdb

Dataset for cluster orphancd of phylum candidate-division-ta06

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S7WF31      -MKSVLQRYEVESPEATEFRRLFSRLRRTGEPEPVKSILITSAVRGEGKSTTAAYLAITA
A0A0S7WGH6      MGLSVLKQYEIESPVATEFRRLYSRLRRAGEGSSLKSVLVTSSVRGEGKSTTAAYLAITV
                   ***:.**:*** *******:*****:** ..:**:*:**:****************.

A0A0S7WF31      ARYRKTKTLLVDGDLRKPKVHTLFQLRNQPGLSDVLSGASSLKACFKSTSLEELKILTAG
A0A0S7WGH6      ARYRNTRTLLVDGDLRKPKLHELFQLRIRPGLSEVLAGVASLKSCFQSTSLESLKILAAG
                ****:*.************:* ***** .****:**:*.:***:**:*****.****:**

A0A0S7WF31      KARLSPSESFDSDRMKDVFEEMRFYFDVIIVDAAPVIAVSDPIILGSEVGGVLLVVMAGK
A0A0S7WGH6      SASLFPSESFDSDRMKGVFEEVKFYFDVIIVDGAPVIAVSDPIILGSEVDGVLFVIMAGK
                .* * ***********.****:.*********.****************.***:*:****

A0A0S7WF31      TPREVVKRAKNILADSSVNILGVVLNNADEVLPYYYDYRYYGYPGTDEK
A0A0S7WGH6      TPREVVKRAKDLLSDSNVNVVGAVLNNVDEVLPYYYDYRYYGYAYRGTG
                **********::*:**.**::*.****.***************.  .  

© 1998-2019