BYKdb

Dataset for cluster tadcd of phylum candidate-division-ta06

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A101I342      MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKPTYQSTALILIETS
A0A117M5Y1      MLEDLQDQEKLSLNDYLAIVSKYKFLILIVALLIFSLSVLFTFLEKPKYTAKTVLMFERV
                * * : ::*  .*: *: :: : *:*:* . :::::* .:.* : **.* :.:::::*  

A0A101I342      DKGLSFLPITDMNPRKTVINNHIEMIQSRTLFERVENAISNSGYMDSLFIGKYKEKEGRI
A0A117M5Y1      NTGSTFFPVTDPLGMEALLNNQTQILKSRSLMERVNLSLKEDTILK-------QKGYKKV
                :.* :*:*:**    ::::**: ::::**:*:***: ::.:.  :.       ::   .:

A0A101I342      SYLRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKIIVDQYYNINLEMTRGELSEVRKFL
A0A117M5Y1      SASRQNLSINKIKDTYIIEVVYKSIDPFLAAYITNKIAREYYKMNLDAMRMTVSQVRIFL
                *  *:** :  :*** *:::**:.  *  * ***: *. :**::**:  *  :*:** **

A0A101I342      EEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKLVEMISNFEGQKKQYFVEREMLLS
A0A117M5Y1      EEQLKKIEKELNSSELLLRDYKKSNKISSLEDETRVLIDQVSQFETDYKGIMLNIDTYTK
                **** ***.:*:..*  *..:*:.*.* .*.:**  *:: :*:** : *  ::: :   .

A0A101I342      KLTYLKENLSQSNKMIAEGFLNELDPFLERSKRELDSLQSNYAYFLSIGYDTTHPKMKEI
A0A117M5Y1      QKEYLLKELDQTQKEMIENISSYRTDVMENIFAEISKLETDKAYFISQGYSNDHPKILQI
                :  ** ::*.*::* : *.: .    .:*.   *:..*::: ***:* **.. ***: :*

A0A101I342      KTRVENLKNNIIQNSKTSFQKKYFASNPLDYSKNLMDEIITVQLDVKVKESMIEAFNNVL
A0A117M5Y1      NSKIESLKKQLKDETEKSLKENRVQQNPLKYSGEIIQQIAEINNNVSLLQAKAEGLKKVI
                ::.:*.**::: ::::.*:::: . .***.** :::::*  :: :*.: ::  *.:::*:

A0A101I342      KIFEEKMKKIPFQELMLARLERNKKVSEELYLMLKGKFEEAKVAEAGKLGSVKIIDKPVL
A0A117M5Y1      DVYNSKLENVPDKSIQLVRLERNAKVNEDIYLMLKRRYEEAKLQEVAEVGNLSIIDTAVV
                .:::.*::::* :.: *.***** **.*::***** .:****: *..::*.:.***..*:

A0A101I342      NKSPVLPKKNRNYLFGFFLALILGVGIVFLKEYIDDSVKDIDEIERELKINIIGNIPSI-
A0A117M5Y1      SKIPVSPKKEKNFLLGIILGIFFGVTLAFILFFLDESIRTAEEVEHYTGEQILGIITYIG
                .* ** ***:.*:*:*::*.:::** :.*:  ::*:*:.  :*:*.    :*:* *. * 

A0A101I342      ------KIKNGKQVSAE------KGKLLTELPENSPIVESYKILRTNLLYHSDGKEPPKV
A0A117M5Y1      GNGKKDKVKGEKKVTEDEIVEKIRKKLIINMEPHAPIAEAYRSIRTQIKYRSKEGE-KLV
                      *:*. *:*: :      . **: ::  ::**.*:*. :**:: *.*.  *   *

A0A101I342      VVVTSATKGEGKSTTASNLGIVMAQLDKKVLLIDGDLRRPVLDKMFKINFDKGFTNLLKG
A0A117M5Y1      YVFTSSIPGEGKSTTISNLCITMANLGKKVILIDADMRKPVIHKIFNVKNGIGLAHYINR
                 *.**:  ******* *** *.**:*.***:***.*:*.**: *:*::: . *::: :: 

A0A101I342      EISVEDVIYSSGIDNLWIIPFGERTSHSTELLEGRITKKIFEQLRNMFDFIVIDTSPVLS
A0A117M5Y1      KATYEEIKRDTEVENLKVITYGTRPVNPSELLENPKMKELLEICKNEFDYVFLDAPPVNV
                : : *::  .: ::**.:*.:* *. :.:****.   *:::*  .* **::.:*:.**  

A0A101I342      VADPTIISRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPVIGFVFNNINTESFYGKYY
A0A117M5Y1      VTDPIVLANYADKLLWVVSPGKVKRKDLRHARKLLVPVKRKILGVILNSSKTEF----SS
                *:** :::. :* *****.  *.*..:*.::.***  ::  ::*.::*. :**       

A0A101I342      YYHYYYHYHTKEGER
A0A117M5Y1      YYSVYYKKYYGEGEL
                **  **: :  *** 

© 1998-2019