BYKdb

Dataset for cluster tadcd of phylum candidate-division-wor-3

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S8GJS7      ------MKQQYTLTDYINIMREHIRPIAVCTAAAAVVALLMSFILPKTYEAEVTFKLDLS
A0A1F4UBB9      ------MKSEPTLQDYIGVIIERRWLVISCVIGVTFCALVISLFLPKIYEARVRFKLDLS
A0A1V4QH99      ------MKSEPTLQDYFNIIMERRRLIIICVAVTTVVALIASFVLPKVYEARVKFKLDLS
A0A235BXH5      -----MEEEQVSFEDYLRIIYERKWIIIVAFFAVVISTAVFTYRQEPVYEATCTIMVESR
A0A348MM93      MPERVVEDEGKELKTYFFLLLENKILFLTTFFIVIALVFIVTKVTKPTYQSTALILIETS
                       ..   :  *: :: *.   .      .   . : :      *::   : ::  

A0A0S8GJS7      ESKPLFYSPIYSQKQIDPVESQLEIIQSRTLAQTVVKELGLNFVVKDSYRTYFDSVFVAD
A0A1F4UBB9      ESKPMFFSEIYTPQRVDVVESQLEIIRSRTLARTVVQDLGLNFVVNNHKIYFLDSIRVAN
A0A1V4QH99      ESKPMFFSEIYTPQTVDPVESQLEIVRSRTIAKSVIKKLGLNFIPANENYSYFDSISVSE
A0A235BXH5      KRQRDIFEL--VYPRWVNILNYSEILKSVAIAKSTIEKIA--------GSDL--------
A0A348MM93      DKGLSFLPITDMNPRKTVINNHIEMIQSRTLFERVENAIS--------NSGYMDSLFIG-
                .    :            : .  *::.* ::   . : :.                    

A0A0S8GJS7      DCPPGTYYVRFHNSEFTIVGSRGEVIGTGTVGEHYDSGALRFRINEKRADNMKLTIMTLN
A0A1F4UBB9      DFPPGKYSVRFRSENFGIYDKGDREIGTGKVGDLFDNGKLRFLIRERPNEDMRITIKNIN
A0A1V4QH99      KFPPGKYYLKFNDNNFVFLDKDGNEIGQGQVGRLFKKGSIQFRVKTKPKDILEVKIMDME
A0A235BXH5      ------------------------------------------------------PISKTG
A0A348MM93      ------------------------------------------------------KYKEKE
                                                                            

A0A0S8GJS7      KRARELQKQVRVDQIRNSQLVRLKARSRNPQVAAAIANTLANEYINYSLRTVREVARGSK
A0A1F4UBB9      KSAEELQDIVNASQIKNTVLVMLKAKSNSPELAAKIANTLAYEYINYSLSSIREAARSSK
A0A1V4QH99      KRVDKLLSNISANQIKNTALVLLKARSRNPYLAALIANTLAREYINYCLQVVRESARGSK
A0A235BXH5      NPVGVLRGGLSVTRVRDTDILEISVKGKTPQEASVLANTIAEVLIESELATGRKEYTEQR
A0A348MM93      GRISYLRKNLMVIPVKDTDILKIVYNDRTPEDAFYITKIIVDQYYNINLEMTRGELSEVR
                     *   : .  :.:: :: :  ....*  *  ::: :.    :  *   *      .

A0A0S8GJS7      EFIESQILIFGEELNHAEEDLRQYKEKAGIFLLNASAHEIISSLAQFETERERAIVALHE
A0A1F4UBB9      EFIESQISIFGEELNNAEEDLRHFKEKTGIFLLSETATEIISSLAEFEVSREQAVVELNE
A0A1V4QH99      EFIESQIRIFGDELNRAEEELRKYKEKSGIFLLQESAKEIIKSLADFETQKEKALVELHE
A0A235BXH5      HFLEEQIPKVKERLEIIENNLKKFKEETGLIALSEETGQLTEKLFEFDRLRGQTESELEF
A0A348MM93      KFLEEQLVKIESDLQKNEENLKKFKENNSIIELSEETSKLVEMISNFEGQKKQYFVEREM
                 *:*.*:  . . *:  *::*.::**: .:: *.  : :: . : :*:  . .       

A0A0S8GJS7      SESAIENLEAELSRDAASYGAYKQMASFPTLSSSPIIVSLKDKLQTLELQKQEMAQTDVG
A0A1F4UBB9      MESSIVNLEDELSKDEATFGVYKKMASFPTISNSPIITNLKDKLKSLELKKQELVQINAK
A0A1V4QH99      VESSIKNLETELSKDEAAYGAYKRMASFPTLSRSPIILSLKKKLKSLQLQKQELLSRGEK
A0A235BXH5      QKTKLVSLEASLEETQ------RTLVEKISQVSSPYILELRRRLVELETTHSMYLVQGLP
A0A348MM93      LLSKLTYLKENLSQSN------KMIAEGFLNELDPFLERSKRELDSLQSNYAYFLSIGYD
                  : :  *: .*.         . :..      .* :   .  *  *:         .  

A0A0S8GJS7      SN--DVPRIEAQIQKTEEELQKATRQIVLAGPSIDDPV--FRSIITQIIDQETRAISLQS
A0A1F4UBB9      AG--EIAEIDRKIQAAEIELKKATEQIVLSGPSIKDPI--YQSLISQIINNGTKAIALQS
A0A1V4QH99      GE--KLIRVEADIQATEQELSKATHQIALAGPSINDPI--FQSIISNIINKETKKIALQS
A0A235BXH5      ENNPKLVSLRKSIDETKAKLIEETNKIKDKELPTLDPLSFSQKLVDEIISLRTEITAGET
A0A348MM93      TTHPKMKEIKTRVENLKNNIIQNSKTSFQKKYFASNPLDYSKNLMDEIITVQLDVKVKES
                    .:  :   ::  : :: : :           :*:   ..:: :**         ::

A0A0S8GJS7      RIAALNQIIGRQNARLKQLPEAEVELAQLERQKMANENIYTMLLGKLEESKIAEAMQISE
A0A1F4UBB9      RIDALNQIISRQNRRLKQLPEAEVNLAQLERQKMANEEIYTMLLGKLEESKIAEAMQISE
A0A1V4QH99      SIDALNQIISRQNRRLKQLPEAEVNLAQLERKKLANEEIYTMLMGKLEESKIAEAMQISE
A0A235BXH5      RLNVIKNILKEYERRLQRVPGQELRLVGLEREREINASTYELLVQRYEEVKIAEAGKTSN
A0A348MM93      MIEAFNNVLKIFEEKMKKIPFQELMLARLERNKKVSEELYLMLKGKFEEAKVAEAGKLGS
                 : .:::::   : .::.:*  *: *. ***:.  . . * :*  . ** *:*** : ..

A0A0S8GJS7      ARIIDVANVPERPTHPRPVLNAVLGVLLGLMIGVGGVILKERLDTSVKTAKELEELTGSS
A0A1F4UBB9      ARIIDEAIVPDEPYSPKPKQNTILGFILGLFIGVGAAFLLEYLDTSLKTSKEIEELTGLS
A0A1V4QH99      ARIIDSATPPKNPMAPKKKQNTILGFFLGLIIGIGGAFLLEYFDTSLKSTKEVEELTGLS
A0A235BXH5      VRVIDPARPPGRPISPKKRMNLTLAVVIGLIVGVGGAFVVDYMDNSIKTSKDIERYTGLS
A0A348MM93      VKIIDKPVLNKSPVLPKKNRNYLFGFFLALILGVGIVFLKEYIDDSVKDIDEIERELKIN
                ..:** .     *  *.   *  :...:.*::*:* .:: : :* *:*  .::*     .

A0A0S8GJS7      VLASIPLMKGKERALIA-------TVEEPHSEIAEAYRILRTNIAF-ATTARPIQTLLVT
A0A1F4UBB9      VLAAIPLVKNKERTHIP-------TIDEPHSQIAEAYRILRTNIGF-AATAKPIKTLLVT
A0A1V4QH99      VLATIPLVKNRNQ-HIP-------TIHEPYSQIAEAYRILRTNLAF-TAATKPLKSLLIT
A0A235BXH5      ILGSVPIVKKKNDTPLL-----LLKGFPSRSALHEAYRGIRTSLQF-INPDNPIRTFLVT
A0A348MM93      IIGNIPSIKIKNGKQVSAEKGKLLTELPENSPIVESYKILRTNLLYHSDGKEPPKVVVVT
                ::. :* :* .:   :        .     * : *:*. :**.: :      * . .::*

A0A0S8GJS7      STIPQEGKTTTCINLAITLSQQGHKVIVVDCDFRRPMLHNYFAQYVTDNRHGLSDVLIGR
A0A1F4UBB9      STMPQEGKTTTCLNLGTTLAQQGHKTIVIDCDFRRPMLHRYFSAFIKDNTHGLSDVLVEH
A0A1V4QH99      STLPQEGKTTTCINLGITFAQQGHKVILLDCDFRRPMLHTYFGELAKDNHHGLSDVLIRK
A0A235BXH5      SPLPREGKTTIALNLAVVLSQLGLKTMVLDADMRKPAVHKFLG---IE-GKSLAEFLAHG
A0A348MM93      SATKGEGKSTTASNLGIVMAQLDKKVLLIDGDLRRPVLDKMFK---INFDKGFTNLLKGE
                *.   ***:* . **. .::* . *.:::* *:*.* :   :     :  :.:::.*   

A0A0S8GJS7      LKLESAIVRNSVHNLSFITSGTIPSNPAELLGSEKMVQMIEKLKASFEFVIIDAPPTLGV
A0A1F4UBB9      LQLKEAIVKSTTPNLFFITSGTIPSNPAELLGSQKMQQVLNTLKETFEFILVDAPPALGV
A0A1V4QH99      LKLNEAIRKGTLGNLFFVTSGTIPSNPSELLGSPRMREVLQELKKQYEFILIDAPPSLGV
A0A235BXH5      GDIESFILPTEIENVSVIISKETPPNPAELLSSNKMKKLLLDLKERFDVIIIDTPPVLSC
A0A348MM93      ISVEDVIYSSGIDNLWIIPFGERTSHSTELLEGRITKKIFEQLRNMFDFIVIDTSPVLSV
                 .::. *      *: .:     ..:.:*** .    :::  *.  ::.:::*:.* *. 

A0A0S8GJS7      ADARVLGRICDAVLVVVKAQMTNREAVIDVKNEIERSGEKVIGFVLNGIDI-----TSSY
A0A1F4UBB9      ADARVLGKIVDAIAVVVMAKKSSRDAVLEIKEELERSGEKIIGFVLNGIDL-----SRHY
A0A1V4QH99      ADARVLGKICDGIIVVVMARRTSRDAVIEIKEELERAGDKIVGFVLNGVDF-----EGHY
A0A235BXH5      TDATVLAPLTDGVLIAVQSHKTNRNALGRVRDVMESVRAKLIGVVLNAVPSGRGGYGYYH
A0A348MM93      ADPTIISRLSDGLLWVVQFKKAKKRELHYTKKLLKNLNIPVIGFVFNNINT-ESFYGKYY
                :*. ::. : *.:  .*  . :..  :   .. ::     ::*.*:* :          :

A0A0S8GJS7      YRRRYHYYRSA-----
A0A1F4UBB9      YRNRYYYYYHTTAE--
A0A1V4QH99      YRHRYYYYHYPSVKK-
A0A235BXH5      YYHYYHYYPEEEGKGN
A0A348MM93      YYHYYYHYHTKEGER-
                * . *::*        

© 1998-2019