BYKdb

Dataset for cluster orphancd of phylum candidatus-aminicenantes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3D4NYA6      ------------------------------------------------------------
A0A3D4P3H6      DNTVKTSEDVEKYAHLPALGIVPTFTVDGYRKGYGYGYGQRGHAKGIILKTTDGIHQTED
                                                                            

A0A3D4NYA6      --------------MVEPKVKSIELIAHLSPKSNLAESYRTIRTSLLLSSADKKPKSIVV
A0A3D4P3H6      KGGAGAEARESGAKNQGTQVKSIELISHRWPKSDYAESYRSIRTSLLLSTADPNLKVIVV
                                 .:*******:*  ***: *****:********:** : * ***

A0A3D4NYA6      TSALPEEGKSATLCNLAVTLAQAGKTVLIVDSDFRRPTQHKIFKIRNINGLTNYLTSEME
A0A3D4P3H6      TSALASEGKTATVSNLAVVLAQAGKHVLILDADLRKPRQHRIFGIRNLNGLTNYLTANLE
                ****..***:**:.****.****** ***:*:*:*.* **.** ***:********:::*

A0A3D4NYA6      LKALVKETGIPKLYLINVGPVPPNPAELLGSEKMGNLIESLKQWFDFILFDSPPVLTVSD
A0A3D4P3H6      LKALFKQTEIPLLYLINAGPVPPNPAELLGSDKMAGLIEYLKPHFHYILIDTPPMLAVSD
                ****.*:* ** *****.*************:**..*** ** .* :**:*:**:*:***

A0A3D4NYA6      AMVLGPKIDGIILVVWGGKTAKDALKQAKERLDMLKVKCLGVVINNLNIQEHDYYHMHHH
A0A3D4P3H6      ALVLGPKLDGVVLIVQGEKTSREAMKRAKEKLDLLKIKSLGVVINNLNLQRHDYYYKRYY
                *:*****:**::*:*.* **:.:*:*.***.**:**:*.*********:* ****: .::

A0A3D4NYA6      YHYYGEGKGGEKTT
A0A3D4P3H6      YHYYGEE-------
                ******        

© 1998-2019