BYKdb

Dataset for cluster tadcd of phylum candidatus-aminicenantes

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F5AEV3      -----MATEFPKEPQTGLLAQAQHYWHVILKWKWTAVLFFMLAVAVATIYSLLLTPVFTA
A0A1W9P661      ----------MRDNKGKKEIDLFDIWRVALKRKWIIITIVILFIVGAGIYSFTRTPIYQA
A0A3E2BKD4      MDRTTPTTAGPRQTQQNLLEQILYYWNAMLRWKWTGLTVAILIVALTLVYVFISPHIYSA
A0A2N7QEB5      ----MNDNNIEPQADEIGEIDLKKYLDILLRRRWTIISVTVIAVVISLLISLVTRPMYTA
A0A3E2BQJ8      ---MSNENYVEPQALDAGEIDLRKYIDIIFRRRWTVISITLIAAALSLIISFVTRPVYKA
                            :       :        :...*  : . ::  . : :  :    :: *

A0A1F5AEV3      SGSVWIEDD-PNILPFEDVQSFGA-------GSNLQSHARLLRSRTLASDTIDKLKLYEN
A0A1W9P661      TATILIEEPGSSMFNIEEMFNYTPYYRYDFLGVYFNTQLSLLTSRTLAERVARRMNLSER
A0A3E2BKD4      KGTIWIDET-QSVLPFEELSRLSG-------GINSQSHALLLKSRSLASDVIEKMKLHEH
A0A2N7QEB5      HGTVMIEKE-PNILSFEDIFQIET-----FRDDYFQTQYKLLQSRSLAERTIDKLKLWEK
A0A3E2BQJ8      RGTVMIEKE-PNILSFEDIFQIET-----FRDDYFQTQYKLLQSRSLAERTIERLKLWEK
                 .:: *:.   .:: :*::            .   :::  ** **:**. .  .::* *.

A0A1F5AEV3      SD-----------FAG---KPEKGQARPDPADPIYREVLTQIFL--------------SN
A0A1W9P661      MELNTQSSSSPASFLG-QIKSFFSISRWFNRTKEVTQPALQEFVPPADLSANYAFVVLSG
A0A3E2BKD4      PE-----------FMGPKLPVRLAKERIQPDNPVFKEKLIDEFI--------------AS
A0A2N7QEB5      TD-----------FSGNRPLTSEEL-----KDPRIKQKMIDRFL--------------SR
A0A3E2BQJ8      KE-----------FSGSKSPTADDL-----KNPVFRQKMVDKFL--------------GR
                 :           * *                    :   : *:              . 

A0A1F5AEV3      IGVSTAERSRLVDVRFSNRNPKLAADILNALFDGYIEMMVRKRYAASEQATAFLNTQIAE
A0A1W9P661      LKIQPVEETRLVNINFRSPFPVLAADIVNNLIEEFIDYSVEMRYEATRQASEFLNKQIAQ
A0A3E2BKD4      LNVSPISGTKLIEVSFDHKNPRLAAEVLNTLLDSYIEMLIKRKYTASEQATEFLSTQITA
A0A2N7QEB5      LEVKPVRMTRLVEVTFSAHDPALASECVNTLFDSFVDMNIETKSEATEQATEFLSQQIND
A0A3E2BQJ8      LEVKPIRMTRLVEVAFKAHDPTLASDCVNALFDSFVDMNIEAKYETTEQATEFLSEQIEE
                : :..   :.*::: *    * **:: :* *:: :::  :  .  :: **: **. **  

A0A1F5AEV3      IRTDIDKKERELNKYGSEKDILPLTTAEAPTVARIGEVNRALTDATLDRVNKFNAYNQLN
A0A1W9P661      LRNELAAKEKELQKYGEEKKLLFLNEKESSVVSKYADLNTAFTEAQIERINKEAAFRELS
A0A3E2BKD4      LRKDIEEAEKKLAELGTAQGILPLSSAEAPLISKITEVNTALTAATLDRVNKYTTYNQLK
A0A2N7QEB5      LKKEISQKEQELQNYGQEKNIVILSDKETTILDKLNEVNKALTEAQIDRVRKEAYYNEIK
A0A3E2BQJ8      LKKEISQKEQELQNYGQEKDIVILSDKETTMLDKISELNKALTEAQIDRVRKESYYNGIK
                :..::   *.:* : *  : :: *.  *:. : .  ::* *:* * ::*:.*   :. :.

A0A1F5AEV3      AAPLGEIPDAPPGSLIQRLREQYINLSLDYRTRLATVRPEFPAMQRLKSELDAATEALQN
A0A1W9P661      SLQIDALSPNIDNPVIQSLKAEYTRLKNEYDEKIKIFKPEYPDMVRLKARLDSLRTELEK
A0A3E2BKD4      ALRPEELPESPANPAIARLREQYALLSREYARRLATLKPEYPEMQKLKSEIEATYESLAN
A0A2N7QEB5      NASPDFIPEALSNPLIQRLREDYLKLSREYAKMQEQFQPEYPEMQRLKAELDTARDLLKN
A0A3E2BQJ8      NASPDFIPEAMNNPLIQRLREDYLKLSREYAKMQEKFQPEYPEMQRLKAELDSARELLKN
                      :.    .. *  *. :*  *. :*      ..**:* * .**: :::    * :

A0A1F5AEV3      ETQNLIRNAYNDYQNALDKEQSYQKLLNDQKNMAYKASSNSVVYNSMRIELENRKALLEA
A0A1W9P661      EISQAVDAARTEYRAALAKENSLKNLLEKQREDVVRTNNNAILYNSLKIDVENKRNLLNS
A0A3E2BKD4      EKENLIKTAYADYQGALAKEQNLQRLLDDLKAQAYKANSTAILYNSLKIETDNKKALLEA
A0A2N7QEB5      ETENLVKAAYSEYQAALKKENSLRDLFERQKEEAFRMNSNAILYNSLKIEIENRKNLLES
A0A3E2BQJ8      ETQRLIKAAYADYQAALKKEVSLKELFEQQKEEAFRLNSSAILYNSLKIELENKKNLLES
                * .. :  *  :*. ** ** . . *::  .  . . ...:::***:.*: :*.. **::

A0A1F5AEV3      LSRRQSETDVSSRLKGLEALNVWIVDKADYPLRPAFPNKRKNVLMGFLFGLAGGIGLALG
A0A1W9P661      LIAKQNEALVSARLKGLKTSNIKIVDRALVPQSPVYPNPSRTVMLAFLLSLFVGVGVAFI
A0A3E2BKD4      LSKRQSETDLASRLKDLQALNVWIVDKASVPVNPSFPNRRKTFLIGVLLALIGGAGTSLF
A0A2N7QEB5      LLKRQSETGVSARLKGLRTSNIRVVDRADIPIRPSSPKKFRNLLLALFLGLFGGVGLALG
A0A3E2BQJ8      LLKRQSETGVSARLKGLRTSNIRIVDRADLPLRPDSPRKFRNLLLALFLGLFGGLGLALV
                *  .*.*: :::***.* : *:.:**.*  *  *  *.  ...::..::.*  * * :: 

A0A1F5AEV3      LEYLNHTVKTSKDITHSIGVPTLGAIPAFEAEAKPKGPKAEFAR---LISMLRGKGERKE
A0A1W9P661      LEYLDNTIKSPEDVEQLVDLPSLGLIP--------------------LVSASNGVKKASY
A0A3E2BKD4      INYLVATVKSSRDISQATGWATIGTIPAFEKEYKPKGPRAEFRTLSSLLKGKPGILDKKK
A0A2N7QEB5      MEYLDNSVKSVEDVERYSGLPTLGVVPAFGDNSGSYGHYYAYHSSE-----SRSKRNKSE
A0A3E2BQJ8      MEYLDNTVKSAEDVERYSGLPTLGVVPVFDEDATLNGHYYAYRSGEEEEAGGKKKKKEQD
                ::**  ::*:  *: .  . .::* :*                             . . 

A0A1F5AEV3      TKASRRVEDQRVRFLKPNGTDGDSVGGGMRGGKIDLIASREPQSIQAESYRSIRTTLFVS
A0A1W9P661      THQYSYGQQEGETLEEEVIN------------NIELINYYYPNISIAEDYRTIRTSILFS
A0A3E2BKD4      KKKHSQPKPKSVSLKADQASQAPAETPDRNNHQIELIIQREPRCIQSEAFRSIRTSLLLS
A0A2N7QEB5      KKDTKQQEEVT---------------------NIELTSHFAPESVFAESYRSLRTALLLS
A0A3E2BQJ8      KAEGENGSEPR---------------------SIELISHFAPDSTFAESYRSLRTALLLS
                .      .                        .*:*     *    :* :*::**:::.*

A0A1F5AEV3      SPPGKIKTILFTSPLAREGKSSTVSNMGITFAEAGKRVVIVDSDLRKPKQSRIFGVNSGN
A0A1W9P661      SLEDKPMAIGFTSSLPEEGKSTTLVNTAVAFAQMDRRVILIDGDLRKPRLHKIFDNT--N
A0A3E2BKD4      FDSPARKALIFSSPLSKDGKSSVISNLGLALAQAHKRVVIVDSDLRKPRQQEIFNVD--Y
A0A2N7QEB5      APQGSLKMVMITSPLPGEGKSTTISNLAISLAQMGKKILLIDADLRRPNQHHNFNIK--N
A0A3E2BQJ8      GPLASLKSLIITSPLPNEGKSVTISNLAVSLAQMEKKVLLMDADLRRPKQHRIFNLK--N
                        : ::*.*. :*** .: * .:::*:  ..::::*.***.*.    *.     

A0A1F5AEV3      GPGLSRYLSSHIEPADVGKPTEIPNLQLITSGPLPANPIELLTSEKMDALIAYLKRSFDF
A0A1W9P661      RIGLSNYLAGKSSIDEIIHPTKITKLDLIPCGLHPPNPAELLESRRFIDLIRLLKEDYDF
A0A3E2BKD4      TWGLTHFLSAIVDASEIIRPTAYTNLFVVPSGVTPSDPLEIMFSEKMKAFINFLKQQFDF
A0A2N7QEB5      NNGLTNYLAMDLEIEKIIKPTMVPSLYLINSGPIPPNPAELLSSDKMSQLLSKVREQFDF
A0A3E2BQJ8      HDGLSNYLTMGLELNKLIKTTLVPSLYFINSGPVPPNPAELLGSDRMKALLDRLKAAFDF
                  **:.:*:   .  .: ..*  ..* .: .*  *.:* *:: * .:  ::  :.  :**

A0A1F5AEV3      VLFDTPPLLAVSDALAMGPMADAIILVARGGQTPIPALKQAKQKLDAHKLKCLGVILNGV
A0A1W9P661      VLVDSPPTLAVVDASVVSTRMDGVVVVIRANKTTKKSLLYAVETLRKAKAPILGVVLNEV
A0A3E2BKD4      VLFDSPPILAVSDALVLGKQVDGLILVVRAGQTPLNALKQARNKVEDHKINCLGVIINGV
A0A2N7QEB5      ILIDTPPILAVTDAQILGRLVDGLVLVIRAETTPREALQQARELIDLLKLKTFGVVVNYL
A0A3E2BQJ8      ILIDTPPILSVTDAQVLGKMVDGLVLVVQADRTPREALKQTREVIDLLQLKTYGVVINAL
                :*.*:** *:* **  :.   *.:::* ..  *.  :*  : : :   :    **::* :

A0A1F5AEV3      DLVEQDGYYARQYYHYSKPE------
A0A1W9P661      P-FSHNGYYSPDYHGYLKGYYSSSKQ
A0A3E2BKD4      SLLEQEGYYARQYYHYSKPL------
A0A2N7QEB5      N-LNHRGYYYRHYYRH---YYKEYRR
A0A3E2BQJ8      N-LDNRGYYRRQYYRH---YYQK---
                  ..: ***   *: :          

© 1998-2019