BYKdb

Dataset for cluster tadcd of phylum candidatus-cloacimonetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1W9P0R7      MKTNRTKEAILTKEDKDSHLDIIAYLKVLWRRKIVMTTAVGATLFFTLIYTFISPKIYEA
A0A1V4R675      -----MEQFPEQEQE----IKLRDYYRIILRHIKLIGIIFVLVMVATIYYTARAPRIYES
A0A2G6BVY8      ---MFEDDNNQENYS----FPWKEYFSIIYRGRWWILLTFITISSLSTYYTLRMTPVFQA
A0A3D5VBP3      MQDQFYEQ--TEEQE----IKLTDYLHIISRYKWLIIAIFVLVVAATVIYTFHSPKIYSA
A0A2N2KUB8      MDNQTNTA--PVQDE----INLSDYLRIVLQYRYLIVLVFSLVVVSTVFYTARQDKIYSA
A0A3C1LP64      --MEQQNIPNPASDE----INISDYFRIILQYRYLVILVFILVLIGTIIYTARQPRVYSA
A0A2N2KXM8      MENQHINP--VVQEE----IKLSDYLRIIVQYRYLVVLIFTLVLAATVIYTARQPKVYST
A0A2N2LDB7      MENQVQNQSNVSQDE----IKLSDYIRVIVQYRYLIVLVFVLVITLTIFYTARSPRIYSA
A0A3D3EZ13      MENQYQNQQ-PLQDE----IKLSDYVRIVLQYRYLIVLVFILVMAATIIYTARQDKIYSA
B0VJW4          MLENENNQL-PVQEE----IKLSDYFRIILQYRYLVILVFLVALVATVYYTARLPKIYSA
                            . .    :    *  :: .    :   .      :  **     ::.:

A0A1W9P0R7      QTSILIQQIPEG-KDTFLTPWEYIGARENFINNQAQILKSRTNLKLVIDKIRKEHSGENL
A0A1V4R675      NGKILLELNKQT---DLF--FSTGGFGRNDLNNQMEVIKSPSVMESAVEKLKRNQEAENF
A0A2G6BVY8      ETTIEIKDKDNMFSDMSS--PFNLKRSDRVIANNSELIKSRTVAKMVMDEVDKSEFAEHI
A0A3D5VBP3      SSTIMLEEKSSE-N--LL--FSSMANKATSINNYIEILKSRPVLEAAYSIIQNSEIYPEI
A0A2N2KUB8      SARILLEDQKGS-TDLMF--LATPGVGKNSLNNQIELIRSKPIMSLAWDIMKKYPDWDTF
A0A3C1LP64      SNRILLETQKSG-AD-LF--LAGTGTGKNELNNQIELIKSKPILNAAWEIMKKYPDWESF
A0A2N2KXM8      SSRVLIENQKNT-SDLML--FATPGVGTNALNNQIEMMKSLPLGNRAAEIMKKHRDWESF
A0A2N2LDB7      SSKILLENQKSQ-SDFLF--LATPGVTSTTINNNIELMKSKTIGTMAWEIMKRNPDWDTF
A0A3D3EZ13      SSRIMLEDQNQG-AEFLF--MGAPGMGKNSINNQIEIIKSRPTLTLAWEIMKKYPDWDLF
B0VJW4          STRILLEDANKQ-SDLMF--LSTGGLGKNTLNNQIELIHSKPIMNLAWEIMKKYPDWDTF
                .  : ::                       : *  :::.* .    . . : .      :

A0A1W9P0R7      PILKDP-------DPITSLAYNIIVKPVERTDIVNILVHSTDPKEAAIIANTVAENLLEQ
A0A1V4R675      PILSLD-------NPSSILAKNIDVSAEREVDIIDISFKSTNPNEAQAAVNAVMDSYQDE
A0A2G6BVY8      SVSKEVRKDLNENSRIQMLRRKLSIKPIKNTDILRLIITSSSPFEVSFLANTYAEQFELY
A0A3D5VBP3      PLNPANHEEPDKFSPIGAIKEKLAVESQRETDIIKISYESTHPGEAKLVANALALGLQNK
A0A2N2KUB8      PANTSG-------NPIISL-SRMKVESKRETDILTISFESTNQTEAMAAVNSISEAIQQQ
A0A3C1LP64      PAASTP-------NPAAQL-ASVKVESKRETDILTISYESTSQGEAMAAVNSIAEAVQQE
A0A2N2KXM8      PISQSA-------SPGAFIKARMKVESKRETDILTISYESTSQSEAQAAVNAVAEAIQQE
A0A2N2LDB7      PINSSG-------SPVNTLRSSVKIESKRETDILTISYESTNQVEAMVAVNSLAEAVMLE
A0A3D3EZ13      PIASHE-------NPAGAL-GKVKVESKRETDLLTISIESTSPTEAQAAVNAIAEAIQQQ
B0VJW4          PASQAA-------DPASTL-GRMKVESKRETDVLTISFESTNPTEAMAAVNSIAEAIQQQ
                .            .    :   : :..   .*:: :   *:   *.   .*:        

A0A1W9P0R7      SRLTARSAVSEVRKFLEKQLKIVQNNLKESADSLRVFKEKNRVFSLSNEGEELFTKLSTF
A0A1V4R675      SLKYTRAEVTSVREFLEKQLDVTSKKLAISEEDLRAYKIAHEVFALTEETKEMITNMVEF
A0A2G6BVY8      SKLSNLGEVGAVTNFLKDQLDVIKKRLKLSEEALELYQKEGGIVVLEAETQLLIENSAKS
A0A3D5VBP3      DNEYARIEFKNVREFLENRLDETERRLRNSEEDLRSYKIDKGISMLSEETTQIIEQSAEL
A0A2N2KUB8      NTQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSAETAQLIIQSSEL
A0A3C1LP64      NTQFARLEYTTIREFLETQLDAISRRLQSSENDLREFKNMNKLTELSAETTQLIEESAKI
A0A2N2KXM8      NTLYARLEYTTVREFLEDQLDAISRRLQSSENDLREFKNANQLVELSAETQKLIEQSAEV
A0A2N2LDB7      NTQYARLEFTNIREFLETQLDAITRRLQTSENDLREFKNMNRLVELTEETTKLIEKSSDV
A0A3D3EZ13      NTQFARLEYTTIREFLETQLDAISRRLQASENDLREFKNLNRLTELTAETTKLIEQSSEL
B0VJW4          NTQYARLEFTTIREFLETQLDAISRRLQSSENDLREFKNLNKLTQLSEETNKLIEQASDL
                .          : :**: .*.   ..*  * : *  ::    :  *  *   :: :    

A0A1W9P0R7      DSKYNEIEADYITKKKQLDFLKKKYEQNQKNLVTDITEIKSPLIMNLRKKL--ISLETEY
A0A1V4R675      EAQLSSAQTELQIVEKKLAYLKDELIKIDEALGEEMASISSPVSEQLRQKL--IENESQL
A0A2G6BVY8      EAKLNEIELNYQSANQKILFLKKELDEKSKRIVEDISRNATPEIEKLKIKVGELNAKKLN
A0A3D5VBP3      ELLLSEAETEYAVAKNRLDFLTSELSDQDKLLSDVNSIITTPLLEQLRREI--VTNQSKY
A0A2N2KUB8      EALYESSLTDQAIKAKSLDMLNRQLREQDSLLVDVNNILKAPYISELRKQI--VDTQSLV
A0A3C1LP64      EAEYEAALTDQAVKARTLELFQKQLQQQDSLVVNVSTVLKTPYINELRKQV--IETQSLI
A0A2N2KXM8      EAQYEQALTDQAVKAKTVEMLQRQLSEQDSLIVNVENILNAPYVNELRRQV--IDTQALI
A0A2N2LDB7      EAEYESALTDQAVKAKSLDLLNKQLREQDSLMVNVNNILKAPYVAELRKQV--VDTQSLI
A0A3D3EZ13      EAELEASLTDMAVKAKSLDLLTKQLRDQDSLLVDIDNMIKTPYITELRKQV--VETQALI
B0VJW4          EAEYEAALTDQAVKAKSLDLLNRQLQEQDSLLVNVDNIIKTPYINELRKQI--VDTQSLI
                :   .    :     . :  :  :  . .. :        :*   :*. ::  :  :   

A0A1W9P0R7      SNYLLQ-GLPENHPKMEKIKSLINETKRSLQKEVRKYISSGAENGNLITENQKI------
A0A1V4R675      AILLTKKGYTENHPQLVSLRTEIDNIKRQMKSEIAKILEVNKYSFNPLDRRQQLFTDIIS
A0A2G6BVY8      IELEKSAGY---KRILKNLQKQIDNLEAKITEKAKYFANSAQASANPVEDKSDIMRKILE
A0A3D5VBP3      LNLLSKPSYSPDHPELVALKNQIDNAKRQLNEEIQKTTNVKAGTADPLVYRADLISSISK
A0A2N2KUB8      TKLVTKNEYPLDHPQILLLKREMENAKATLDLEVRKLVALSV-NNDPLTTRSELLGKIIQ
A0A3C1LP64      TKLLTKNNYPTDHPQIIALNAELERTKDELDIEIKKLVATSS-TDDPLAMRNETLVKIIQ
A0A2N2KXM8      TNLVTKNEYPLDHPQIALLNAELDRSKANLDLEVRKMVAIQM-QSDPVATRSDLLNRIVQ
A0A2N2LDB7      NKLLSKNEYPLDHPQIMLLNRELENIKATLDTEVRKLVKISL-NSDPLQSRSDLLSRIVA
A0A3D3EZ13      TKLLTKNEYPLDHPQILLLNRELENTRANLDREIRKLVSVSV-SADPLSTRSDLVNRLIQ
B0VJW4          TKLVTKNEYPLDHPQIQLLYREIENAKEKLDQEIRKLVNLAV-TDDPLATRSDLLTRIVQ
                     .      :  :  :   ::     :  :            : :  . .       

A0A1W9P0R7      ---------------------------------TKLAQLERAYKINDNTYEMLMQKYEEA
A0A1V4R675      TEVEFQTATAKVSGLETVVEEYSVRMSGLPDAELELARLERSKAINEQIYSMLITRYEEA
A0A2G6BVY8      AQAEQIGLKAQAKKVQETINNYNKKIAMLPETATEFARLKRKYEIDEKTYIMMENKYNEY
A0A3D5VBP3      ARVEKNIAESKVENLRKSVEQYNRQLSLLPDAEIELARLERNNRINEKTYTMLNEKFEEA
A0A2N2KUB8      ANLELEMARAKVDGLEQTKEMYDQRIIAIPNTELELARLTRNMLLDEKIHGMMMEKYEDA
A0A3C1LP64      TNVELEIARTKADGLAQTKEMYDERIISLPNTELELARLMRNVQLDGKIHGIMMEKYEDA
A0A2N2KXM8      ARIELEMARSSVSGLEETKEMYAQRMITLPNTELELARLRRNLLLDEKIHGMMMEKYEDA
A0A2N2LDB7      ANLELELTRAKVNGLSQTKEMYNERIVTLPNTELELARLVRNMKLDEKIYGIMMEKYEDA
A0A3D3EZ13      ANVDLELARTRVDGLGQTKEMYEQRIISLPNTELELARLSRNMMLDSKIHGIMMEKYEDA
B0VJW4          ANIELEMARAKVDGLEQTKEMYNQRLIAIPNTELELARLTRNLMLDEKIHSMMMEKYEDA
                                                  ::*.* *   :: : : ::  .::: 

A0A1W9P0R7      KITEAGQLGSVKIIDKAFIPTFAIKPNKKKNLLFAILVGIGIGLVFTVFTEYIDTSIKEP
A0A1V4R675      KISEEGKL--------------------------------------------LNTKITNL
A0A2G6BVY8      KIALAGQVGNARIVDKAITPKSPIRPDKPLYITIGLGVGLGLGVFISFLLAFFDNSIKTI
A0A3D5VBP3      RIAEKSKMGKIRIVEEAQLPEAPIKPNKKMNLLIAIVLGLGGGIGSSFLLHSLDSKIRTF
A0A2N2KUB8      KIAEQAKVGNVRIIDFAERPTIPIKPRVSMNILVGIILGLGLGIGAAFIVHSLDTKLRTL
A0A3C1LP64      KIAEQAKVGNIRIVDLASRPVSPIKPRVSMNILVGVILGLGLGIGAAFLVHSLDNKLRTL
A0A2N2KXM8      KIAEQAKVGNIRIIEYADLPRVPIKPRVSMNILVGIILGLGLGIGAAFLIHSLDNKLRTL
A0A2N2LDB7      KVAEQAKVGNIRIVEYAEKPVSPIKPRVSMNIMVGIILGLGLGIGVAFIVHSLDTKLRTL
A0A3D3EZ13      KIAEQAKVGNIRIIDYATRPQIPIKPKVPMNILVGIILGLGLGVGAAFLVHSLDTKLRTL
B0VJW4          KIAEQAKIGNIRIIDYAERPTVPIKPRVSMNILVGVIIGLGLGIGTAFLVHSLDTKLRTL
                .::  .::                                            ::..:   

A0A1W9P0R7      KEVEEYIGEPTLGIIPNINHTFLSKEKNNGKLGNAK----------------KLLLTEFP
A0A1V4R675      SDVERYVKLPILGTIPDIPLDEKQLADIEDRMGKEKDKERLQELTTTQRQMVARLVPHYS
A0A2G6BVY8      EDIERF-KINFLGAVPTINIKDMKKKMRKKMDDLTDSEKT-K--------INSKLISHFS
A0A3D5VBP3      DDVRNYVSLPILGTIPFIRVHDSDIDYLEKQIKNATGEGK-EELKHIKQQVESRLITNYA
A0A2N2KUB8      EDMETYVRLPIVGTIPLIRESESKLQEFNYMIEAAEGENR-EQLTRSMHFVLMQLVSHYA
A0A3C1LP64      EDMETYVRLPIVGTIPVIQESEARMEEFNAMIEKAEGENK-EQLSKSMHYVMMQLVSHYA
A0A2N2KXM8      DDMETFVKLPIVGTIPVIQESEARIEEFNELIENAEGENK-ERLMKSMHFVLMQLISHYA
A0A2N2LDB7      EDMETFVRLPIVGTIPMIAESESKLEEFNRMIEQSDGEHK-EQLLKSMHYVMMQLVSHYA
A0A3D3EZ13      EDMESYVRLPIVGTIPVIREAESKLAEFNDMIEKSEGEAR-AQLAKSMHFVMQQLVSHYA
B0VJW4          EDMENYVRLPIAGTIPVIHEAESKLQEFNDMINSATGENR-EQLTRSMHFVMMQLVSHYA
                .::  :      * :* *          :                         *:. :.

A0A1W9P0R7      PRSGVAEAYRSLRTNLQYF--NTDKPIKSILITSSIAQEGKSTIVSNLAISLSQLGLKTV
A0A1V4R675      PKSPIAEAYRTFRTNVVSLPFKVPGLGKIFLVTSSGPKEGKSTSAGNLAITLSQMRSKTI
A0A2G6BVY8      PKSPISEAYRTIRTNIYFS--SVDSPPSVIVVSSSVPKEGKSTTSSNLAVTIAQSGKKVV
A0A3D5VBP3      PKSSTSESFRMLRTNIVAK--KKKGQPLSLLVTSSGPKEGKSTIISNLAVALSQMDKKVI
A0A2N2KUB8      PKSPIAEAYRTLRTNILAR--K-AEGSTTLLITSSGPKEGKSTTIANLSITLAQMNNKVV
A0A3C1LP64      PKSPVAESYRTLRTNILSR--RNTTGSTSMLITSSGPKEGKSTTIVNTAITLAQMNAKVI
A0A2N2KXM8      PKSPIAESYRTLRTNILAK--K-PEGSTTLLVTSSGPKEGKSTSIVNLAITFSQMNSKVV
A0A2N2LDB7      PKSPIAEAYRTLRTNILSK--K-SEGSVCLMVTSSGPKEGKSTTIVNLAITLSQMNAKVV
A0A3D3EZ13      PKSPIAEAYRTLRTNILSR--K-AEGSVTLLVTSSGPKEGKSTSIANLAITLAQMNARVV
B0VJW4          PKSPIAEAYRTLRTNILAH--K-GESSIAILITSSGPKEGKSTSIANLAITFAQMNSKVI
                *.*  :*::* :***:             ::::** .:*****   * :::::*   ..:

A0A1W9P0R7      MVDADLRKPMLHKLFEADLSPGLTNLIISKDVEFKKTIKNTRIENLFLITAGSVPPNPAE
A0A1V4R675      LVDCDMRRPMIHNLFIVSRENGLSKFLTTDNIDIHDIIKPSGMDNLDIITAGHVPPNPSE
A0A2G6BVY8      LIDADLRRPVVHKNFNILREIGVTDFLIK-NSSVRDISKMTDIENLSIITCGDIPPNPSE
A0A3D5VBP3      LVDLDLRRPMQHKIFNLEKNEGISDFLYDHDKELETFIKKTKIDNLDIITSGFIPPNPSE
A0A2N2KUB8      LIDMDMRRPTIHSKFALEKENGVSDYLIDPDVTLDQVVKSSGIMNLDIITSGFVPPNPSE
A0A3C1LP64      LVDMDMRRPMIHNKFGIEKENGLSDYLIDPDVSIEQVTKATGIPNLDVITSGFVPPNPAE
A0A2N2KXM8      LIDMDMRRPMVHNKFGIEKENGLSDYLIDADVKIEQVVKSSGIVNLDVITSGFVPPNPSE
A0A2N2LDB7      LIDMDMRRPMVHNKFGVEKENGSSDYLIDPELTIPQVAKATGIQNLDIITSGFVPPNPSE
A0A3D3EZ13      LVDMDMRRPTVHTRFNLDKENGSSDYLIESDLRVEQIVKESGIPNLDIITSGFVPPNPSE
B0VJW4          LVDMDLRRPTVHSKLGLEKENGTSDFLIDPEVSVEQVIKPSGIANLDVITSGFIPPNPSE
                ::* *:*.*  *. :    . * :. :   :  .    * : : ** :**.* :****:*

A0A1W9P0R7      LLESKRMKEVSYEITKEFDYLIFDAPPIVLVADAVILSTLVDGVILIIEAKKTRRDAIFS
A0A1V4R675      LLSSKKMDELFAKLREEYDYIIVDSPPIIAVTDALILSKKVDELVLVIRVNSTEREIIEQ
A0A2G6BVY8      LIASAKMDKFIEELKKEYDVIIFDTPPVITVTDAVVLSRKTDGIVLVVSSGTVGKEEVRR
A0A3D5VBP3      LLASSHMDEVLDILKQKYDYILLDTPPTMAVTDSIILAKKVDFRALVVRINQADKIVIKR
A0A2N2KUB8      LIASPRSDVLIEELKKRYDYILFDTPPIIAVTDALILTKKVDMTFVVVRCGFTEKGIIKR
A0A3C1LP64      LISSARTDILLEELKAHYDFVLFDTPPIIAVTDALILTKKVDLTFLVVRCGFTEKGIIKR
A0A2N2KXM8      LISSARTDMLIAELKERYDFILFDTPPIIAVTDALILTKKVDMTFVVVRCGQTEKGIIKR
A0A2N2LDB7      LISSKRMDQMIVELKSIYDYVLFDTPPIIAVTDALILTKKVDMTFVVVRCGYTEKGIIKR
A0A3D3EZ13      LIASNRFDKMIKELKSLYDYILFDTPPVIAVTDALILTKKVDMTFVVVRCGFTDKGIIKR
B0VJW4          LIASPRTDNLLEELKSRYDYVLVDSPPLIAVTDALILTKKVDMTYLVVRCGFTDKGIIKR
                *: * . . .   :   :* ::.*:** : *:*:::*:  .*   :::    . .  :  

A0A1W9P0R7      SKEIIKNVGGKILGTVLN----KTRFSRMD-YMYGGYSGYYYYGYDESGHKTKKKKQKGG
A0A1V4R675      AKSLLHNIDVKVAGVVVNGIEVKKYYSGYK--YYYYYYYYYYTDDEKGAKKKKRKTQGHS
A0A2G6BVY8      SQDLLRSVDANIIGVILNNLDIKKLYGNYY-YYYHYYQYYYYYGADKKKK----------
A0A3D5VBP3      IKEILDNVDSDFTGAIINGIHPQKYYS----SYEYNYYYYYYYGKEDEKK------DGAL
A0A2N2KUB8      TKELMENIDGKIDGIIVNSIYVQKYYSKQN-YYYYYYYYYYYYGDEVPKK-QKKNVNRFL
A0A3C1LP64      TKELMANIDATIDGIIVNGIYAQKYYSRQNYYYYYYYYYYYYYGDEAPNKLKKKHAGRFL
A0A2N2KXM8      TKELMENIDAKIDGIIVNGIFVHKYYSKQN-YYYYYYYYYYYYGDEAPRK-QKKDVRRFL
A0A2N2LDB7      TKELMENIDSKIDGIVVNSIYVQRYYSKQSYYYYYYYYYYYYYGDDVPKK-QMKNVNKFL
A0A3D3EZ13      TKELMENIDARIDGIIVNGIYVQKYYNKQN-YYYYYYYYYYYYGDEVPKK-QRKNVNRFL
B0VJW4          TKELMNNIEGRLDGIIVNGIYVQKYYSKQN-YYYYYYYYYYYYGEEVPQK-QKRNVNRFL
                 :.:: .:   . * ::*    :  :.         *  *** . :   :          

A0A1W9P0R7      KRNEL--
A0A1V4R675      RLSRKA-
A0A2G6BVY8      RRGRA--
A0A3D5VBP3      PKKSS--
A0A2N2KUB8      RKNKSVS
A0A3C1LP64      RKDKPVA
A0A2N2KXM8      RKNKSVS
A0A2N2LDB7      RKNQPVS
A0A3D3EZ13      RKNKSIS
B0VJW4          RKNKSIS
                       

© 1998-2019