BYKdb

Dataset for cluster tadcd of phylum candidatus-dadabacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1K715      ----------------MRGMQDLMRLTAVRR-----------------------VLAAVR
A0A0T5ZTK1      MEEGNKRDVVEYKSNELKEREDYPLSTQVRREYDTHIEEE---------PNLRDYIDVIL
A0A3M1VEF6      -----------------MNRDKLPQLRPLTEGLPAGVEFEDGSDYQTLYPQFKEYLKVII
                                    :.      :                          : .: 

A0A3M1K715      RYRFVGLSFFIFVILGTLFFTFSQDELYRATSVVELR-----WNPKTEVFPFRDVSTQET
A0A0T5ZTK1      RRKWIVISCLAISVVTVAIASLLMNRIYKAEATIEIAPENPKITTFQEVVELEPQPQQT-
A0A3M1VEF6      KYRMLILTSIVLLTLIALIYAFTVTPRYTAESVIKISTYQP-ILTATKIEDMLQQRSKE-
                . . : :: : :  : . : ::     * * :.:::        .  ::  :     :  

A0A3M1K715      WGGYWSYDEFRNTQIEVIRSRRVLQRVVDVLGDP--------SLTPALL-----------
A0A0T5ZTK1      -------DSFYETQYKLIESKSLAKEVVSALQLDLHPEFAVKEKKPGFISFVNDTFAQIL
A0A3M1VEF6      -------ANYLETQVKQIKSYSLADRVLSHDNLK---EQIFGKDSPGLL-------ATLF
                        .: :** : * *  : . *:.             . .*.::           

A0A3M1K715      ---------------------------EARLTVEPVPDSRLIRVSYMDTSPQRAADIANT
A0A0T5ZTK1      QANEKKSDPIEIEKRQLAREEGLLDSFLDRVKVTPDRKSRLVQISFESSFPELSAKVANT
A0A3M1VEF6      GWDSKKGTEAHSKDNIYNNSVREIQSYLDRIEVKPLRRTSLVKIQATFTDPVLAARVANT
                                             *: * *   : *:.:.   : *  :* :***

A0A3M1K715      VVQAYMDVGVENRIRWIQQIVDWLRDRIDNTQDDIGRAQKDLFEFQKEMGSINLDKDRQQ
A0A0T5ZTK1      LVDEYIGWVLERKLDATKAARRFLEKQLGEVKAKLERAEEELSSYAKGADIVSLDEKFNL
A0A3M1VEF6      HAREYINWVREARVSQQSAGLKFLKGQAQELRQKVADLEREQADYAEANSIVAVNKDENI
                 .  *:.   * .:   .    :*  .  : . .:   : :  .: :  . : :::. : 

A0A3M1K715      IEAEIDALHARYIDAHTRRIQLEGQLREMKRLAEQGNSGLQQLAHALAVEDRQGAVATIQ
A0A0T5ZTK1      TYKQLAELNDALSKAETERLTKEALYKEIQA------GNYEYFPQVIS----DSSIQTLD
A0A3M1VEF6      TAQKMSQLNRLLTAATAKRLEAEHLYQE-SL------KALKNNAAGID----DASTQEIR
                   ::  *:     * : *:  *   .* .          :  .  :     :.:   : 

A0A3M1K715      KRWVELQAERAGLSAVYGDAHPKMQALDRQLNALRSELLEAARKRIDGIRAQMDIATAEE
A0A0T5ZTK1      EEHTKLKSQYDNMSVIYGPNYPEMKQLAAQLGRIQSDIKGRINGIAESIKKDYQTALTKQ
A0A3M1VEF6      SRLAKLEAEYQQLSAKFTPNYPKMQQLRYEIKALKQSIEGQRAQIVAGLKAKALAAAEEE
                .  .:*:::   :*. :   :*:*: *  ::  :...:         .:. .   *  ::

A0A3M1K715      EELLKAMDELVSAALDRSKIWQRYQELSDEAVSRRQFYEVLLERFKEIDITRDLNREQAV
A0A0T5ZTK1      NILMQRTDEQKKLVTKLNDKTVQYRILEREVETNKSIYQNLLQRLKETEVASGIRATNIQ
A0A3M1VEF6      RSLKEELEKQKSMAFELSKRQVQYNILNRELQSARELLQNVLRQIDETSVAVEGNSSNVS
                  * :  ::  . . . ..   .*. *. *  : ..: : :* .:.* .::   .  :  

A0A3M1K715      LIESAVPPAVAAWPNVRVNLAVGLFLALTGAIGMALLLNLLQQGVQNSEDLEAAIGVRAL
A0A0T5ZTK1      VVDYASTPLIPYKPNIKLNMLLAILMGLMGGVFLAFIFEHFDNTIKDEEEVKRRFSLPFL
A0A3M1VEF6      IVDHAAVPLRPSFPKKGLVILIGLVLGTGLGFSLAFFLNYLDDTIRTPEELTAYTALPSL
                ::: *  *  .  *:  : : :.:.:.   .. :*:::: ::: :.  *::    .:  *

A0A3M1K715      AELPYLQTDSI----------------------------------------DYPLEKLML
A0A0T5ZTK1      GAIPLVDENEL-----------------------------------------QDLEKVVY
A0A3M1VEF6      GVVPSFEIENLLPENQSSVNGAGDIKAATGQTAKSNKGRGEKTGAPVPSKKPDNFPVVYL
                . :* .: :.:                                           :  :  

A0A3M1K715      HDPDSPLAESIRVVRNHILFAPRGRRIRAILFTGAQPLEGKTTTANNLAIATAQAGRRVL
A0A0T5ZTK1      ANPKSLVSEAFRVIRTSILYSSPNSPPKSLLITSTQPLEGKTTCASNLALSFTQSGLKVV
A0A3M1VEF6      RDPKSLASEAYRTIRTGILLSQAGEPPRTILLSSAQSSEGKTTTTLNLAASLASAGGRVV
                 :*.*  :*: *.:*. ** :  .   .::*::.:*. ***** : *** : :.:* .*:

A0A3M1K715      LVDADLRKAATSKVWKARG--RRGFADVLSGNARWQDVVQPTEVANLSVMGTGGDPSHPP
A0A0T5ZTK1      LIDADLRKPRLHKLFLNNG-YAFGLSTYLVGKMELSGVINRTSLDGLDIITSGPIPPNPA
A0A3M1VEF6      LIDADLRRPSLLKIIDGEERIRPGVVEVITGQANLEDVLIRDAMRRVSLLPSGNPPPNPA
                *:*****..   *:         *.   : *:   ..*:    :  :.:: :*  *.:*.

A0A3M1K715      ELFQKEALERVLPVLQQEWDIVIFDGSPLLLVADSIVVSSVVDETFIVMEAGRIHKREAR
A0A0T5ZTK1      ELLGSKRMKELIEHLLEEYDHVILDGPPIAGFADSRLLASVVDGVLLVTSIGITQRQTLR
A0A3M1VEF6      ELLGSIEMAGIIDKLATMFDYVLIDSPPILPVTDSVILSRYVDGVVLVVRGASTPRKVVL
                **: .  :  ::  *   :* *::*..*:  .:** :::  ** ..:*   .   ..   

A0A3M1K715      DLVARLERIGQPTWEIILNKVTLPSAWGYDGYGYGYSYGYGSRGESELLVDQGDVTVETV
A0A0T5ZTK1      SSIEDILRVRGRIIGTIVNRLESRRS----KYGY---SYYYYYNNEEGKRKKSNLHLPHA
A0A3M1VEF6      DAKERLRSVGARFLGAILNDVDVTSG----DYYYYNRYYYSYYNQEKHDSRAAS------
                .    :  :       *:* :    .     * *     *   .:.:     ..      

© 1998-2019