BYKdb

Dataset for cluster orphancd of phylum candidatus-desantisbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1J5E0N0      ---------------------------------------MDARIVTYHSPKTPISEQYRM
A0A2H0A8Q4      MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRM
A0A2M7P361      MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRM
A0A2M8AWJ6      MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRM
A0A2M7JEF9      MPENLLTSIREKKAPETKKKEKPDGFLATSIAYAKDDSGIDARIVTYHSPKTPISEQYRM
                                                       :********************

A0A1J5E0N0      IRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVH
A0A2H0A8Q4      IRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVH
A0A2M7P361      IRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVH
A0A2M8AWJ6      IRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVH
A0A2M7JEF9      IRTNLQRVNPENPPRLIALSSSLHREGKTTTSVNLAVAMAHDLNKNILLVDCDLRKPNVH
                ************************************************************

A0A1J5E0N0      NLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVE
A0A2H0A8Q4      NLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVE
A0A2M7P361      NLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVE
A0A2M8AWJ6      NLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVE
A0A2M7JEF9      NLLGLRMEGGMSDILTRGVELDAVFKKTRAENLTVLTSGKIPSNPSELLGSHRMRDLLVE
                ************************************************************

A0A1J5E0N0      LKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
A0A2H0A8Q4      LKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
A0A2M7P361      LKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
A0A2M8AWJ6      LKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRARSFLSNAHANII
A0A2M7JEF9      LKNRFDYVIVDTPPVLAITDTGILGALVDGVVVVVQTWRTQREALDRTRSFLSNAHANII
                ***********************************************:************

A0A1J5E0N0      GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
A0A2H0A8Q4      GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
A0A2M7P361      GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
A0A2M8AWJ6      GYILTGVEYFVPGYLANYGYHYGYGQYHGYYAHSEEV
A0A2M7JEF9      GYILTGVEHFVPGYLANYGYHYGYGQYNGYYAHSEEV
                ********:******************:*********

© 1998-2019