BYKdb

Dataset for cluster tadcd of phylum candidatus-edwardsbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F5RCH8      MAAEQNIKPQETSLYEVVDLLWRRKTLILVCLAGILLPIIIANFTLPPVYESQTTIIFEQ
A0A3B9EB47      MAAEQNIKPQETSLYEVVDLLWRRKTLILVCLAGILLPIIIANFTLPPVYESQTTIIFEQ
                ************************************************************

A0A1F5RCH8      SREPIAAFDVSDAFSRKSYIVNQIEEIKARTLAEEVAHKLAPETAAEILKDQGRGLSQEG
A0A3B9EB47      SREPIAAFDVSDAFSRKSYIVNQIEEIKARTLAEEVAHKLAPETAAEILKDQGRGLSQEG
                ************************************************************

A0A1F5RCH8      RRQLLSQRIKKGISAEPIRDSDVILIKFQGPTPASAARTVNLVAETVKERSSQVKREQAS
A0A3B9EB47      RRQLLSQRIKKGISAEPIRDSDVILIKFQGPTPASAARTVNLVAETVKERSSQVKREQAS
                ************************************************************

A0A1F5RCH8      STRKFIEVQLPAVEAGLYKAEDAIKGFKARNQVVSLSDEAREVLARMTEIDKMYAGTVTQ
A0A3B9EB47      STRKFIEVQLPAVEAGLYKAEDAIKGFKARNQVVSLSDEAREVLARMTEIDKMYAGTVTQ
                ************************************************************

A0A1F5RCH8      KMALEKKLEAIYTKLEYKPDFSEGSSKMTSGAVADSLRKSLLDLQIEATQLSIKGYHPEH
A0A3B9EB47      KMALEKKLEAIYTKLEYKPDFSEGSSKMTSGAVADSLRKSLLDLQIEATQLSIKGYHPEH
                ************************************************************

A0A1F5RCH8      PQIYKLNRQIEATKNKLVEELANISRGGQAKPMPEMSDLLAQIPPLQIELISLEARELAI
A0A3B9EB47      PQIYKLNRQIEATKNKLVEELANISRGGQAKPMPEMSDLLAQIPPLQIELISLEARELAI
                ************************************************************

A0A1F5RCH8      RDFNTGYESDLSKLPYKELELTRLLRAKDVNENIYKMLLEKYEEAKITEAGKIGNVRVID
A0A3B9EB47      RDFNTGYESDLSKLPYKELELTRLLRAKDVNENIYKMLLEKYEEAKITEAGKIGNVRVID
                ************************************************************

A0A1F5RCH8      PAKEPLSPIKPRKALNLLIGLVVGLVLGVGLSFFLDSMDNSVKTAEEIETNFGIPVLGLI
A0A3B9EB47      PAKEPLSPIKPRKALNLLIGLVVGLVLGVGLSFFLDSMDNSVKTAEEIETNFGIPVLGLI
                ************************************************************

A0A1F5RCH8      PSIQSEGPRKKKRNGRDEISKIASTLVTKYTPRSPISEAYRAIRTNIQFSKIDAPLRSIV
A0A3B9EB47      PSIQSEGPRKKKRNGRDEISKIASTLVTKYTPRSPISEAYRAIRTNIQFSKIDAPLRSIV
                ************************************************************

A0A1F5RCH8      VTSAAPSEGKSTTVANLAFTTALAGAKTLLIDADLRRPVVHSLFGLEREPGMTNILAERL
A0A3B9EB47      VTSAAPSEGKSTTVANLAFTTALAGAKTLLIDADLRRPVVHSLFGLEREPGMTNILAERL
                ************************************************************

A0A1F5RCH8      APEKVIKPSGVENLDILTCGAIPPNPSELLGSQRMKELVQQLKAKYDLVLFDSPPVITVT
A0A3B9EB47      APEKVIKPSGVENLDILTCGAIPPNPSELLGSQRMKELVQQLKAKYDLVLFDSPPVITVT
                ************************************************************

A0A1F5RCH8      DTAVLSNQVEGVVLVVLSHGTDRRALARAKSLLSNVNANILGSILNKIDLTGIGSSYDYY
A0A3B9EB47      DTAVLSNQVEGVVLVVLSHGTDRRALARAKSLLSNVNANILGSILNKIDLTGIGSSYDYY
                ************************************************************

A0A1F5RCH8      YHYHYYYYSDDGQNVKRKGRFWDILRPGGRRG
A0A3B9EB47      YHYHYYYYSDDGQNVKRKGRFWDILRPGGRRG
                ********************************

© 1998-2019