BYKdb

Dataset for cluster tadcd of phylum candidatus-kryptonia

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S4MUQ7      MEKIGTNGQTFFQ-EEETINLYEVIQVLYRGKWLIILIFILVVLATAIFTFMQDPIYEST
A0A0N7MUP1      MEKINTNGQTFFQTEEETINLYEVIQVLYRGKWLIILVFILVVLATATFTFMQDPIYEST
A0A0P1MWA2      MEKTNVNGQPFFQTEEETINLYEVIQVLYRGKWLVILIFILVVLATAIFTFMQDPIYEST
A0A0S4NBC6      MEKLSTNGQTFFQNEEETINLYEVIQVLYRGKWLIILVFILVVLATAIFTFMQDPIYEST
                *** ..***.*** ********************:**:********* ************

A0A0S4MUQ7      AVILIEKGKKGLGLAQAFDITGFSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVEPEKK
A0A0N7MUP1      AVVLIEKGKKGVGLTEAFDITGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVDPENK
A0A0P1MWA2      AVVLIERGKKGLGLTEAFDITGLSEQRNIKNEIEILKSRSLAEAVAKKLIDRVYVDLNDK
A0A0S4NBC6      AVVLIEKGKKGLGLTEAFDITGLSEQRNIKNEIEILKSRSLAEAVAKKLIERVYVNPQTK
                **:***.****:**::******:***************************:****: : *

A0A0S4MUQ7      SDTILVILPSRKELKEGIKPFAKIETIIERFEKNVKIESPRDADIIKITARSKNPKEAAL
A0A0N7MUP1      KDTILVILPSKKELKEGIKPFAKIETILERFKEDVKIESPRDADIIKITVRSKNPKEAAL
A0A0P1MWA2      KDTILIIKPSRKELKEGIKPFAKIETIIERFEKDVKIESPRDADIIKITVRSKNPKEAAL
A0A0S4NBC6      KDTILVILPSKKELREGIKPFAKIETILERFNKDVKIESPRDADIIKITVRSKNPEEAAL
                .****:* **.***.************:***:::***************.*****:****

A0A0S4MUQ7      IANTFADAYYERNLMMSRNESRSVRKFLEEQLADKRKQLDQAENQLESYMKSAGVVALDE
A0A0N7MUP1      IANTFADSYYESNLMMSRNESRSVRMFLEEQLAEKRKLLRQAEAQLENYMKQAGVVALDE
A0A0P1MWA2      IANTFADAYYERNLMMSRNESRSVRKFLEEQLADKKKLLDQAENQLESYMKSAGVVALDE
A0A0S4NBC6      IANTFADAYYERNLMMSRNESRSVRKFLEEQLADKKKILDQAETQLETYMKSAGVVALDE
                *******:*** ************* *******:*.* * *** ***.***.********

A0A0S4MUQ7      ESKKLIEQLSNLESARGEAIVDISAAKKKLDSYLEQIKQIEPEFVKVATEALDPYIKYLQ
A0A0N7MUP1      ESKELIKQLSDLESKRGETIVDISSAKRKLDSYLEQIKQIEPEFVKVATEALDPYIKYLQ
A0A0P1MWA2      ESKKLIEQLANLESKRGEAIVEISSAEKKLNAYLEQIKQIEPEFVKVATEALDPYIKYLQ
A0A0S4NBC6      ESKKLIEQLSDLESKRGEAIVEISSAQKKLNAYLEQIKQIEPEFVKVATEALDPYIKYLQ
                ***:**:**::*** ***:**:**:*:.**::****************************

A0A0S4MUQ7      EEIAKLEVTRDQIIAQNPKVGSQEVLNKSLREIDEQLASLRKKLQEKIAEFLKTGFASSG
A0A0N7MUP1      EEIAKLEVTRDQIIAQNPKVGSKEVLNKSLREIDEQLASLRKKLQDKISEFLKIGFASSG
A0A0P1MWA2      EEIAKLEVTRDQIIAQNPKVGSQEVLNKSLREIDEQLASLRKKLQEKIAEFLKTGFASSG
A0A0S4NBC6      EEIAKLEVTRDQIVAQNPKVGSKEVLDKSLREIDEQLASLRKKLQEKISEFLKTGFASSG
                *************:********:***:******************:**:**** ******

A0A0S4MUQ7      SPGTQTYDPTGFVKELKQKILLTEIELSAYEARKKEIEKLIEQLNRKFETIPAKLIDYAR
A0A0N7MUP1      SPGTQSYDPTGFVKELKQKILLTEIELSAYEARKKELDRLIEQLNKKFETIPSKLIDYAR
A0A0P1MWA2      SPGTQTYDPTGFVKELKQKILLTEIELTAYEAKKRELERLIEQLNRKFETIPAKLIDYAR
A0A0S4NBC6      TPGTQTYDPTGFVKELKQKILLTEIELTAYEAKKKELERLINQLNQKFETIPSKLIDYAR
                :****:*********************:****.*.*::.**:***.******:*******

A0A0S4MUQ7      LERARMSAEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGVRPVSPKVHLNLILSIII
A0A0N7MUP1      LERTRLSNEKLYLLIEEKYQEAMIAERSQFGYVQIIDYATPGIKPVSPKVHLNLIIGIVL
A0A0P1MWA2      LERARMSSEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGLKPVSPKIHLNLILSIIV
A0A0S4NBC6      LERARMSSEKLYLLIEEKYQEAMIAEQSQFGYVQIIDYATPGIKPVSPKVHLNLILSVLI
                ***:*:* ******************.***************:.*****:*****:.:::

A0A0S4MUQ7      GLGLGVGIVFVKEYFDRSVKTPEQLEKRGFTVLSAIPVIEIEAKLDGKQLRKDEGRNIAA
A0A0N7MUP1      GLGLGVTIVFVREFFDRTVRSPEQLEKRGFTVLSAIPVIEVEVKLDGKQLKKDEGRNIAA
A0A0P1MWA2      GLGLGVGIVFVKEYFDRTIKTPEQIEKRGFTVLSAIPIIEVETKLDGKQLKKDEGRNIAA
A0A0S4NBC6      GLGLGVMIVFVKEYFDRTIKTPEQIEKKGFTVLSAIPVIEIEAKVDGKQLKKDEGRNIAA
                ****** ****.*:***::.:***:**.*********:**:*.*:*****.*********

A0A0S4MUQ7      HLITHLSPKSPVAEAYRVMRTGIQFAKLDKKIKSIVVASSAPKEGKSTTASNLAITMATA
A0A0N7MUP1      HLITHLNPKSPVAEAYRVLRTGIQFAKLDRKIKSIVVASSAPKEGKSTTSSNLAITMAKA
A0A0P1MWA2      HLITHLSPKSHIAEAYRVLRTGIQFAKLDKKIKSIVVASSAPKEGKSTTASNLAITMASA
A0A0S4NBC6      HLITHLSPKSPVAEAYRVLRTGIQFAKLDRKIKSIVVASGAPKEGKSTTSSNLAITMAKA
                ******.*** :******:**********.*********.*********:********.*

A0A0S4MUQ7      GLKTVLVDTDLRRPVLHRVFNVPREPGLTDYLFDRADVQEIFKQTEVENLYLVPCGVVPP
A0A0N7MUP1      NLKTVLVDADLRRPVLHRVFGVKREPGLTDYLFERAELDEIFRKTDIENLYLIPCGVVPP
A0A0P1MWA2      GLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAEIEEIFKQTEVENLYLVPCGVVPP
A0A0S4NBC6      DLKTVLLDTDLRRPVLHRVFGVKREPGLTDYLFGRAEIDEIFKQTEVENLYLVPCGIVPP
                .*****:*:***********.* ********** **:::***.:*::*****:***:***

A0A0S4MUQ7      NPAELLGSEKMKEFVEYLKLNYDFVVFDTPPLVAVTDALILASQVDSVLLVASAGKTEID
A0A0N7MUP1      NPSELLGSEKMKKFVEYLKSNYDLVVFDTPPLVAVADALILANQVDGVLLVASAGKTEID
A0A0P1MWA2      NPAELLGSEKMKEFIEYLKLNYEMVIFDTPPLVAVTDALIIASQVDGVLLVASAGKTEID
A0A0S4NBC6      NPSELLGSEKMKEFIEYLKSNYDMVIFDTPPLVAVTDALILANQVDGVLLVASAGKTEID
                **:*********:*:**** **::*:*********:****:*.***.*************

A0A0S4MUQ7      VLEKAREMVQRVGGNVIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADRDKSRG--
A0A0N7MUP1      VLDKAREMIQRVEGNVIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADREKGEGNA
A0A0P1MWA2      VLDKAREMIQRVGGTVIGVLLNNFDASSTYGTYYRYYRYYRYYDYYGADRDKGEGKK
A0A0S4NBC6      VIDKAREMIHRVGGNIIGVLLNNFDASATYGTYYRYYRYYRYYDYYGADRDKGEGKS
                *::*****::** *.:***********:**********************:*. *  

© 1998-2019