BYKdb

Dataset for cluster orphancd of phylum candidatus-latescibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1W9RIK7      MVKKDAKTIFEMFDQESPMATEMRRLYTNIRHIHGKKDMRSFLITSSNRGEGKSTIASHL
A0A3A4ZF06      MTDSERKNIYDVFDQESPMATEMRRLYSNIRHHHGRPDMRSFLVTSADRGEGKSTIASHL
                *...: *.*:::***************:**** **. ******:**::************

A0A1W9RIK7      ALTVARFRGKKSLIVDADLRRPRLHRIFDVPKEPGLLECLEGKIDPMDAIQDTKVENLKV
A0A3A4ZF06      ALTVARFKGKKSLIVDADLRRPRLHDVFAVPREPGLLECLEGKIDPLAAVKDTPVENLKV
                *******.***************** :* **.**************: *::** ******

A0A1W9RIK7      IPSGGKISSPAHLFEGDTLSEIIEKIRFYYDIVIIDSAPVIPVSDPMLIANEVDGVILVL
A0A3A4ZF06      IPAGARIKSPAHLFEGDVLSEIFKKIRFYYDIVIVDCAPVIPVSDPMLISSEVDGVILVL
                **:*..*.*********.****::**********:*.************:.*********

A0A1W9RIK7      LAGKTPRNVAIRAKNILIDGNATILGVVVNNLSEVLPYYYDYKYYGYKESEDSNG-----
A0A3A4ZF06      LAGKTPRHVAQRACDILRDANANVIGVVVNNLSEVLPYYYDYKYYGYREHEGEKGGASGA
                *******:** ** :** *.**.::**********************.* *..:*     

A0A1W9RIK7      -------------
A0A3A4ZF06      GNAPAGSGAGGPR
                             

© 1998-2019