BYKdb

Dataset for cluster tadcd of phylum candidatus-latescibacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5ZEN4      ---------MHDEKKDFRVYVDVVYRKKWLILFIFLIVFLAALYFVRKQAPSYSSSSSIY
A0A3D4BE10      MKTRTGDKSLQGTEIRLQDYIGVVYRKKWILMLSFVLVLGIALYDAFTTPPVYISSATVK
A0A1V4R2W1      --------MEEEKQVGLEDYIDIVWRRKWIILLSFVSVLASTTYFTFTRPPTYEAASILM
A0A0S7XD06      ----MFSRDSERKEPSFREYFHILYRNRLLVASIFFLTVAVTTVFSFTTKKVYEARSTIM
A0A1V4RNF1      ------MQEVSEQEVSIHDYLRILYKGRWIIVISFLAVVISTVFFTLRATPIYEAKTTIL
                             :  :  *. :::. . ::   *. ..  :          * : : : 

A0A1V5ZEN4      IESGNPAAMAVALTADAQGK-----RPIEFFMGI----------LESRSFRDAVRDAVRD
A0A3D4BE10      IDTRTLSTRG------DGAMVRAVAQSVDYYDRI----------FRTGIFRN----ELLD
A0A1V4R2W1      VEA----EEGMNLLDPRGSLFGPLAKPVEFFERI----------MESPSYRDQVALKVTE
A0A0S7XD06      VEVGGRAGGIESLFGVRSAMQSSVVNEVILNNQVEILRSRTLAERTISKLRNLPVSDRLE
A0A1V4RNF1      IET-GKTGAAIPLFEAPGFTR----RETMINNQVQILKSRTIAELVLNELRKLSGSQTFA
                ::                       .       :                *.        

A0A1V5ZEN4      HAISRGMPPIQATDLS---REAIESLQIKRSKNEGFYTVIAESESPDIAYATDSLAVSLF
A0A3D4BE10      SLSADEASIIAQNHNLSLENLIEFNLSLNADAVQSFFRITASASNPDLAYRLADVSSHLF
A0A1V4R2W1      RLRNPHGILLPMDEAL---DLVEHNLTLNTSKTSDFLEIKAHADSPLLCYLLAASGTEVL
A0A0S7XD06      LFASEDGKA-SMASLI---ERLSPAVEISPIQNTNIIVVKARAGKPYEASLIANTIVETY
A0A1V4RNF1      IFKTDLGRPWSREDAL---KTLEESIKVTPIRDTDIVEIKCQAPSPEEAVAIANTFAHVY
                                         : :.     .:  : . : .*  .           

A0A1V5ZEN4      MERCILYARQQTNAMTAFVAMQFDSARARLERAEDNLQAFRKQHNLIQAGGGPATDPSLP
A0A3D4BE10      QKRLIDIESESMVESDVYLDEQITLLRNKLETKEIEIQKFTREQHIIPGKPGSVGNTGF-
A0A1V4R2W1      KDRSRGVDKEEAQSVLDFIEDQKIEAQQKLEAAEKKLQLFRERVGIVGNGEEGGALGKL-
A0A0S7XD06      LELNLSWARGEVTEIKSFVEEQLTLVRERLSSAEDKLKRFQESEKVASLSHETEA-----
A0A1V4RNF1      YQQRLQMSREEISETRRFIEDQLAKVREELRASEEALRDFKQKEKVVALPDETKA-----
                 .        .      ::  *    .  *   *  :. *     :              

A0A1V5ZEN4      IDYVRLVEGYYDARQERQTAQAALEAAE--------------------------------
A0A3D4BE10      ---MAFQIKLDEIEVQRELTAIKLRIYRQRQDEISRRQYTYNNVDLLVDQID----QEIR
A0A1V4R2W1      ---IELEKELAGVQAQKELAQANLEAYDLRIA------------QVLPDKTA--GGRETE
A0A0S7XD06      -----AVKKLAEFDALKGQAEVDLESTQRRLTFLETQ--LSDQRKSLVDDIGRVSAPMVT
A0A1V4RNF1      -----LVEQLADFEALYNEAETDLGSSQTRLNYLRKQ--LREQQKDLPEKIAMVSSPLIQ
                                   :   *                                    

A0A1V5ZEN4      ------------------------------------EASRLLRINLDTLATDKLRRALPA
A0A3D4BE10      SIGAKADSLESLQAT-LRNSLDQTHPDVIKINKQIRDI--QFEENEVYARIYQISSPQKR
A0A1V4R2W1      GLSREIATLESIRANLVRQP-GEHHVEVLSLDKKIAEKKKKLVESI--VQDTDVRSSGMQ
A0A0S7XD06      QLRGTLANLEGIRTRYLAQGYPENHEKMKEIERRIEETKGQLVTKTKSALSEEVSLQDPF
A0A1V4RNF1      NFRGEIAKLEGKYANYIAQGISEDNEKVVAIKNRIQEIKNKLKEETRKLLSEKLAPENPL
                                                    :    :  .       .:      

A0A1V5ZEN4      LDLAEAEERTRKARTELQLKELQEQSFLAQLQAYEASHP-GLSDVSIGYLRLVRERDIYV
A0A3D4BE10      NLLPILKAKIDAAEEAMFELTTEAEYYDIKIQEFTPDSNTAFFNNELHLRRLMRSQELYE
A0A1V4R2W1      VEIAQLQERRTAEELNIYVLESQERYYENLIEKFKAEHP-SMLENAIELAQLTRARKVYE
A0A0S7XD06      SYSQELIERILDLEVEVRTLRARVEGFDQLVSQYAVELE-RLPGKALALARLEREREVNE
A0A1V4RNF1      LFSQALVDKILTLEVEVEASSAKASALKRIVDQYAEKLQ-ALPEKSLELARLERTAQVNE
                        .       :             :. :  .    :    :   .* *  .:  

A0A1V5ZEN4      RLSDLLLERREELRVKSASETGGVRVVDAPSEPT-PKPSRAPLILIFAAIIGLSLGAGAA
A0A3D4BE10      TNYNVLIQLNEESQLKKATQSGGVKMIDPAYRPKAPVPSTASRKILFGAILGMSLGLGAV
A0A1V4R2W1      NMYNILLEKGEEAKINASTGTGGVKVVEKAREPDEPVPAHSKRNLVLGAMVGLGLGLGIA
A0A0S7XD06      QILLMLMDRYEEARIKEAGQLGNASVVDRAEEPREPILPRKRRNVLLGSVAGLLLGLLCV
A0A1V4RNF1      KIYIMLMEKSQEARITEAGQIGNVRIIDEAREPKYPIKPKKKLNVILGAVVGLGLGVGIA
                    :*::  :* .:. :   *.. ::: .  *  *  .     :::.:: *: **   .

A0A1V5ZEN4      FLLEAMDTSVRTVNDITEALE-VPTIGTIP----------SIGVTPGGKRRRETERRRV-
A0A3D4BE10      FLLEYMDTSLKSSDEISRFLQ-IPLLGEIPKIDADKPTRKWLRFLPGTIK---SNEEAYD
A0A1V4R2W1      FALEYMDNTIRTAEDLSRTLG-LSVMGTIP----DIQKLENMQRKRSGKKKRKGGGERDD
A0A0S7XD06      FSLERLRDRIADVSDVETATDGIPVLAAIPSATTKRRGFRLLRTRRRVFPFQGSSGEAVP
A0A1V4RNF1      FFLEYIDTSIRTPDEVERFTN-LALLGTIP----------LIKGRDNDKKTRHTEASLIS
                * ** :   :   .::      :. :. **           :                  

A0A1V5ZEN4      --LISDGNPKDPIAEAYRTLRTSLLFS-SGDQPIRSVVVSSAGQAEGKSITVANLAIVCA
A0A3D4BE10      SRIIAHFDPKDPIVESYRNVRTSLLFTFTSGDPLQAFVISSPNPSEGKSLTTSNLATVFA
A0A1V4R2W1      PGLISRYETKDMVVESYRSLRTNLQFA-SVDKPLKSMLISSPGPMEGKTLTVANLGISFA
A0A0S7XD06      KVLLTELSPRSEISESYRTLRTNILFS-QVDKPLRTIVLTSPGPTEGKSTVVANLGFVMA
A0A1V4RNF1      SRLISHLAPKSPASEAYRTLRTNIQFT-KLDRPLQSLLVTSATPGEGKTTTVANLAITMA
                  :::   ...   *:**.:**.: *:   . *:.:.:::*.   ***: ..:**.   *

A0A1V5ZEN4      QMGQRTVILDADLRRPVQHILFELEREEGLTEALVHRRELSEVAKPTSIENLDVVTCGVI
A0A3D4BE10      QSGKKTLIIDTDLRRPVIHKIFRLPKNPGITDVLVGQIHWNEAIRQTDIDNLFVLPSGTS
A0A1V4R2W1      EMDKRTIIVDADLRRPRQHKLFGVGKEPGLTDYLVGTASLEDVILPTEVDHLSLIPAGRG
A0A0S7XD06      QAKNKTVVIDSDLRRPTVSLLLGTPKGAGLTDVLSGKAVLDDVITSTSVDGLFLVGTGTL
A0A1V4RNF1      QMGTKVLLVDTDLRKPMLHQIFGVERDVGLTNVLVGERGLSSVIKPTDIEGLSLISCGPI
                :   ..:::*:***.*    ::   .  *:*: *      ...   *.:: * ::  *  

A0A1V5ZEN4      PPNPATLLGSAAMGERLEELAQHYDIVLIDTPPVIVVTDAVLVARKTDGVLLVVRCNSTP
A0A3D4BE10      PPNPGEMVGSERMTEILDILKEHMDIIILDTPPVVAAIDAAVLGAKTQGIILVLNMEETK
A0A1V4R2W1      SPNTAEMLGSNRMSDLIRKLISEHDIVLFDSPPLVPVTDAALLASKMDGVLLVTKYASTH
A0A0S7XD06      PPNPSEMLGSLRMRQVIAELAAKFEFVLFDSPPVLPISDAAALGARVDGVLMVARCGVTG
A0A1V4RNF1      PPNPSELLGSEKMGQLIEQARREFNFILFDSPPTVAVTDAAVLATLTDGALLVVQSAKVS
                .**.. ::**  * : :       :::::*:** :   **. :.   :* ::* .   . 

A0A1V5ZEN4      REAARHTADTLRTANIPLIGAVLNDVDVTRRYGGYHYYNYYYHYYYGGYYGSSDGSGDTK
A0A3D4BE10      RDSAKFSIDQIERAGGKVLGGLLNNVDVNRRYG---YYYNQYYY----------------
A0A1V4R2W1      KDAVHHALEILEKVGAPTIGAILNDVEVVRRLGYYRYYYNNYYYY---TYHEDEKKEETK
A0A0S7XD06      VAGLSRAISVMRGVHARVIGIILNDLDIRQRLG-EGYYD-YYRSY---SHAQGADEPS--
A0A1V4RNF1      REAVNRAKSVLEGVGARVLGAVLNDFDVESQYGYYSHYY-YYYYY---NYPESGEKKRRR
                  .   : . :  .    :* :**:.::  . *   :*   *                  

A0A1V5ZEN4      TAKT
A0A3D4BE10      ----
A0A1V4R2W1      A---
A0A0S7XD06      ----
A0A1V4RNF1      KARA
                    

© 1998-2019