BYKdb

Dataset for cluster tadcd of phylum candidatus-margulisbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F6QP92      MELLEYWGFFLRRKTVIISIFLLVVIMGILYLSMAKPVYEADCALLVTETKGPGLLGDLE
A0A2W4JTQ5      MELLEYWGFFLRRKTVIISIFLLVVIMGILYLSMAKPVYEADCALLVTETKGPGLLGDLE
                ************************************************************

A0A1F6QP92      VGALLSETIGKSDPIDTQLELVKRRPILSKVIRDTKLVDGRGNPLKIRALREAINVQAIN
A0A2W4JTQ5      VGALLSETIGKSDPIDTQLELVKRRPILSKVIRDTKLVDGRGNPLKIRALREAINVQAIN
                ************************************************************

A0A1F6QP92      NTNLISISYRDHDPIVAREVVNTVALTFAEQNQKLNKEEISSARVFIENQLRTQKEKVIG
A0A2W4JTQ5      NTNLISISYRDHDPIVAREVVNTVALTFAEQNQKLNKEEISSARVFIENQLRTQKEKVIG
                ************************************************************

A0A1F6QP92      AENSVLDFKRKLQTVALEQETTTQLEGLSLVEATKMDLETKLKGSYAQKQQLESKINGKI
A0A2W4JTQ5      AENSVLDFKRKLQTVALEQETTTQLEGLSLVEATKMDLETKLKGSYAQKQQLESKINGKI
                ************************************************************

A0A1F6QP92      AQSSPFYSLWMKSLEDTNNEITNLTAQLANITSEIARITVDLNKLPPKEIELARIVRDEK
A0A2W4JTQ5      AQSSPFYSLWMKSLEDTNNEITNLTAQLANITSEIARITVDLNKLPPKEIELARIVRDEK
                ************************************************************

A0A1F6QP92      LASEVYTRLLGRYEEARINEAGKVANVKIIEPAITPDEPVSPNLKKVILLTLLLGLIAGI
A0A2W4JTQ5      LASEVYTRLLGRYEEARINEAGKVANVKIIEPAITPDEPVSPNLKKVILLTLLLGLIAGI
                ************************************************************

A0A1F6QP92      SVAYLIEYIDDVPGSVEVVKNILPYNTLGMLPNQSNINPLFMINDPRSPLAEAVRLIYTN
A0A2W4JTQ5      SVAYLIEYIDDVPGSVEVVKNILPYNTLGMLPNQSNINPLFMINDPRSPLAEAVRLIYTN
                ************************************************************

A0A1F6QP92      LKFKEIMGKRCITMLVTSALAGEGKTTLSSNLAISLTNMGKKVVMVDIDLRRSRLNKVFN
A0A2W4JTQ5      LKFKEIMGKRCITMLVTSALAGEGKTTLSSNLAISLTNMGKKVVMVDIDLRRSRLNKVFN
                ************************************************************

A0A1F6QP92      MPGNKGVTDYLIGDVEIEDIVVIDPVSGVYIVTAGVIPPNPAELLAGKKIQELIARLREK
A0A2W4JTQ5      MPGNKGVTDYLIGDVEIEDIVVIDPVSGVYIVTAGVIPPNPAELLAGKKIQELITRLREK
                ******************************************************:*****

A0A1F6QP92      FDIVMLDSPPITLVSETLDFARTVDGIIITVDMKNTSLRAIQGMQELLKDKHLPILGMVF
A0A2W4JTQ5      FDIVMLDSPPITLVSETLDFARTVDGIIITVDMKNTSLRAIQGMQELLKDKHLPILGMVF
                ************************************************************

A0A1F6QP92      NKLSVENAGYAYCSYKYKYSY
A0A2W4JTQ5      NKLSVENAGYAYCSYKYKYSY
                *********************

© 1998-2019