BYKdb

Dataset for cluster orphancd of phylum candidatus-marinimicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A359IET8      -------------------------------EQLKQVEERLRVSEDSLRTFQQREGVVNL
A0A3B9KQY2      ALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRVSEDSLRTFQQREGVVNL
                                               *****************************

A0A359IET8      DEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILE
A0A3B9KQY2      DEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKEKELLNNFIQTANPLILE
                ************************************************************

A0A359IET8      LQTKIAKLEASVVEAIAKGIDENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDP
A0A3B9KQY2      LQTKIAKLEASVVEAIAKGIDENAPQIQTIKVQMDKMKERLNQETRMLISRGYIPGPSDP
                ************************************************************

A0A359IET8      LSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNE
A0A3B9KQY2      LSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELEKLPQVIITFTRLERERLVNE
                ************************************************************

A0A359IET8      NIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLGGILGLGLGIGII
A0A3B9KQY2      NIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKKMNVLLGGILGLGLGIGII
                ************************************************************

A0A359IET8      FLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDP
A0A3B9KQY2      FLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSVNNTEVSQYQSRLITHFDP
                ************************************************************

A0A359IET8      KSPVSEAYRSMRTNIELSGVDKSIKSVVITSAGPGEGKSTTIANLAIAFAQMDQKTLLVD
A0A3B9KQY2      KSPVSEAYRSMRTNIELSGVDKSIKSVVITSAGPGEGKSTTISNLAIAFAQMDQKTLLVD
                ******************************************:*****************

A0A359IET8      TDMRRPVLQKVFKVPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGS
A0A3B9KQY2      TDMRRPVLQKVFKVPRVPGIADIITGTNTIEECIHETSVENLYILPSGNLPPNPSEMLGS
                ************************************************************

A0A359IET8      KKMREIYQTLTEQYDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGVTHDEALDQVQNI
A0A3B9KQY2      KKMREIYQTLTEQYDKIFFDAPPIIAVTDASLLAKLCDGLVVVVKSGVTHDEALDQVQNI
                ************************************************************

A0A359IET8      VQQIKLPMLGAVINAITPKHMKGGSYYYYYRYMNYQYK
A0A3B9KQY2      VQQIKLPMLGAVINAITPKHMKGGSYYYYYRYMNYQYK
                **************************************

© 1998-2019