BYKdb

Dataset for cluster tadcd of phylum candidatus-marinimicrobia

[Download (right click)] [Edit] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A101ID17      ------MNQNNHYMPYNEEEEINIKEIFQTLIKGKWIIALSFILVTAVTIWYTFNQTPIY
A0A124FPG2      ------MNQNNHYMPYNEEEEINIKEIFQTLIKGKWIIALSFILVTAVTIWYTFNQTPIY
A0A2D9VF15      --------------MNELETNFNIKELLFFIRRNIKIMMAVFSLIMIFGCAYILKKKPIY
A0A2D7IJL9      MNNQHLDYRSDNANYQTMENELYLKDYVIILRIHLKKIIIIFLIALSLGVYSTFSKIPKY
A0A2E3DVU2      MKNNHLAFKEDNHNYHNIENELYLKDYFLLLRIHLRKLIYCVILFLLIGFYTTINKTPMY
A0A2E5VVQ3      MKNQHLEYKSDNVNYQSMENELYLKDYIIILRIHLKKIILIFFIALLGGIYSTYSKIPRY
A0A2E1Q0C7      -MTTELHNTQNGQQEISQEKSLNLRDYYFIFRTYYKLIVVMTILGLCIGFYSVLTLPPKY
A0A2D8V7U8      --------MNNNINSDFNQKEISLEEIVFSLKKHIKIILFITFFCFFCTLIYVIIQKPRF
A0A2E1NF27      -METNENTRIQNLETDYANKSLSFRDYIFLFRLHSKKIIFLTILSTLISIYKVYITPPSF
A0A2E6SF50      MINRQSGLQSNGQMPNWQDNELTFRDYLFILRLHLKKILLFGLLGLGYSIYHVMTIPPSY
A0A2E0B890      ---------MNNSNQDFHKEEVSIKEIFFIIKSNIKKVYFSLFLFLFIGLIYIVITRPTY
A0A2D7NA59      ------MSEKNKIINSIENYEISYWDIYFILKRHLKLICFSTVLILFLSVIYTLRLAPVY
A0A2E5VWZ7      -MNNQNNLEKNSIQNFSENYTLTLQDYLLIFKIHLKKIIICLIIGFMSSIYYTYTITPTF
A0A2E5JPH8      -MNTSSELHGNHDGQLGQEPELTIHDYWLIINRGRTSIIISTLILLVLSVYYNYSVSPDY
A0A2E6AXM8      -------------MESQATTQYGFYDILYFLKRNYKYIILVTLLSVFIGALITLRTKPVF
A0A2E5GDL9      --------MSNNNIYNNPVVELTLQDYLIIFRIHLKKIIIITLIGMVYGIYHTYTVPPKY
A0A2E5SGC3      --MNDFNENSKSFKNTDSSFDYSLKELYYILKNHAFAMLVTFFIVISIVIYYTLTVKPVY
A0A2E1WWX4      ---------MIENQNSNLESSYTIQEILFLLKKHIKIILAIFFATILLILIYTFSSDYIY
A0A2H0XTF1      -----MEGLNNQSQSDFQGKEVSLQDYLRILYHGRWIIGISFVLVMIITTYITFTAQPQY
A0A2E5XY54      ----MNQTQSNNYSXDNNXIELSLRDYFLILKIHSKKIFFFTLIGLLISIYFVSVKKPEX
A0A2E5U5G7      ------MDKQNQSSFEDSR-EYSISEILFIIRKHYKLSFLIFFITLFFTIYYTLAVKPQY
A0A2E1Q8L9      ---MKELKINYMTNQENKKEDLNIDEIYFLILKHYKILLSSIVSCLVFSFFYILTIDPIY
A0A2E2VWX2      -----------MSXXDNQKXDLTLKEIYFLILXYXKIFXXSIFSCXIISLFYVFTXDPXY
                                         :    :                             

A0A101ID17      EASTQILIGAAGNQTA--AIFDIMTPLGNSQMEINNQVEILKSRSLAENTIKNLMENYSP
A0A124FPG2      EASTQILIGAAGNQTA--AIFDIMTPLGNSQMEINNQVEILKSRSLAENTIKNLMENYSP
A0A2D9VF15      NASGTILIESSNNKS---DVFN-FSHENKI---IEDKIEILKSSTISKRAIKDLISISKN
A0A2D7IJL9      RASATIMVTQKPGSQ---SLQS-FGNSDNNVQIINNKILLLKSRGLLESVVKDYWDSNRR
A0A2E3DVU2      SSKGTMIVRVSPGAN---TVAD-ITKQKNNNQ-IRNKIELLRSRTLAEDVVRSFYDSKRR
A0A2E5VVQ3      RATATVIITQKPGSQ---SLQN-FGNSDNSAQ-INNKILLIKSRALLKLVVQEYWDSNRR
A0A2E1Q0C7      TATSSVAIREKPGAS---MIMD-LTGNRDRNR-MSNEIQLIKSRSVAKGTIESIWDQKK-
A0A2D8V7U8      ESTSLILIEDPSASAM--DIFD-AGVKTNKNY-IENEKEILKSRTIYEKSIRTLLESDVK
A0A2E1NF27      TAKATIVIREKPETN---LIMD-MTGNRDRNR-IENEIQLIKSKTVAKAVIKKIWEVKR-
A0A2E6SF50      TAIATVVVQDKPGAG---MIMD-ITGNRDRNR-MTNEMQLIRSRSVAKATIKEIWRYKK-
A0A2E0B890      SSYGAIIVESEDSAMS--SIFD-MELGSAKNY-LENEIELLKSRTTAERTIQSLLNSNQI
A0A2D7NA59      SSTGVILIEDPSSRV---NIFD-MGVGSDKNL-LENEIEILNSHTTAESVVNRLLNSNHK
A0A2E5VWZ7      QSTSKIEVREKPGAN---MIMD-ISGRAKIDK-MTNEIQIIKSRVLAKRIVKRLWESNRR
A0A2E5JPH8      TATSTLLIKSESDAS---AIFD-FGGRMSQSE-LANQIELVQSRQVATNTIKTLWNSKHR
A0A2E6AXM8      TSFSEIEIVEDDNS-GFGKMSG-FEAFVDQRS-LSDKIRNIGLRPIAEKTIDKLIKPVNS
A0A2E5GDL9      QSTATVMIREKPGA----NMMN-FGGNSSKNR-MVNEIQLIKSRALAKSVVKELWNSSRR
A0A2E5SGC3      ESSSTVMVRQDQKSMSIFSMLD-MGLTKDRNY-IENEIEVLKSSTTLDVVVNRLFESKYK
A0A2E1WWX4      KSSSTIIVNKDPNS-L--SILN-MGYSGERNF-IDNEIGILRSRTTSEKVIKRLLDSD-N
A0A2H0XTF1      QSTTLLSLAGRAGQTS--TLFS-NPFMPTNMMKVNNEIEVLKSNALSRRVIAALRQSPYA
A0A2E5XY54      TAVVTVAVKDKPGA-G--MVMD-MTGNRDRDR-MINEIQLIKSRRVVKATIKEIWPNK-K
A0A2E5U5G7      RSTSMIMVNEDQKS-R--SMLN-MGLDANRNF-ISNEIQVLKSRTTSQLTIEKLLDSEYR
A0A2E1Q8L9      ESQGSILIEDPQNDVS--NIFD-VGLSKTKNF-IYNETEILRSRTNSEEVIKQIYNSG--
A0A2E2VWX2      ESYGSILIEDPQNDVS--NIFQ-VGLGKTXNF-LENETEILNSRTNSEEVIKQIYXSG--
                 :   : :           :             : ::   :         :         

A0A101ID17      ------------------------------------------------------------
A0A124FPG2      ------------------------------------------------------------
A0A2D9VF15      ------------------------------------------------------------
A0A2D7IJL9      ------------------------------------------------------------
A0A2E3DVU2      ------------------------------------------------------------
A0A2E5VVQ3      ------------------------------------------------------------
A0A2E1Q0C7      ------------------------------------------------------------
A0A2D8V7U8      ------------------------------------------------------------
A0A2E1NF27      ------------------------------------------------------------
A0A2E6SF50      ------------------------------------------------------------
A0A2E0B890      ------------------------------------------------------------
A0A2D7NA59      ------------------------------------------------------------
A0A2E5VWZ7      ------------------------------------------------------------
A0A2E5JPH8      ------------------------------------------------------------
A0A2E6AXM8      VFLTKDNKLLYNYNYDKIDTLYFTYNGESKKIKINVTQGCGVLYEDVRVPLGIKKVDTND
A0A2E5GDL9      ------------------------------------------------------------
A0A2E5SGC3      ------------------------------------------------------------
A0A2E1WWX4      ------------------------------------------------------------
A0A2H0XTF1      ------------------------------------------------------------
A0A2E5XY54      ------------------------------------------------------------
A0A2E5U5G7      ------------------------------------------------------------
A0A2E1Q8L9      ------------------------------------------------------------
A0A2E2VWX2      ------------------------------------------------------------
                                                                            

A0A101ID17      ----------------------------------DSLYILGKGQEEKMESTLNRVKN---
A0A124FPG2      ----------------------------------DSLYILGKGQEEKMESTLNRVKN---
A0A2D9VF15      ----------------------------------EKLYALGNKVYKPEGFYRKAFEYLST
A0A2D7IJL9      ----------------------------------NNMFLFNTRKFFPKGQAIRTLLK---
A0A2E3DVU2      ----------------------------------NNLFLFGTRKYYPKGQRIRTLFK---
A0A2E5VVQ3      ----------------------------------NNMFLFSTRNFYPKGQTIRTIVK---
A0A2E1Q0C7      ----------------------------------NNLALFDSYPFYPRGKRVRVLLK---
A0A2D8V7U8      ----------------------------------NNLFLFGTREYNHPF-----------
A0A2E1NF27      ----------------------------------NNLDLFNSYPYYPGGRELRKSLK---
A0A2E6SF50      ----------------------------------NNLALFGSYPFYPRGKRLRQFTK---
A0A2E0B890      ----------------------------------NNLHLFNTKKHED------GFLR---
A0A2D7NA59      ----------------------------------DNLYFFGTRKYTPVGLS---------
A0A2E5VWZ7      ----------------------------------NNLHLFGTRIHYPKGQSVRQLVK---
A0A2E5JPH8      ----------------------------------NNLSVFGTRKFLPRGQRPRRFIN---
A0A2E6AXM8      VLVLSDNSLNNNFKISDTLIPDGEYHNGCDLPDFRQMYLLNTKKYKYFGLRKTFKNIITM
A0A2E5GDL9      ----------------------------------NNLHVFGTRKFYPRGQRPRVIIK---
A0A2E5SGC3      ----------------------------------NDLFLFGTKKYEP------SWIR---
A0A2E1WWX4      ----------------------------------IDLHLFGKKNNNK-------------
A0A2H0XTF1      ----------------------------------DTLYILGTRHYQQKGIDFKKVFKPLI
A0A2E5XY54      ----------------------------------NNLALFGSYPFYPRGRRVRTFXK---
A0A2E5U5G7      ----------------------------------NDLYILGTKKYEP------NFYR---
A0A2E1Q8L9      ----------------------------------QKLYILQNREDKK------GLIK---
A0A2E2VWX2      ----------------------------------EKFFILQXXQVNH------SFIX---
                                                    :  :                    

A0A101ID17      ----WILFLGN----------------RGTEDEELISSREDTIRSLAYTLQEAITITPER
A0A124FPG2      ----WILFLGN----------------RGTEDEELISSREDTIRSLAYTLQEAITITPER
A0A2D9VF15      LG--GVLDSKEEDISLNYNSESTIL---------YLAK----------KLRQSIKIENIR
A0A2D7IJL9      ----EIFTLGL------YDAEKFKE--TKVLDGFYKEE---IGQKYAKVLQRNLSVGRKG
A0A2E3DVU2      ----EIFTLGL------YDAQDALK--VSTLEGPLTYE---RLDDFSKRIKNHLTVKHIP
A0A2E5VVQ3      ----ELFTLGL------YDAEESKK--TKILEGPYTEE---IGEKYAKRIQNNLSAGRQG
A0A2E1Q0C7      ----ELFSMGL------YDSKSNGP--AKYTED-YNDE---IGERFADRLLAGLSTKHRQ
A0A2D8V7U8      ----NFIPSFL------YKKPDYRYIDNTLNETEFLSA--------VKKLKDKTTIVNKN
A0A2E1NF27      ----KLFTLGL------YDPKLDKP--INYGDQLYTDQ---IGERFSDKLLLRLKISPRP
A0A2E6SF50      ----EILTLGL------YDPSTDLP--LRYNEE-YSDK---IGERFAENLIARLKVNHRQ
A0A2E0B890      ----EFFRNIL---FLDLNKNPEILINNEVNDS-LFNV-------FVKKIRNNISISNLR
A0A2D7NA59      ----KLLDSFFSINGEEYEKNEFLIS-DSLVNQ-LTLD-----------LQQNISVNSQR
A0A2E5VWZ7      ----EFFSLGL------YDENSFKP--KEYNEP-YSEN---IGEKFSGKVLSGLKVNNIK
A0A2E5JPH8      ----EIITFGM------YDPESNKP--KKYDKE-YSEE---FCRRFVIKIKKSMEVKSKR
A0A2E6AXM8      FGLFPIIDKNDD-----FSRNESFS--DGEIRF-FVKK-----------LQESLFIEPVK
A0A2E5GDL9      ----ELFTLGL------YDPDSDMP--IQYNQP-YSES---IGDQFAGNILSGLNVNNRR
A0A2E5SGC3      ----AFLTFGIDSFASDFELGEELN--DSLKII-FSDR-----------LLNSLDVLNKR
A0A2E1WWX4      ----SFFNSTD------NNNDFQALSKEDFVNK-YANK-----------LKKSVYISNNK
A0A2H0XTF1      FGLEAIFQNIP------FDTSTSLV--DTLDRA-LVRA-----------LQASMKVEPIR
A0A2E5XY54      ----EFFTLGI------YNSNMEEP--VKYSMK-YNDX---IGERFVGXLIQNLKATPRK
A0A2E5U5G7      ----TILTFGL------LDNSQNIV--DVDSEI-FAESSDAWIDFCTKELMKSISVKNEK
A0A2E1Q8L9      ----SFFNKQY------YIDDMVLT--DSLLLE-FSNY-----------LRKSMKIENTI
A0A2E2VWX2      ----SXINKHY------XIENMVLT--XSLLSE-FSEY-----------LXKSMRIEXSN
                      :                                          :          

A0A101ID17      NTQTIRISIKSPDPKEAALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRV
A0A124FPG2      NTQTIRISIKSPDPKEAALIANTFAYEYYKQDLERSRGAMSEVKSFILEQLKQVEERLRV
A0A2D9VF15      KTNILNISVNSLSPTEAALIVNTFIDAYIDQEKKWANQEINQSITFLESQIEKKELELEE
A0A2D7IJL9      GTNMIWINYESENADEARRIVNTIVRRFEQKDKEWTNKYAINSISFLDSLVNIQEKKIEN
A0A2E3DVU2      NTNLIEVSYRSKNADEARRIVNRTMGIFSVKDKEWSNQYALNSVSFLDSLVNVQEKILQN
A0A2E5VVQ3      GTNMISVTYVSKNADEARRIVNSIVKQFEIKDKEWTNKYATNSVAFLDSLVTLQEKKIEN
A0A2E1Q0C7      GTDVIDISYTSVWPHEAQLIINNLVKVYKKFEMEISGEYAGNTVNFLEKILSDHDTKLER
A0A2D8V7U8      KTDIIKVTVNSIDPDESALLANTIVNVYQGTDLEWSTGEMTSLKSFLDSQITIKENELNI
A0A2E1NF27      RSDIIDISYTSVWPIEAQLIINTIANTYKDFDKNLSGEEASKTLKFLEKLVQNIEQELYK
A0A2E6SF50      GTNIIDISYTSVWPMEAQLIVNTVADVYQDLDQKWSGEKANNSVQFLDELVKNQEKKLRD
A0A2E0B890      NTDVLKISYSSPDPYEAALIVNTLINEYQRRDKEWASGEMNHLKNFLFEQVVLKEKELKE
A0A2D7NA59      NTDVLKISITSIDPNEAALLVNTLIDEYKNIDLKWANGEMSHLKSFLLEQIEKKEIELTE
A0A2E5VWZ7      NTNILKITFSSPNADEARRIANLVANTYIDFDRERSRENARRSVAFLDSLVYSKREEIEI
A0A2E5JPH8      GTDILILSSTLPFPEEAALVANTVAEEFAKLDARWGAEHTHNLLSFLESQIVIKENELAV
A0A2E6AXM8      ETSHLVITVKSFSPSEAADLANCVIDSYIEEEIKIANKRTSAQIKFLKKDIKLNSDILKE
A0A2E5GDL9      NTDILEITITSVNADESSRIANSIASNYVRLSKIWNSEQAMQSVEFLESLVSMQEEKLNT
A0A2E5SGC3      NTDAIKITVKSKSPIESKLIANVLIDVYRERDLNWLTAEMGHLKNFLSSQLKQKEKELNQ
A0A2E1WWX4      RTDAINISIESKDPEEAAMLVNTLIDVYRERDLEWATGEMSHLKTFLLNQLSKKQKELNE
A0A2H0XTF1      ETEAVRLTVTSASPIEAAFLANMIAREYYRLDIEFNLGEVVEVKNFLEEQLVDIEKDLTA
A0A2E5XY54      GTDIXDISYTSVWPAEAKLIVNTIAEKYEEFEHMLGSEQAASSLKFLEKLVKDQENDLIN
A0A2E5U5G7      NTDVLSISITSLSPFESSLLVNTLIDIYKKRDIEWVTGEMSHLKHFLVDQLSEKEIELNQ
A0A2E1Q8L9      DTDVLNLSIQSKNPEEASLLVNKIIEVYKQRDLNWVTGEMQHLKQFLNEQLAIKEVDLNN
A0A2E2VWX2      ETDVLKISIQSKNPEEAALLVNTIIDVYKQSDLXWATGXMQHLXQFLKEQLSIKEIELNX
                 :.   :.     . *:  : *     :   .             *: . :      :  

A0A101ID17      SEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKE
A0A124FPG2      SEDSLRTFQQREGVVNLDEASKNLLDQLSNFESEYYSAMAELEINEQQLKYLTRELDIKE
A0A2D9VF15      IENQIKTFQISNEIYNIGETSKLLLEQFLDIESKL-------------------------
A0A2D7IJL9      AENKKMEFMLEHDLFSMEANSDVIISQINDYEMKLYDIETEISIQQKQMDVLKSKFSKQE
A0A2E3DVU2      TDSLKMDFLLENKLHSMEAKSDDIIKRINGYEGELYNIKTQKSINKQKIEFLSSKLSSEE
A0A2E5VVQ3      SENEKMKFMLENNLYSMEAKSSVIISQINAYELDLYDIETELSIQQKQIDLLKSKFSNQE
A0A2E1Q0C7      SEKEFTNFKNQERMYDLDGTALMVTTQVANIESEIYNAVSEINIRSEKYNLLKSKLSSDE
A0A2D8V7U8      SAQELKKFQEEEKIFSIDDNSSLLLTSLLNIESEYYKYKAEGNILKERISYIEDQLTSEE
A0A2E1NF27      SEKELTEFKKKEKMYDLNGPAIDISAQIAAIEIEIYNASSEKQLKQEKYSILKSKLSKEE
A0A2E6SF50      SEKALTQFKKQERMYDLDGKAIAITGQISSVETEIYNTASEINIRKEKYNHLKSKLSQDE
A0A2E0B890      IEEKLKLFQEKEHIYGLDDNSNLLLNQLTTVESDYYNTKAKKNISLERKKYFQNQLSKDE
A0A2D7NA59      FENSLKQYQEKEKIFGMSEMSNLLLNNLINSESQLYKSKAEYNILQERINYIKNLLTDEE
A0A2E5VWZ7      IEKEIREFKLNNNMYGLDGDASSISLQLNNYESDLYTIQAEINIRKEKVEILNSRLTKEE
A0A2E5JPH8      AEELVKDFMEAEKIFDLTGNAELIMMQSTDVESKFYETAAEININEENILYLQEKLSKEE
A0A2E6AXM8      IEDKIQDFQQEEDILSVDGNVDEHVGQFLKLKSDRV------------------------
A0A2E5GDL9      SELEIKNFKINNKMYSFSGSNTSVTDQLAVLDSELLNILSEINIRKEKISLLNSKLSEKE
A0A2E5SGC3      IEEKLKKFQEEKKIFGLEDNSKLILENLTDIESRYNNILAMIDINSHKIKHINDLLTIDE
A0A2E1WWX4      IENLLKSFQEKEKIFTIDDNSKIILDNLTLFETEYNNVLASIDIINEKEKFITGQLNSDE
A0A2H0XTF1      SEEALKDFQKREGVFGLDETAQTLIDQLSTFEATYYTSLAELEVSKKKWDNQQKMLTDRE
A0A2E5XY54      SEIKLTEFKKKERMYDLDGSALNLVSQISNVESEVYNFESEINIKQQKYNIGKSRLSAEE
A0A2E5U5G7      IENKLKEFQESEKIFSLDDNSKLILENLTQFETQYNNILAEINIIEEREKYLNAELTADE
A0A2E1Q8L9      IEEKLKNFQENEKVFSISDNYSLLLGELSELESKYYNFEAEINILKSRKEFMYNQLSKDE
A0A2E2VWX2      IEXKLKDFQENQKVFSISXNYTLLLKELXNLESNYYNFEAEINILESRKKFMYDQLSKDE
                       :     :  .              .                            

A0A101ID17      KELLNNFIQTANPLILELQTKIAKLEASVVEAIAK-GIDENAPQIQTIKVQMDKMKERLN
A0A124FPG2      KELLNNFIQTANPLILELQTKIAKLEASVVEAIAK-GIDENAPQIQTIKVQMDKMKERLN
A0A2D9VF15      -----------------IQEKINYEDAVNLKNSYLQEESAKNEVSSTRKLELKELKREVN
A0A2D7IJL9      LNLTSSLMDNINIQLSSLRNEVGRIESQIALNSGIYG--DTHGSVIALNEKHSLIKEEIN
A0A2E3DVU2      KDLADKIVGNINIQLSALRDEAAKLESQIITNSSIYG--ETHEFVQDLKKKLNNLTVAID
A0A2E5VVQ3      LNLTSQLMNNINIQLSSLRNEVGNIESKIALNSGIYG--NDHGSVIELYGKLNLIKAEIN
A0A2E1Q0C7      KILADRLLNNINVQVLSLRGELGKIESLLIQNIAQHG--ENHGAVRDLKKKLEGIKEQLS
A0A2D8V7U8      KKMVNNVTNTINNRLFALKNELALKETELISAISQQG--EDHQIVKNIERKLESLKERLK
A0A2E1NF27      KNLANKILNTIDAQVVYLRDDIGSLEGQLIQNIALYG--EGHSAIKSIKSRIDILKVQLN
A0A2E6SF50      KNLAEQLMNNINIQVISLRNEISQLEANLIQNIAQYG--EEHGAVMELKSKMQGLKSQLN
A0A2E0B890      KEFANRVSNTLDVQLYSFRQELASLEAEYNSTKAREG--STHPAVIDLDKKIKNLKILLN
A0A2D7NA59      KLLSEKVINTINERLFTLKNEIAIKEAELVSTIVQQG--ENHNIVQVLTEKLDRLKLNLQ
A0A2E5VWZ7      KSLTGQIINDINSQLINLRLEIGRLESQLLQNKNKYG--SSHDAVIGLTNKIDRLKGELD
A0A2E5JPH8      KQLADQLLNSLNSKLFALRQEIGQREAEQIRNEGLYG--SQHDAVISTRKRISTLKGQLD
A0A2E6AXM8      ---------TQKLKLKDLIYSKQIFEDEIIKQDIPKS-----------------------
A0A2E5GDL9      KNLADQLVNNINTQLISLRVEIGDLDSKLMQNTALYG--ENHAAVKELKAKIGGLKDRLN
A0A2E5SGC3      KEFSESVTNTINDRLFALKNELALSEAELVSLETQYG--KNHAALELLNNKIEILKSNLK
A0A2E1WWX4      KLLAKKVSNTINQRLQAFKVEMAVIESELISTQTKYG--NNHSAVLELENKLENVKSKIE
A0A2H0XTF1      QMVLKDAVNTTNPLISQLRQAIAEIEAQKITAMAVQGYKTGDAAIRELDGRIQELKIKLY
A0A2E5XY54      KSLTDQLLNNINIQVLSLRGEIAVLESSIIQNEVQYG--KNHVAVIELNNRLLSLKKQLI
A0A2E5U5G7      KGLVNRVSNTINNRLFALKNEIDINESELISTITQYG--ENHSAVISLKNKINKLRTQLG
A0A2E1Q8L9      KNLAQSLSNAINARLDALRNEIATKEAELIKTVNQRG--ENHEAVSFIKEKIGRLKKKLK
A0A2E2VWX2      KNLAKSLAXTMNARLDALRSEIAXXEAELIKTVNQRG--ETHEAVXSIKDKIERLKXKXQ
                                 :       :                                  

A0A101ID17      QETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELEKL
A0A124FPG2      QETRMLISRGYIPGPSDPLSINQSMLEDVIKLRIGQILLQSKAREFKKLVDHYSKELEKL
A0A2D9VF15      ANQKIISERILN--IKEELLIKQ-------------------------------NALNHL
A0A2D7IJL9      KKASLLIEKGIT--TNDPLLMRNDQISQILALENSMMALKLNKDQNEKMLDLFKNKLNSI
A0A2E3DVU2      ERVTKLALKGIA--PQDPLRERQEIISEILNLENNIYYLNITENETQKELDRFNEKLRSI
A0A2E5VVQ3      KKVDMLIAKGIA--VDDPLLVRQEQISQILSLEGSMTALKLSRDQKVKMLNSFKNKLNSI
A0A2E1Q0C7      LKIKELTKLGMV--VQDPLLARQNIVTELITLDTEIVAYELKKNESKNLLKIYLEKLKDL
A0A2D8V7U8      LETRKLVSQGIA--VADPINYRQSLMDSVISISAIYATIEAKSSEYEKLVNQYESQLVVL
A0A2E1NF27      NKVNELTEQGIV--VQDPLQSRQEIVTQLISLDNEIVALKLKKKQSEELKTIFQDKLNQL
A0A2E6SF50      TKVKELTQQGII--VQDPLKARQDIVTELISLDSEIMGYRLKKKESERLLSLYEEKLDLL
A0A2E0B890      TETRKYVNQGII--VANPIESRQAIMDSVINLDAFISAYNSKLLELDKLISNYESQLSLL
A0A2D7NA59      KETRVLISQGIS--VADPIKYRQSLMDSVISITAVSAVYESKIKEFDNLVENYELQLGEL
A0A2E5VWZ7      TKVSILISKGIT--VQDPLQNRQEIISQLLNLDSEIISYQLRESEIKKMLNHFTQKLNDL
A0A2E5JPH8      QEIQSLISRGVA--VADPIEYRQTLIGELLKSQATLAGYKAKADQYRKLMNHYNLQIEKL
A0A2E6AXM8      --------------------YELSVKDTLRSLNINIELVNNRIENIAQEISSYQEFLDDL
A0A2E5GDL9      LKVADLIAKGVT--VQDPLVARQEIITELLKLDSDILGLEIKMAETKRIQKLFINKLDDL
A0A2E5SGC3      DETRVLISQGVA--VANPIDYRQGLMDSVIHFKTIKGILESKAISYKKLVDSYDAKLSSL
A0A2E1WWX4      DETRNLINEGIT--VADPILYRQTLMDSVISIKAVKANLLSKAKAYQNLVDDYDNKLSML
A0A2H0XTF1      KEAENLTNLGLS--PEEQSTISADLLRSVLFTSVEKIALEAKCSEYKDLVNQYAAKLNKL
A0A2E5XY54      EKVNKXVAQGIT--SEDPLKSRQXIVLELIALDSEIIGLNLRKKEADKLLNILNTKLNEL
A0A2E5U5G7      DETKSLIENGIS--SADPILYRQTLMDSVISIKAIKANLNSKSISYKEIVDLYDKKLSDL
A0A2E1Q8L9      EETNDFINNGIS--VSDPLLYRQEIMDSLIKVESIIPNLQSKKNEYKNLIDEYEKQLSNL
A0A2E2VWX2      IETNDLISKGIS--VSDPXLYRQEVMDSLIKVESIIPNLESKKYEYKNLIDEYEKQLSXL
                                                                        :  :

A0A101ID17      PQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKK
A0A124FPG2      PQVIITFTRLERERLVNENIYMLMKNKYEESRITEASQISNVYVIDQSVPPKYPVSPKKK
A0A2D9VF15      PEETIELMRLERIKNISEQTFRLMMQKLDESKIMFESQTGDAKVVDYAYPNINRVSPKVR
A0A2D7IJL9      PETNIIMERMNREDEILNEHYLQLVNTLETTKMNNVIEKGDVQIVDLAKKPSRPFTPNHQ
A0A2E3DVU2      PETKMQMDRFERQEMILRDYYLALINKLEETKLNNAILVGDVRIVDLAKLPKIPYSPNHQ
A0A2E5VVQ3      PETDMILERLNRQDEILNEHYQQLVQTLETTKMNNVIEKGDVQIVDLAKKPSRPFSPNHQ
A0A2E1Q0C7      PEKQLQFSKLQRNSIILNENYSLLRKQLEEAKINLAVQVGKVHIVDYARLPFVS-GQNNN
A0A2D8V7U8      PEKLLEFSRLKRNLNIDTETYSLMRSKIEEAKINEASKISKVRVIDKANPDYERVTPKRK
A0A2E1NF27      PPKQLEFSRLQRNNIVLNQNYSLLRQKLEEAKINIFSKFGKVQIVDYASVP-EKFESNHT
A0A2E6SF50      PSKQLEFSRLQRNNIVLNQNYSLLRQKLEEAKINVASQVGKVQIVDYSRLP-GSTGQNHK
A0A2E0B890      PEKYLAYTRFQRDKIILDETYSLMKQKLEEAKINEASQLGKIRIVDSAVENVRKTAPKRK
A0A2D7NA59      PEKVLKYTRLERNLNIHAETYSLMRQKLEEARINEASKVGKVRIIDKARPDYNRIKPKNK
A0A2E5VWZ7      PEKQMDLTKLVRDADILKQNYLFLKQKLEDAELNVAIEVGDVFLLDKARRPSSPIGPNHN
A0A2E5JPH8      PKKQMEFARLERDRSVLNTTYMFMRQKLEEARVNVASEGGKIQIIDRAHIPGRASSPDKG
A0A2E6AXM8      PRKTREFNNLKERKIEISTENIFLTEKLKNAELIYNSAQPGLTIRVDAKEDFERLKPSVF
A0A2E5GDL9      PQKQLELALLQRGSDILNQHYSHIRQKLEEARLNVAIEVGNAQFVDSALKPNKPSSPNHR
A0A2E5SGC3      PEKMLEYARLERQRVIQAETFSFMSTKLEEARIGEASKLGKIRIIDHAIVDSKPISPNKL
A0A2E1WWX4      PEKILEYTRLERDRAIHAETYRFMSQKLEEARIGEASKLSKIRIVDKAIANKIPIKPNKS
A0A2H0XTF1      PESSLEYARLDRERQVNEKYFILMKTKHQESRITEASKISNIRIVDPAVPPEKPVKPKKK
A0A2E5XY54      PPKQLKFSKMQRDISVLNQSYALLRQKLEEAKINVASQIGRVQIVDYAKEPINSAKDSKR
A0A2E5U5G7      PDKALKLTQLERDRSILSQTYSFMKSKLEEARIGEASKLGKIRILDKAISNSKPIKPNKI
A0A2E1Q8L9      PQKVLEYTRLERIRNIQSETYSFMRQKLEEARINEASKIGKIRVVDSAIPNYIPIKPNKK
A0A2E2VWX2      PEKVLEYTRLERIRNIQSETYSFMXQKLEEARINEASKIGKIRVVDSAIPEYIPXKPNKK
                *        :             :    . : :          .   :         .  

A0A101ID17      MNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSV
A0A124FPG2      MNVLLGGILGLGLGIGIIFLKEFLDNTIKTKEDLVKKGITTLAVIPEIDEMKTAKKARSV
A0A2D9VF15      KEMMLCIMLGLIAAFSIALFIEQFNTSIKSLEDLEKYGLNVLAIIPSIKNRKKHKKIRKT
A0A2D7IJL9      KDIIIFCFFGLGIAIVIVFLIEFIDNTIKTIDEIEKYDKSVIGVIPAIGKISSRGIISRY
A0A2E3DVU2      KDILMFLFFGIAIGLFIIFVIEVLDSSIKTIDEIEKYDKNVIGVIPAIGKMKSQNFIMRY
A0A2E5VVQ3      RDIITFCFFGIGFALVIVFLIEFVDNTIKTIDEIEKYDKSVIGVIPAIGKVSSQGLLNKY
A0A2E1Q0C7      RTLLLGLFLGLSLGIIMALALEVMDNTIKTTYDIERKNLAVLGIIPSIGEEQKNKKSYFF
A0A2D8V7U8      LSLLIGLIFGGILGVVAAFIIEILDGTIKSIEDIEKRGLTILALIPSIGLHDKKRKNKLK
A0A2E1NF27      RTILFGLFLGIGISFCLIMLIEVIDNTIKTNYDIENNNLSVLGIIPSIETDESLSSFRFL
A0A2E6SF50      RTILMGLIFGLGLGIFLAFGLEFLDNTIKTPHDIERKSLSVLGIIPSIG-KEIVNKQRFF
A0A2E0B890      FILLISLLFGTIFSVGFILLTEFLDSTIKSIEEIERRGLPILAIIPSIGSQINQRIKKKG
A0A2D7NA59      VNVLIGLMLGLGVGIGISFLLEYADNTIKSIDEIDKRGLSILALIPSIG-KKINNKREHS
A0A2E5VWZ7      RNIILGIFLGLSFGVLLVFMIEFLDNSLKTVDEIEKYALTVLGIIPAIG-NTQQNSKKDF
A0A2E5JPH8      RNMLLGLILGMGFGVGIVFLREYLDRTIQSIEWIERFGVSVLGVIPVVTGMGSNQKSKKG
A0A2E6AXM8      ENLLLSFTVGIIIGILGLFTIEYFNNSIKTIEDLERYGLNVLAIIPS---IGKKNKSTKG
A0A2E5GDL9      KNIIIGFSIGLGISVILSLLIEFLDNTLKTVDDIERHDLTVLGIIPSIGGESSKNSKGWS
A0A2E5SGC3      MNLISGILFAIACSVAIAFLIDYSDQTIKSIELIEKKGIPILSMVPDLTNLNVHGKSRKN
A0A2E1WWX4      QNIIFSIILGIVLGIGASMVMEFFDNTIKSIEQIERRGLAILSMIPAI--SSKNNRNKNS
A0A2H0XTF1      MNMLLGLFLGLGLGVGIAFVRDYLDHSIKNAEDLQKLGLATVSIIPK---IDVKSATEKS
A0A2E5XY54      I-IIMGLIFGXGFGVALAFSLEFLDNSIKTVDEINKLNLSVLGIIPSIG-DDNKKALFNF
A0A2E5U5G7      KNIFLGVILGCILGLGIPLLIEFFDNTIRSIEQLERRGLSVLSIIPDIM-ISSNKKNKNN
A0A2E1Q8L9      LYILLSLVLGLALGIFIIGIKEFFDNTIKSVEQIERRGFSLLAVIPS---IGKKSSKKRT
A0A2E2VWX2      LYVLLSLVLGTIXGIAIIGIKEFFDNTIKSIEQIERRGFSXLAVIPS---IGKKTDKRKT
                  ::    ..   ..      :  : ::..   : .     :.::*              

A0A101ID17      --------NNTEVSQYQSRLITHFDPKSPVSEAYRSMRTNIELSGVDK-SIKSVVITSAG
A0A124FPG2      --------NNTEVSQYQSRLITHFDPKSPVSEAYRSMRTNIELSGVDK-SIKSVVITSAG
A0A2D9VF15      ---------LKEENKIERHLITLEDPKSPISEAYRTLRTSIMYSDTN--TNKTILVSSPG
A0A2D7IJL9      -LESKSFTVLGGEKGIKRKIITRDNPKSPISESYRGLRTNILLTNTK--DIKSILVSSAG
A0A2E3DVU2      -FDDKTVNILGGEKGIKRKIITKDNPKSPISESYRGLRTNILLSNDK--EIKSMLVSSAG
A0A2E5VVQ3      -LENKTFTALGGEKGIKRKIITRDNPKSPISESYRGLRTNILLSNTK--DIKSILVSSAG
A0A2E1Q0C7      ------NKSNKSSSNLKRRLITQDDPKSPVSEAYRALRTSMLYTSADK-KIKSILVSSAG
A0A2D8V7U8      -------NSIDNAKKIQRRLITYEDPKSPVSESYRTLRTGLLYANSKK-AGNVILVSSPG
A0A2E1NF27      RFLKK-NSSNNSNRGIKRRLMTREDPRSPISEAYRSLRTSMLYTGVES-EVKSILVSSAG
A0A2E6SF50      SFKSGLLSRSKTSHGLKRRLITREDPRSPVSEAYRSLRTSLLYTSADK-KIKSILISSAG
A0A2E0B890      ---YRLNLKISNSEKIERRLLTHEDPKSPISESYRSLRTSLMYDNNEQ-DSKIILVSSPG
A0A2D7NA59      ---KNLSKKIGNIEKIQRRLITHEDPKSPISEAYRSLRTSLMYSKESLNHAKIILVSSPG
A0A2E5VWZ7      LFWKNKLLTNQNTNTLKRRLITREDPKSPVSEAYRSLRTSMLYSSTN--KVKSVLVSSAG
A0A2E5JPH8      -----KKDSASGSKNVQRRLITREDPKSPISESYRTLRTNILYSQADK-KIKSILVSSPS
A0A2E6AXM8      -------------KNIERTLITREDPKSPISEAYRTLRTSIMYSSENKKDAKIVMVSSPG
A0A2E5GDL9      FFGKSILSSKGNSHGLRRRLITKEDPKSPVSESYRSLRTSMLYSTTNK-KIKSILISSAG
A0A2E5SGC3      ---IEQLKAYITDNQIERKLIAYEDPKSPVSEAYRSLRTSLLYTSNKDMKGQCVLLSSCG
A0A2E1WWX4      ---KRYVKNDGQVEQLQRRLITHEDPKSPISEAYRSLRTSLMYTKSNS-ESNVILVSSPG
A0A2H0XTF1      ---LKVFKGENLEHSLKSRLVTHYDPKSSVAEAYRTLRTNIQFMNPDN-PIRTLVVSSAG
A0A2E5XY54      ---RKKFGNSNSSKGLKRRLMTREDPKSPVSEAYRGLRTSMLYSSTKS-EPKSILVSSAG
A0A2E5U5G7      ---KKYLNRNMDVLKLQRRLITHEDPKSPVSEAYRSLRTSLMYTESES-NCQILLVSSAG
A0A2E1Q8L9      ---KQYISQNKNLDKIERRLITHEDPKSPISEAYRGLRTSLMYTNVDE-NCRVILVSSAG
A0A2E2VWX2      ---KRYISQNKNLEKIERRLITHEDPKSPISEAYRGLRTSLMYTKVND-NCRVILVSSAG
                                   :::  :*.*.::*:** :**.:     .    . ::::* .

A0A101ID17      PGEGKSTTIANLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGT-NTIEE
A0A124FPG2      PGEGKSTTISNLAIAFAQMDQKTLLVDTDMRRPVLQKVFKVPRVPGIADIITGT-NTIEE
A0A2D9VF15      PGEGKTTTVANLALTYANLGKKTLLIDTDLRKPVINKVFSVEKNPGLTNYLIND-EKFEV
A0A2D7IJL9      PGEGKTTTVANLAITFANLGRKTLLVDTDLRRPVIHSVFNVKREPGVTNYLSGQTDDYHS
A0A2E3DVU2      PGEGKTTTVANLAITFANLGKKTLLVDTDLRRPVIHSVFELKRDPGVTTFLSGQTDDYKT
A0A2E5VVQ3      PGEGKTTTVANLAITFANLGRKTLLVDTDLRRPVIHSVFNVKREPGVTNYLSGQTDDYNS
A0A2E1Q0C7      PGEGKTTTVANLAITYANLGKKTLLIDTDLRRPVVHKVIGINKEPGITDYLSNNEKDISK
A0A2D8V7U8      PGEGKTTTIVNLAITYANLGKKCVIIDTDLRKPVAHTIFDVKREPGITRFISGVDDKIDD
A0A2E1NF27      PGEGKTTTVANMAITYANLGRKTLLIDTDLRRPVVHKIFDLEXEPGITNFLSGNTSDFNQ
A0A2E6SF50      PGEGKTTTVANLAITYANLGKKTILIDTDLRRPVVHKVLDLNKEPGITDYLSGAKDDFNS
A0A2E0B890      PGEGKTTTVANLAITYANMGKKTLLIDADLRKPVLHKMFKNKENKGLTNFLSQSENNIDN
A0A2D7NA59      PGEGKTTTIMNLAITFANLGKKTLLVDCDLRKPVTHKIFNVEKDIGITNFLVGNISNVDK
A0A2E5VWZ7      PGEGKTTTVANLAITYANLGKKTLLVDTDLRRPVVHKVFNLEREPGVTNFLSGQAKNIEN
A0A2E5JPH8      PGEGKTTTISNLSITFANMGKKTLLLDTDLRRPVIHRVFGIKKEPGISHYLAGNIENFDS
A0A2E6AXM8      PGEGKTTTVANLAITYANLGKKTLLIDADLRKPVVDKVFDLKKVQGLTKYIVEN-INIKS
A0A2E5GDL9      PGEGKTTTVANLAITYANLGKRTILVDTDLRRPVVHKVFELXXEPGITTYLSGXTNNYKN
A0A2E5SGC3      PGEGKTTTVANLAVTYSTLGKKVLLIDSDLRKPVNHKVFKVSRSPGFSSYLSGQKNDIEE
A0A2E1WWX4      PGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVIHNVFKADKSPGLTSFLSGN-SDLKS
A0A2H0XTF1      PGDGKSTTVVNIAITFASLGKKTLLIDSDLRKPILHKVFDISRGPGLTHAMIEDLND-SD
A0A2E5XY54      PGEGKTTTVANLAITYANLGKRTLLVDTDXRRPVVHKVFDLKRXPGVTAFLSGSIDNYKK
A0A2E5U5G7      PGEGKTTSIANLAITYANLGKKTLLIDSDLRKPVIHNVFKLDKTPGLTSFLSKN-SSYSD
A0A2E1Q8L9      PGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVVHNIFKFDKSPGLTSYLSGNESDELK
A0A2E2VWX2      PGEGKTTTIANLAITYANLGKKTLLIDSDLRKPVIHNIFKFDKSPGLTSYLSGNESDEKK
                **:**:*:: *:::::: :... :::* * *.*:   ::      *.:  :         

A0A101ID17      CIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDASL
A0A124FPG2      CIHETSVENLYILPSGNLPPNPSEMLGSKKMREIYQTLTEQYDKIFFDAPPIIAVTDASL
A0A2D9VF15      VIKETDIENLHIIPSGIVPPNPSELLDSDSMKTMIDNLKEQYDIILFDTPPIVAVTDALI
A0A2D7IJL9      LVKPSEIENLSLLTSGLIPPNPSEMLGSKKMSQFIKKLESDWDMILFDSPPLVAVTDATM
A0A2E3DVU2      LLQAGEVDNLFIMTSGIIPPNPSELLGSKRMIHLVRELEDDFDMVLFDSPPLVAVTDANM
A0A2E5VVQ3      LIKDSGIENLYLMTSGLIPPNPSEMLGSKKMSQFVKLLESDWDMILFDSPPLVAVTDATM
A0A2E1Q0C7      IIQKTEIKDLCVIPSGIIPPNPSELLGSDRMSNLLRDLEDEWDMILFDSPPLVAVTDAAM
A0A2D8V7U8      LIHKTEIENLSLITCGVVPPNPSEVLASERMKNLVNHLKKKFDVIFFDAPPLLAVTDAFI
A0A2E1NF27      LVKNTDIDNLKVVTSGIIPPNPSELXGSKKMGDLIKNLEKDWDIILFDSPPLVAVTDATM
A0A2E6SF50      LVQSTSIENLYVVPSGIIPPNPSELLGSKRMSDLLKRLEKDWDMILLDSPPLVAVTDATM
A0A2E0B890      ILIDSGVENLSIITSGIVPPNPSELLSSPAMIDFIKKAKENFDVILFDTPPLIAVTDAFV
A0A2D7NA59      IINPTEIENLSIITSGIIPPNPSEILASENMEILIKKIKMDYDVILIDSPPLLAVTDTFI
A0A2E5VWZ7      LVQETDIDNLSIITSGIIPPNPSEMLGSEKMISFVKTLEEGWDMVLFDSPPLVAVTDANM
A0A2E5JPH8      LIQKTDVENLYVVSAGITPPNPSELMGSKKMAELVDKLEREWDMVLLDSPPIVAVTDASM
A0A2E6AXM8      IIQNSSIDNLDIVTSGVIPPNPSELLDSNKMRDLFDNIKLDYDIILIDTPPIIAVTDALI
A0A2E5GDL9      LIKXSQIPNLXIITAGIIPPNPSELXGSERMXKLVKXLENDWDMVLFDSPPLVAVTDANM
A0A2E5SGC3      IINKTYVDNLDILSAGITPPNPSELLESDTLGELMHTLKQKYDIILIDTPPLIAVADAYI
A0A2E1WWX4      ILNKTDIDNLEIITSGVIPPNPSELLDSNKMIDFIKKVKNQFDVILFDSPPLVAVTDAFV
A0A2H0XTF1      IIRATEIPNLYIITCGDIPPNPSEILSSQKLKNFIERMKSEFEIVLFDSPPIIAVTDASV
A0A2E5XY54      LVQSSGVENLSLITAGIIPPNPSELLGSDRMARLVKTLENDWDIVLFDSPPLIAVTDATM
A0A2E5U5G7      ILNKTDIKNLDVITSGIIPPNPSELLASNSMQKFIAMIREEYDVVLFDSPPLIAVTDPYV
A0A2E1Q8L9      LVNSTETKNLDVITSGVIPPNPSELLDSPKLKKLLEKLKSKYEVILFDTPPLIAVTDAFV
A0A2E2VWX2      LINSTDTKNLDIITSGVIPPNPSELLESSKLEELLLKLKNKYEVILFDTPPLIAVTDAFV
                 :      :* ::..*  ******:  *  :  :       :: :::*:**::**:*. :

A0A101ID17      LAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGGSYYYYYRY
A0A124FPG2      LAKLCDGLVVVVKSGVTHDEALDQVQNIVQQIKLPMLGAVINAITPKHMKGGSYYYYYRY
A0A2D9VF15      LSKHIDKFILVCRPGVTQKGALERVLKNLDQVNSKINGCVFNAIGDL-DSYGSAYYYNYY
A0A2D7IJL9      ISKEIDSIILVIKAGQTDKKAFHHTMANLKNIEAPLDGIVMNAVTSK-SNYGSYYYYYYH
A0A2E3DVU2      ISREIDRILLVIKAGQTDKKAFHHTMMNLKNINAPLEGIVMNAVTSK-SNYGSYYYYYYH
A0A2E5VVQ3      ISKEIDSIVLVIKAGQTDKKAFHHTMANLKNIDAPLDGIVMNAVTSK-SNYGSYYYYYYH
A0A2E1Q0C7      VSKEIDQIVMVVKVGQTDKKAFDHTISSLRNVGAPISGVVLNAVTHK-NSYGAYYYYYQY
A0A2D8V7U8      SLSYTDQFILVVRSSHTQKGGLDRAIELLNQSNAPLSGVVINDIDSS-NSYGGGYYYNYY
A0A2E1NF27      VSKAIDKIIIVVKVGYTDKKAFXHTVRSLRNVNAPIGGVVLNAVTKK-SSYGSYYYYYQY
A0A2E6SF50      VSKEIDQIVMVVKVGQTDKKAFDHTITSLRNVDAPLGGIILNAVTHK-NSYGSYYYYYQY
A0A2E0B890      ITKFVDKFLLVVRASVTQKGALERSLVNMSNMGNSISGVIFNGVDES-NTYGGGYYYNYY
A0A2D7NA59      LSKFASQFILVVRAGKTEKGGLDRSLDQMNQVNVNLFGIVMNDVDES-NSYGKGYYYNYY
A0A2E5VWZ7      ISREIDRIVLVVKVGQTDKKAFHHTINNLKNIDAPLGGIIMNAVTNK-SSYGSYYYYYYH
A0A2E5JPH8      VSQEIDAMVMVVKAAETDRDAFRRAVKSLMGISVPLAGVVVNGISRRTSKDTYYYYYQYY
A0A2E6AXM8      ISKYVDNFILVCRSGQTQKGALDRSIKSLKLVGGKFDGAILNAISEG-NNYGSSYYYNYY
A0A2E5GDL9      ISXEIDQILLVVKVGQTDKKAFHHTVSNLRNXKSPLGGIIMNAVTHK-SSYGSXYYYYYY
A0A2E5SGC3      LMKYIDKFVLIVRAGVTEKGAFERVCSELQYGNFPITGVVMNAMTEEHHSYGAGYYYNYS
A0A2E1WWX4      LMKYIDQFILVVRPGKTERGALERVIASTQQSNMNITGVVMNAMSEE-HSYGSGYYYNYY
A0A2H0XTF1      ISKMTDAILLVVKAGVTDTRVVARAIELLRQVKTHLIGAVLNGVNIT-GGYDSYYYYYNY
A0A2E5XY54      ISQEIDQIVLVIKVGQTDKKAFHHTVSNLRNINAPLSGIIMNAVTGK-SSYGSYYYYYYY
A0A2E5U5G7      LMKYVDQFVLVVRSGVTQRGALQRVLEVVGQTDFDITGVIMNAVSES-DAYGSGYYYNYY
A0A2E1Q8L9      LMKHSSQFILVVRAGVTERLALDRVMTNLYQSGFKETGVVLNALEES-HAYGAGYYYNYY
A0A2E2VWX2      LMKHSSQFILVVRAGVTERLALDRVMTNVHQSGFKETGVVLNALEES-HAYGAGYYYNYY
                     . :::: . . *    . .             * :.* :          ***   

A0A101ID17      MNYQYK-----------------------
A0A124FPG2      MNYQYK-----------------------
A0A2D9VF15      QYYYNSDN---------------------
A0A2D7IJL9      QYYHYYSSHDNESDA--------------
A0A2E3DVU2      QYYHYYSSSEDDEK---------------
A0A2E5VVQ3      QYYHYYSSHDDTSEA--------------
A0A2E1Q0C7      YHYYGNEKETEKV----------------
A0A2D8V7U8      QYYYGSEK---------------------
A0A2E1NF27      YHYYGSDK---------------------
A0A2E6SF50      YHYYRSDTETQSA----------------
A0A2E0B890      QYYYGSDEK--------------------
A0A2D7NA59      QYYYGDS----------------------
A0A2E5VWZ7      QYYQYYGSEKDSD----------------
A0A2E5JPH8      QHYYGGYYGYYGKDKEKELEGETA-----
A0A2E6AXM8      QYYYNEESN--------------------
A0A2E5GDL9      QYYXYYGXDKES-----------------
A0A2E5SGC3      NYYYSDNDS--------------------
A0A2E1WWX4      QYYYGDKT---------------------
A0A2H0XTF1      YYYYGDGGKKKKKSRFRKNRSASPAEPER
A0A2E5XY54      QYYHYYGSEKNDNKA--------------
A0A2E5U5G7      QYYYGESDK--------------------
A0A2E1Q8L9      QYYYAENSD--------------------
A0A2E2VWX2      QYYYAENSE--------------------
                  *                          

© 1998-2019