BYKdb

Dataset for cluster tadcd of phylum candidatus-melainabacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A317IV02      MLETKSTDFRRQVSHNDITLADAIGSSIRFVRRQRRVIISSVLVLVTLGVLTRFLTPSR-
A0A1F6QKE9      -----------------------------------MNFYEAIRIHLRLGLLIVFLVPTVS
A0A1F6RGM1      -----------------------------------MNFFEAIRIHLRLGLLIIFIVPAVA
                                                     : .:: : : **:*  *:.*:  

A0A317IV02      ----------YTARAVVYADLSRQEINPPQQQ-AIGPSPEDPTQVDSQVEVFRSLSVLLP
A0A1F6QKE9      WIIALNITPIYESRARLLIEAKDLGLDSNESSAPFRSISRLSDPIQTQIEILRSSTILEK
A0A1F6RGM1      WVYSLTITPIFESRARLLIEAKDLGLQGNQQ--PFKTIARLSDPIQTQIEILKSATILDK
                          : :** :  : .   ::  :.  .: . .  .  :::*:*::.* ::*  

A0A317IV02      VVEQLKLREDPEFSKKGSQGQEEQRELSSLLEKLEKALEVKRVGKTHIIEVLFTAQSPNR
A0A1F6QKE9      VIRQFNLRY--------RRGPQKGQYLSYL--SLSQNLSVSADRNVDVVELKYKDPDPKK
A0A1F6RGM1      VIRQFNMRY--------KGGPNKGRYISYL--TLSGNIAISSDRNVDIVELKYHDPDPNK
                *: *:::*           * :: . :* *  .*.  : :.   :. ::*: :   .*:.

A0A317IV02      AAEVANAISNSFIQDRLQAKYESAQRAIAWLHNRLTELKRQSSAAE----EAAERFKSSH
A0A1F6QKE9      AKDILRAITDSYIEKTIELKASDTASAIRFLKKERNKAEREALEASKRLREFEQRSKTAG
A0A1F6RGM1      AKEILQAITDSYIEKTIELKASDTASAIRFLKKERNKAEREALDTSKRLREFEQKSKTVS
                * :: .**::*:*:. :: * ..:  ** :*::  .: :*::  :.    *  :. *:  

A0A317IV02      VMSAELLAQQLSELKSRRVSIQSEVDNADATLGHIDFILRSDFSIAAVDGSILEASSELA
A0A1F6QKE9      RDFNSELIKSSYGLKSLRLSIDTEYVKAKTAAEQVSKQLMSNIDDALLENTINQDPF-LA
A0A1F6RGM1      LQSNQELVKTAENLKQIKLTADSEYAKFKSVTVQLKKQLMSTVDDAIITSTVSQDPF-LA
                    . * :    **. .:: ::*  : .:.  ::.  * * .. * : .:: : .  **

A0A317IV02      KLRSRYLELVSQEAELTSGANHDHSAEVNVRKQIEQMRASIKEELKRIAENYKSNHEIAR
A0A1F6QKE9      ALKKDLFERQTQLVKIQTKVKPGHYQLEEIKQQIQGDNKLIAERVKELIGHDVNPNTIPY
A0A1F6RGM1      ALRKDLYEKENRLVQLQTKVKPGHYQLEEIKEQLSGNKKLILERIKELIGKEVDINSFPY
                 *..   *  .. .:: : .: .*    ::.:*:.  .  * * :* :  :  . : :. 

A0A317IV02      AKE----RAVGEELAQKNALLKSENEHQVKLRELENIAKNLRTTYDDNASFLQ-------
A0A1F6QKE9      SQDPLRAGLIKNLLETKTAELAIEQELMVVDEAIAELQKKIDKLPNEKYIYNQLLRQNEI
A0A1F6RGM1      SQDPLRAELTKNLLQTKSAELAAKEQLKIIDIAITELNKKLERLPSEKYIYTQLLRQNEI
                :::        : *  *.* *  :::  :    : :: *::    .::  : *       

A0A317IV02      --RDIEQLQQQSMPT----------SGARIISLALPPLKRSSPKTSLLVGGAALAGLMLG
A0A1F6QKE9      AEKRLQEIEVKLIESRMKGVIASHITNIRLIDPPSFAARPKWPNISSTLMTSFIFGLLLA
A0A1F6RGM1      SQKRLEEIEQKLIESRMKGVIAQHITNIRVIDPPSLAGRPKTPNIPINVFYSFIAALFLA
                  . ::::: : : :          :. *:*. .  . . . *: .  :  : : .*:*.

A0A317IV02      FAIGFFRDMADRTCRSREQIEAILDVPCITMVPRLGANRRTQALRNWNLHLHEKKIKASG
A0A1F6QKE9      GLVIYLVEYFDDVIKSVDTLPKDLGCPFLGQLPYI-------------------------
A0A1F6RGM1      GIVIYLVEYFDDIIKSIETLPKEMGCPLLIQLPLV-------------------------
                  : :: :  *   .* : :   :. * :  :* :                         

A0A317IV02      FLTSKNQLLSRTDSRGKSSSAARQTDYISFLADTTQISQEPFFSRFSEAIQTI--ALSLD
A0A1F6QKE9      -----------------------------HVSDLPTVYQEP-RSEYTEAIHALRTNLSFL
A0A1F6RGM1      -----------------------------HIGDLPIVYQEP-RSPYTEAIHTLRTNLSFL
                                             .:.* . : ***  * ::***:::   **: 

A0A317IV02      QAHAASQIVAVTSALPNEGKSTIIAYLARTLAQSGRRVLLVDCDLRVGKLTKVFAE-QSP
A0A1F6QKE9      SLAGNKKLLLVTSSTKNEGKSTISVNLAITYAQSGKRVLLLDADIRNPSLYKYLARPKDA
A0A1F6RGM1      SLSGNRKLLLITSPSMSEGKSTVAVNLAITYAQSGKRVLLIDTDIRNPSLYKYLSRPRDS
                .  .  ::: :**.  .*****: . ** * ****.****:* *:*  .* * ::  ...

A0A317IV02      IGVRDIVMSEVSAQIAIKQH---DAGFAFMPAGTGACPTHPNEIFAMAKTHILFEELRKS
A0A1F6QKE9      VGISNTLINEIDFYDVVQKSILGIIGFDYLPGGD--IPPNPVQLLESDKMRELLETCQHI
A0A1F6RGM1      VGISNTLINEIDFYDVVQKSILGIIGFDYLPGGD--IPPNPVQLLESDKMRELLETSQHI
                :*: : ::.*:.   .:::      ** ::*.*    *.:* :::   * . *:*  .: 

A0A317IV02      FDYILLDLPPLGPVTDVVAIGKFVDSYLFVIEWGRTQTQVVPQTLNRAQLVRNNLLGVIL
A0A1F6QKE9      YDLVIIDTPPIGYFSDALLLARHADVVALVSRYNQTSRKELSASVSLLKKTNVTALGVIL
A0A1F6RGM1      YDLVILDTPPIGLFSDALLLAQYADVVALIARNNKTSRKELMSAIDVLRKTDVAGIGVIL
                :* :::* **:* .:*.: :....*   ::   ..*. : :  ::.  . .    :****

A0A317IV02      NNVDLKAIADYERTYYSYEEN-----------
A0A1F6QKE9      NGIPVGAQG--AYGYYGYGHESERYIREQPAA
A0A1F6RGM1      NAVPSSSQSGYGYGYYGYG-DSERYAKRQPAA
                * :   : .     **.*  :           

© 1998-2019