BYKdb

Dataset for cluster tadcd of phylum candidatus-omnitrophica

[Download (right click)] [Edit] [Sequences] [Repertoires]

25 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1G1IP08      MDLITMPDPKVAPPYSTKESQISTGAPEERLDASIHSYVFVLWKRKWLIAASIVFCLGIS
A0A2J0KU82      --------MEREPLYKFYK------------EWELKDYIEVIIRRKKILLTFLLSLVFIV
A0A1G1K0W1      ----------MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFS
A0A1G1K4H2      ----------MAEVPELDYSSGVFQSEEEADAYNLQLLWKAVQNKRGIIVTITGIAFVFS
A0A1G1LHA8      ----------MVNVPESALGGMQFESERESDEVNLELLWRIFRTRSWFIFTVVAMVTVLA
A0A1G1KQI3      ------------------MTTRPYLEQEESEAVNLRYYFDLIFRQRVPIVTFLIIIVTVA
A0A2J0LFS5      ------------------------------------------------MVTFFVAIVSFV
A0A1J4VP59      ------------MTLNDGIGNVPKMGLDGNQSTDLAKYWFVFLAHLRIIASATGVFFIIS
A0A1G1PGV5      ----------------MSPTLSEAVRQAKTLEWRFDDYVVFIRRHWLTIVLGGLLGWGAA
A0A3C0MWS5      --------------------------MQAQEVSGTSEYPDILIRRRKTIILFFVLTLAAV
A0A2H0LL91      ------------MVSMDQPAVGYPNSPEEAESINLSYYLGLLYRHRVFLFTFFFISVTLV
A0A1V5SP48      ---------------MPNVPEAQNPQIHRDTEMDFKKFFSAVRDRYIIIIILTTVILAGV
A0A1G1JR53      --------------------MESPRPSIKEEGLQLKNYTHIIRRRADVLILFFVATVSVI
A0A1G1KL63      ----------------------MTANLEKQKERHLKDYIEVLRRWRDIAITFFVSMVLLV
A0A351I6G3      -----------------------MENTTFNKELHIKEYISVILRRKWTLIAFFLITVTAV
A0A2J0LAF9      ---------------------MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVTTI
A0A2J0LM30      ---------------------MFFQSEKGQKDIHLKNYLFILFNRKWIVISFFFIIVATI
A0A0F0CSR3      ---------MGVKKKGNKNMPNSTQNPFLEREQDIKEYLSILYNRRWLIISFTLVLCTIS
A0A1G1IVX7      --------------------MAAAGSVFGEEEIHLRDYYYVLMKRRRLILTFLLAALSLG
A0A1J4Z4I0      -------------------MIPKSDLK----ELNFNDYLEIVGKHRWIVVTFFVAIVSFV
A0A2J0LS24      -------------------MIPKSDLK----ELNFNDYLEIAGKHRWIVVTFFVAIVSFV
A0A2H0LEC5      -----------------MALI-------GEVDWKPEDYLHAAFSHKFTLFMITLVIGSYA
A0A1G1JZ27      -----------------MKIFPSSKIS-DELQLSLYDYWYIIQKRKRLALTFFLIVVIST
A0A1G1K375      -----------------MKIFPSSKIS-DELQLSLYDYWYIIQKRKRLALTFFLIVVIST
A0A1W9RLH0      ----------------MRGMIEEKEIGYSPSEEGIRDILNKIYKRRWFIFNFTFLCIVFT
                                                                            

A0A1G1IP08      TFINVTQKPVFRASTEVVL-----------QPKESDT-SSSSVHPGNSIMQD-----PTF
A0A2J0KU82      SVYSYTATPIYQATTQILI-----------ERNEPQILNFQEVYAMPS--AE-----TEY
A0A1G1K0W1      LLYALHLPTVYTARTKIFI-----------EGGKESAFQNPEMMESPAA-----NPLPTY
A0A1G1K4H2      LLYALHLPTVYTARTKIFI-----------EGGKESAFQNPEMMESPAA-----NPLPTY
A0A1G1LHA8      SIYALRLPNVYTARTKLLV-----------QKVDPSPLQNPELMK-PTT-----AYGDTY
A0A1G1KQI3      VLVVLKLPNNYQAVAELLF-----------DNPEA-VSAPERELATPNYGQD-------H
A0A2J0LFS5      AFFSFWVEPTYRATTVILI-----------ERQQPKVLSVEEVYGMGLADKE-------Y
A0A1J4VP59      VFHFFSLPNIYTATTTILA-----------EQTETPPSRQEMLKTTTST--D----VDEY
A0A1G1PGV5      AWWVSTIPNSYQAQTRLLI-----------DRYSGEPVGFGETASMSSARRD----IE-F
A0A3C0MWS5      GMGTVLMTPVYQAKAVLLI-----------DVAGPDVVATTANVAMESQGASYYSYRE-Y
A0A2H0LL91      GIFLMKLPDQYRSTTQVLIESAPVSAGASEELEPT------------------FQSYT-Y
A0A1V5SP48      LFYNSTLVPIYRATTQLMIEIPEFVGHDTKEAKSPTI-----------------GSSD-Y
A0A1G1JR53      TIGSFIMEPVYRATTTLLI-----------DPESPNVLTTTGMVELESQ--NYFSYKE-Y
A0A1G1KL63      TISSFIMKPVYRATLTMII-----------DPESPNVLTATGMVALKSE--DYLSYKD-Y
A0A351I6G3      TFATFKQHPIYRAVSTIII-----------DVAEPDILAVKDIIKLGET--NYFAYRA-Y
A0A2J0LAF9      TIATFMQKNVYRAAATVIV-----------DAESPDVLSVKDIVKLGES--NYFAYKD-Y
A0A2J0LM30      TIATFMQKNVYRAAATVIV-----------DAESPDVLSVKDIVKLGES--NYFAYKD-Y
A0A0F0CSR3      LIRTFMMRPVYEATTKILI-----------QKKAPRIIKIDEMDTTNYS--A----SD-T
A0A1G1IVX7      IFFTFTERVIYQASATLLI-----------EKDNPNVLDFKEVLTFDAS--S----TD-Y
A0A1J4Z4I0      AFFSFWVEPTYRATTVILI-----------ERQQPKVLSVEEVYGMGLA--D----KE-Y
A0A2J0LS24      AFFSFWVEPTYRATTVILI-----------ERQQPKVLSVEEVYGMGLA--D----KE-Y
A0A2H0LEC5      YFREAQKPDIYQASTEIVI-----------EQDDADLVQFQRGARYNAN--A----GDQF
A0A1G1JZ27      ALYSLLSPKIYKATTRILI-----------ERSNQNILSFDNIFPVQMA--G----LD-Y
A0A1G1K375      ALYSLLSPKIYKATTRILI-----------ERSNQNILSFDNIFPVQMA--G----LD-Y
A0A1W9RLH0      LFFSFKVKPVYRAKTRILI-----------ESKVPKIVQFEDVYLTDYG--N----SDRY
                          : :   :.            :                             

A0A1G1IP08      LLTQLRVIKGPQLAERILQKFSTGE----------------------------ERQLAAD
A0A2J0KU82      YQTQYRILKSRSLAEKIVEKLNLTA----------------------------SPRF---
A0A1G1K0W1      FQTRAEMLKSHHILEQAAKELNLVEHYQKV-----------------------NKRIK--
A0A1G1K4H2      FQTRAEMLKSHHILEQAAKELNLVEHYQKV-----------------------NKRIK--
A0A1G1LHA8      YLTRIEVMKSRPILAPIAERLNLPEHYG----------------------------VE--
A0A1G1KQI3      IATQLQILKGISVTEEAVKKTNYHE----------------------------KVGMS--
A0A2J0LFS5      YETQYKILRSRTLIKLIFDDMNLYL----------------------------DPEFS--
A0A1J4VP59      YGTQLAILRGLKIEKMVKAELGGD-----------------------------SEGYA--
A0A1G1PGV5      LATEYQLIISRPVLEEVLRTMNLGG----------------------------FPPFS--
A0A3C0MWS5      YRSQMAIVKSYPIIKQVFDEFGVGK----------------------------SEKYA--
A0A2H0LL91      VDTQAEIIASIPILTVAAEKEDLAN----------------------------FFEVE--
A0A1V5SP48      FNSQYEILRSVSLARKIAEKLDLKA----------------------------LPE-F--
A0A1G1JR53      YQSQAELLTSYTLVKKVFNEFGLEE----------------------------QFEYF--
A0A1G1KL63      FQSQMMIMCSHSLAKKVFEDFKLGE----------------------------TKEYY--
A0A351I6G3      IETQQEIIKSRNIAMQVINNLGLAD----------------------------KEEFK--
A0A2J0LAF9      IETQQEIIRSRRTAHKVMKNLGLKD----------------------------RTEFI--
A0A2J0LM30      IETQQEIIRSRRTAHKVMKNLGLKD----------------------------RTEFI--
A0A0F0CSR3      LFTQYKILESD----------------FLAEKVFKTLGDYIPWDKWHGRKKINTSKPL--
A0A1G1IVX7      YQTQYQMLKGAGLIRELLHEERLENDPYLEGLVRGRMRNFLRKQPWVAGI---LGKFL--
A0A1J4Z4I0      YETQYKILRSRTLIKLIFDDMNLYL----------------------------DPEFS--
A0A2J0LS24      YETQYKILRSRTLIKLIFDDMNLYL----------------------------DPEFS--
A0A2H0LEC5      LRTEHMLIRGPEILQSVVKTLNLDA----------------------------FPPFA--
A0A1G1JZ27      YPTQYKILRSRSIAKRVMDELHL------------------------------WPQFS-W
A0A1G1K375      YPTQYKILRSRSIAKRVMDELHL------------------------------WPQFS-W
A0A1W9RLH0      YNSQCEILKSNTIAKMVLDMLGD------------------------------YKPWDIW
                  :   :: .                                                  

A0A1G1IP08      CFALKGNWAKKDAPFTEREQGFLVSMIRGF-ISAEQVERGARIIAISMTGYDAYGVKKMV
A0A2J0KU82      ------------------QGGNPIDALLGM-IIIEPVGK-SRLVNINVQSDNPQFAATIA
A0A1G1K0W1      ------------------TNEEAADLLGDDKTNVKLLKG-TQIVQLSVTDTDPQWAAKIA
A0A1G1K4H2      ------------------TNEEAADLLGDDKTNVKLLKG-TQIVQLSVTDTDPQWAAKIA
A0A1G1LHA8      ------------------TTENAAQILRGN-LDAHLVRN-TEVIEVALSDRDPKMAARIA
A0A1G1KQI3      ------------------MERAAGSA-LGA-LSTIQIKG-TRIVRVVFQSEDPKIAAEMV
A0A2J0LFS5      ------------------DARDPISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIA
A0A1J4VP59      -------------------------------ISASHIRD-TRILSLSVTHLKPELAAKIA
A0A1G1PGV5      ------------------ISNDPAGVLSGL-VSVVPVRG-TKLVDIVVTSTNPTLAMRIA
A0A3C0MWS5      ------------------KAKDPMKEFLKT-IDVQSVRD-TRLMDVNVENEDPVIAAKMV
A0A2H0LL91      ------------------DLREAVFVLKKK-LRVRAVRG-TQLINISIATPSAEKSAAIV
A0A1V5SP48      ------------------QGKIPELALQEM-ITVKPVKN-SRIVMLSVESSRPELAANIA
A0A1G1JR53      ------------------DAKEPIKKFLKT-IKVDPVRD-TRLLKLNVDNKDPELAAKIA
A0A1G1KL63      ------------------KTKEPIKNFLKT-IRVDPVPD-TRLVKLSVDNKDPQLAANIA
A0A351I6G3      ------------------KEKDPVGHLLKK-LKVELVKD-TRIIKISIDDKDPRQAVLIV
A0A2J0LAF9      ------------------RSKDPLETLLKK-LRVELVRG-TRILKINADDNDPVQACRIA
A0A2J0LM30      ------------------RSKDPLETLLKK-LRVELVRG-TRILKINADDNDPVQACRIA
A0A0F0CSR3      ------------------TDLQKIETLLSH-LKITPIPN-TELVLIKFEDIDPVLSAKIA
A0A1G1IVX7      ------------------VPQSPEDVFAAHMLQIKPVRN-SQLVSVIVLHPDNRRAASIA
A0A1J4Z4I0      ------------------DARDPISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIA
A0A2J0LS24      ------------------DARDPISVFISR-LTIDPVRN-SRLVNLHFDGKDPQKITTIA
A0A2H0LEC5      -------------------RSEYPADLLAGMVSVQPVRG-TNLVNISVTGKKPDLVARIS
A0A1G1JZ27      -------------------ASDPPAAFLQK-VDIDPVKQ-SRLVDVSAYSTSPKQAADMA
A0A1G1K375      -------------------ASDPPAAFLQK-VDIDPVKQ-SRLVDVSAYSTSPKQAADMA
A0A1W9RLH0      HGRKKDATF---------TEEEKIKALLKN-VKVKKAVR-SQLVDILVEDTDPELAAKIA
                                                        : :: :            : 

A0A1G1IP08      DTAAETYIDLNYETQIDAFKKSFSVISKSLNEIREKIKAGEMALQK--------------
A0A2J0KU82      NTIAEEYVKKDIEDKLFTTKYAVGWLTDEMKKMKEKVEESEKKLQEYKETNELV----SL
A0A1G1K0W1      DGISDTFIKESWRERLFISEQILEWFPKEGETLQKS--SGINQLRQLDKEGAIT------
A0A1G1K4H2      DGISDTFIKESWRERLFISEQILEWFPKEGETLQKS--SGINQLRQLDKEGAIT------
A0A1G1LHA8      DAVAEHFARETWREQLFISDQVLKWFPEEGKILEMN--SPIGQLRRLEND-PIA------
A0A1G1KQI3      NAICEGYIKKNIENRLYFSQEIMKLLPAETQKTLK--SQTPMGQLEELSQKELI------
A0A2J0LFS5      NTLAELYIKQDAEIRTKASRDAVSWLMEQIVSVKKRLEESETALVKYMEQEKIT------
A0A1J4VP59      NKFAEIYVRESKHENAFIGQQILQLLPGSPEAVLPG--GSAVVSQGFSKQEFAS------
A0A1G1PGV5      NTVAETYVQLNLERRQQQATGGAEWLQEEVVKTEGQMKAAQEALQGFKEKHQMV-SLEDQ
A0A3C0MWS5      NRIADLYIRRN---LDYISKSELLNL----------------------------------
A0A2H0LL91      NSIAETYVKQSIQNRLFFSKEILNLLPEGGGKKTIEDLSPIGQLEKLEDIKFAA------
A0A1V5SP48      NALADIYIQQNIEGMMFMSKEILRVISGEHGLPEPGMPSDI-LPSAAERQKIIQ------
A0A1G1JR53      NRMANLYVMRN---LYYISRTELTNL----------------------------------
A0A1G1KL63      NRMAELYVMQN---LYYTSKVELSNL----------------------------------
A0A351I6G3      NKFAKVYTDSNIASRINPSNEAETWLREEVDKQKLKVRESEFSLQAYKEKNNIVGSIEDK
A0A2J0LAF9      NEFANVYVDSNIALKMRTSNEAEDWLKKEVDKQKTKVREAEFMLQSYKEKNDII-SIENK
A0A2J0LM30      NEFANVYVDSNIALKMRTSNEAEDWLKKEVDKQKTKVREAEFMLQSYKEKNDII-SIENK
A0A0F0CSR3      NLWANSYISYILDTRFDVSSYASGWLDDKIKEEKNNLETAEKTLQEYRKANTII------
A0A1G1IVX7      NTLARLYIEQNLRNRYEVSTQATELISGQIGILKDKVAEADLKLQKYKEEHSLV------
A0A1J4Z4I0      NTLAELYIKQDAEIRTKASRDAVSWLMEQIVSVKKRLEESETALVKYMEQEKIT------
A0A2J0LS24      NTLAELYIKQDAEIRTKASRDAVSWLMEQIVSVKKRLEESETALVKYMEQEKIT------
A0A2H0LEC5      DAVAETYADRNLQRRIEKTGGGTQWLQEELAWTEKKMRAAQLELQNFLEEHETV------
A0A1G1JZ27      NAMVKFYIEQNLSNKLAMTQQAAEWLKGRSKDVREKLSKSELEFEAMK------------
A0A1G1K375      NAMVKFYIEQNLSNKLAMTQQAAEWLKGRSKDVREKLSKSELEFEAMK------------
A0A1W9RLH0      NFWVGAYLNYIQQSRSSLTKYASTWLEKEIERAKKKVEEAELALQKYREENNII------
                :     :                  :                                  

A0A1G1IP08      ----------------------------------------------------IIKELQ--
A0A2J0KU82      EESQNIVVQKLAELNSKATQAKGKKLETENKYKQVEENRDKPDTLPSVRDNALVQELKQV
A0A1G1K0W1      -------------------------------------------SLPSVAKDPVINSIKEE
A0A1G1K4H2      -------------------------------------------SLPSVAKDPVINSIKEE
A0A1G1LHA8      -------------------------------------------SLPSVMQDPVIGGIEQK
A0A1G1KQI3      ---------------------------------------ESLPSVQADPTLR---ELKKK
A0A2J0LFS5      ---------------------------------------ESPEAGNKDNTVNLPETLKRE
A0A1J4VP59      -------------------------------------------SLNSVSGDPQVTQLLNE
A0A1G1PGV5      QNVIVQRLQELSSAATEAKTARLNAEAEWAEISRALSAGRPVDSLPIVRQSPRILTLEPQ
A0A3C0MWS5      --------------------------------------------------------LKNE
A0A2H0LL91      -------------------------------------------TLPSVRSDPTILELKNQ
A0A1V5SP48      -------------------------------------------MLPSVVNNPEILNLRKE
A0A1G1JR53      --------------------------------------------------------LKNE
A0A1G1KL63      --------------------------------------------------------LKNE
A0A351I6G3      QNIINDALMKLNTVYLDAQRKRIQAESAHKSSVDTEGNLRLENLSTLLSNNEVLQQLKKD
A0A2J0LAF9      ENIINDSLISMNASYLAAQKKRVSSETTYKSLVDGGGKLNLDRLPTILTDNDILKELKKE
A0A2J0LM30      ENIINDSLISMNANYLAAQKKRVSSETTYKSLVDGGGKLNLDRLPTILTDNDILKELKKE
A0A0F0CSR3      -------------------------------------------IDTVDEEHRVLNKLLAK
A0A1G1IVX7      ------------------------------------------SIPSLHEKDQFLQDAKLQ
A0A1J4Z4I0      ---------------------------------------ESPEAGNKDNTVNLPETLKRE
A0A2J0LS24      ---------------------------------------ESPEAGNKDNTVNLPKTLKRE
A0A2H0LEC5      ---------------------------------------DFS-TNRQNTIFQRISDLNRA
A0A1G1JZ27      ------------------------------------------------------------
A0A1G1K375      ------------------------------------------------------------
A0A1W9RLH0      ---------------------------------------DDP-ATTSEDT-ALLNKLIER
                                                                            

A0A1G1IP08      -------LLDQFKVYGDKHPMVVSLQTDITGLSVKLRES--------TNDL-----EKME
A0A2J0KU82      CATKEGTLSEMMKRYKEKHPKIIQLKSELKTLQERIDTE--------IGKVVDSIKGEYE
A0A1G1K0W1      RIKVDAMMRELSKRYTSEHPKIKELQARADYLESEMKSQ---------------------
A0A1G1K4H2      RIKVDAMMRELSKRYTSEHPKIKELQARADYLESEMKSQ---------------------
A0A1G1LHA8      QMGVDEEMTVLSARYTPEHPKMKELLTQAAYLQSEKKAR---------------------
A0A1G1KQI3      KTEIENELTALRQQYREQHPSIIQREANLKFIDESIQIE---------------------
A0A2J0LFS5      QLRLEVEISEISRRYGPKHPQMVKVLSELESVKSKLDIE---------------------
A0A1J4VP59      KLGIQSKLTELSQRYGPEHPAIKDLNQRLSTVESDIKAR---------------------
A0A1G1PGV5      IAAKETELSDRQKIYGEKHPAIAQLTEELTALRKQREAE--------VGKVVEDARLEYS
A0A3C0MWS5      YLRLDARLAEYSKIYKEGHPEMIRVREEMADVVASINKE---------------------
A0A2H0LL91      IAKAETDLFELKRQYREQHPDVMKVQANLKFLKESVD-----------------------
A0A1V5SP48      RSGIESQIAQLSKRYKPKHPRMIALNTQLGSINEQIK-----------------------
A0A1G1JR53      YLKLESRVSEYAKVYKEGHPEMIKVKNEMAELVAKIEKE---------------------
A0A1G1KL63      YLKLETKAAEYAKVYKEGHPEMIKLRTEMADMIKRMDNV---------------------
A0A351I6G3      YSKQQAILAEYKEVYKNKHPKMIALFETTNYLKSRIKSEELHIKAEETSRVTTKLETEDD
A0A2J0LAF9      YLKQEALLVEYKKVYKDKHPKMARLFENMDYIKSRIKTE---------------VENEYN
A0A2J0LM30      YLEQEALLVEYKKVYKDKHPKMARLFENMDYIKSRIKTE---------------VENEYN
A0A0F0CSR3      KSELEVLLSEKQEYYKAQHPEILGIKSELESIVKTIANE---------------------
A0A1G1IVX7      LMKLQAREARMAKRYLPAHPKRIHLRSEIEGLDEKIKTE---------------------
A0A1J4Z4I0      QLRLEVEISEISRRYGPKHPQMVKVLSELESVKSKLDIE---------------------
A0A2J0LS24      QLRLEVEISEISRRYGPKHPQMVKVLSELESVKSKLDIE---------------------
A0A2H0LEC5      LTQVKQERIEAETRYREKHPILQELLKREAEMEAAFKQQ---------------------
A0A1G1JZ27      ---LKKELTELNEKYLPKHPKIIRTQERIRVIEEQFGGG---------------------
A0A1G1K375      ---LKKELTELNEKYLPKHPKIIRTQERIRVIEEQFGGG---------------------
A0A1W9RLH0      KAELETELAQQLNYFKEKHPIIKGLKAELNSINKKIEEE---------------------
                              :   **           :                            

A0A1G1IP08      ISQRKDRFSLIVESHTDMKSLTDAEVDLQTMKPLLEQEVNTNKELYNSLFKKLQEVELSG
A0A2J0KU82      EAEANERTALLALTEQEKKALELNRMAIEY--NVLKRDTETNREMYEALLKRMKETDISG
A0A1G1K0W1      -----------------------------------------IQKIVSGL-----KSGLSG
A0A1G1K4H2      -----------------------------------------IQKIVSGL-----KSGLSG
A0A1G1LHA8      -----------------------------------------IEKIISAL-----KAGLTG
A0A1G1KQI3      ----------------TQKIVA------------------------------NLKSSISG
A0A2J0LFS5      ----------------TQNLINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSE
A0A1J4VP59      -----------------------------------------SETILSNV-----KANLAG
A0A1G1PGV5      AVQAKEQELQQALVEQERLALGLNRLKLDY--ENLNRQAQLSVDLYNSLSKRLKELEVVQ
A0A3C0MWS5      ----------------------------------KETGLEGSKAVHDRY--KEQLRGALA
A0A2H0LL91      -----------------------------------------VQ-IKRVV--HELKTALSK
A0A1V5SP48      -----------------------------------------AR-TDEVI--ASVKAELEG
A0A1G1JR53      ----------------------------------KKSVYDYDN-IEDYL--KPEAQHQLA
A0A1G1KL63      ----------------------------------NMPIHDYSK-MEESL--KSDSGRTLA
A0A351I6G3      YAAEEEGKLKKLLDERKEEALEVERKIIEY--NALKRELETNKRILDIVLNRMKETAISS
A0A2J0LAF9      YAKEEEAKFKKMLETQKNELLALERKVIDY--NALKRELETNERVLDIVLNRLKETSISS
A0A2J0LM30      YAKEEEAKFKKMLETQKNELLALERKVIDY--NALKRELETNERVLDIVLNRLKETSISS
A0A0F0CSR3      ----------------KTKELKIKDIEIEY--NILLREVETRKEVYESLLKRIRETEITG
A0A1G1IVX7      ----------------ETRKIDIGGVAIQY--DELEREAESARKVYRALLERLEQTHSEA
A0A1J4Z4I0      ----------------TQNLINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSE
A0A2J0LS24      ----------------TQNLINLNRKAAQY--TILKREVDSNRDIYETLVKRAKETGVSE
A0A2H0LEC5      ----------------EKKALEFTRLSIQY--NVLQRNSETTEGIYDVLLKRLKELSVEG
A0A1G1JZ27      ----------------ISKDFASGEISTQY--NQLQREVDSQGKIYEAMLSRLKETSASE
A0A1G1K375      ----------------ISKDFASGEISTQY--NQLQREVDSQGKIYEAMLSRLKETSASE
A0A1W9RLH0      ----------------RQRLLALKEKAIRY--RILKREVETNKAIYESLLNRLKETKSIQ
                                                                            

A0A1G1IP08      SRNVWLDAKVIEKAAVPGRPIRPNKQMNLLLGLLLGGFIGTGLAYFLEYLDSSLRSLNDL
A0A2J0KU82      GLQA-SNIRVIDKAEVPKGPIKPRKSTNIIMAIFIGILSGAAAAFTLEYLDDSIRNQRDI
A0A1G1K0W1      EFSA-SNMKVIERAEIPTKPSGPKRLVMVSLSTLIALFLSIVLAVQLNNLDLNIKAEEDV
A0A1G1K4H2      EFSA-SNMKVIERAEIPTKPSGPKRLVMVSLSTLIALFLSIVLAVQLNNLDLNIKAEEDV
A0A1G1LHA8      DFTI-TNVKVIEPAAIPSRPSGPKRSIIVLASAAVSFAGSLLLVVFLHHLDQNISSEEDV
A0A1G1KQI3      RLQI-SNVRFIKRADPPMSPSGPDRKKLLLIVVLGYLFASSLIVILLDQFDDRIKGQEDI
A0A2J0LFS5      QLEA-TNIRVVDPAEVPDRPIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDV
A0A1J4VP59      EANI-TNIKVLEEAPVPKNPSGPNRFRGILSWTLIGFCASASLISFFEYANQKVRTKNDV
A0A1G1PGV5      SMQS-NNVRIVDGAKLPDGPIAPHRVRIVLQGLLLGLVVGGGLAFLQDLMTTTIRMRRDL
A0A3C0MWS5      GLKA-NNVSVVEYAQDPIEPVKPNKLLNLLLAIVTGLFGGVGLALFFEYQDATIRSVEDI
A0A2H0LL91      RLQV-SDVRVVQAGEPALLPEGPKRLRLILLFIILELLLSFGFVILIDYIDDRVKNQDDI
A0A1V5SP48      KLRP-NNIRILDRAQTPKIPIDSPKIPNILKGILAGILLGLGLIYLLEKIDTTVKTQEDV
A0A1G1JR53      GFKA-NNISVQDSAEIPVVPIKPKRALNIVLAVVIGIMGGIGMAFFSEYLDDTAKSIEDV
A0A1G1KL63      GFKA-NNISIRDPAEKPVTPIKPKKRLNFLLSIVIGLLGGVGLAFFFEYLDDSVKTVDDI
A0A351I6G3      KIQT-NNVRIQDIAEEPKRPIKPKKTLNIALSIVLGIIGGLTLVFFREYMDTTIKNSNDI
A0A2J0LAF9      QVQT-NNIRVQDLADVPKKPIKPRKKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEI
A0A2J0LM30      QVQT-NNIRVQDLADVPKKPIKPRKKLNIAFAVVMGLAGGIGLAFFREYMDTTIKDPDEI
A0A0F0CSR3      GLKT-TNVSILDIAQVPTKPTRPNKKLSLIITLFISVLSGSALAFLIEALDQTLKTPEDI
A0A1G1IVX7      KAQA-SNITVVDKAVPEPRPARPRPFLNLLMALVLGLMGGVFSAFLAEYLDPTIKIPDDV
A0A1J4Z4I0      QLEA-TNIRVVDPAEVPDRPIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDV
A0A2J0LS24      QLEA-TNIRVVDPAEVPDGPIRPNKKNNIILACLVGLMLGVSTAFFIEYIDNTVKDPDDV
A0A2H0LEC5      NLQA-NNIRIISRAKIPKSPIGPNRQRGILVGIFLGLILGCGQAILREMLSKTLRNRREF
A0A1G1JZ27      GIED-TNVVVIDRAEVPTRPVAPRFFLNVFLSILVGAFGAAALCIIFESLDNTVKTPEDI
A0A1G1K375      GIED-TNVVVIDRAEVPTRPVAPRFFLNVFLSILVGAFGAAALCIIFESLDNTVKTPEDI
A0A1W9RLH0      NLRL-TNIRVVDRATVPIKPVRPNKKMNFVLALFIGLFLSTGAALLIENLDLSIKEPDEV
                      :  . . .     *  .     .          .                  :.

A0A1G1IP08      RSYLKIFPLGMVPMVELPELEKQIDLAENPELTRTWWNTNDGTLPLY--------VAEAY
A0A2J0KU82      EAYIQLPFLGHVPIV----------------------RTKGATVGLYANLYPRSEVSESL
A0A1G1K0W1      RQ-IPMPFLGYLPQLDTL-----AGD-----------TKSDRRENLLEHVLTDMRLMDDI
A0A1G1K4H2      RQ-IPMPFLGYLPQLDTL-----AGD-----------TKSDRRENLLEHVLTDMRLMDDI
A0A1G1LHA8      RK-IPATFLGYLPLISGL-----NGR-----------SKNGAKSNLLHRALSDSRLIDSI
A0A1G1KQI3      ERYLHLPYLGHLPLI-------RKQD-----------VKSNQERALYSHHKPDSEVAEAI
A0A2J0LFS5      TNYIGLPFLGYVPSA-------RK-E-----------ARTEDEIDLIVYQKPHSVISEAY
A0A1J4VP59      IS-LGICFLGYIPLV--KEFLKGQKY-----------HEFSEEPDLVRVLKANATLADAV
A0A1G1PGV5      EELVNLPFLGHVVRV---------PL-----------PRGRRGGALFFSRHPDGVAAESL
A0A3C0MWS5      EKLTSWSFLGKVPVIPGS------------------------KKEFSTHLKPEDFTSEAY
A0A2H0LL91      ERFVRLPYLGHTPVLRLE-------G-----------EKNKSKGYFYVYANPQSDLAESL
A0A1V5SP48      QQSLRLPFFGDFPFLKGGDKMMTGPE-----------SLLKLDSNI--------PASNAI
A0A1G1JR53      EEIAPWPFLGSVPRMKGR-------G-----------KRAELEKDVRVQRLPRDPVSESY
A0A1G1KL63      ERICEWPILGCVPDIDSRISVEEAAS-----------PLGELEKDIFVSIKPKDPIAEAY
A0A351I6G3      VTLLQLPVLGSVPRI-KP----DGKN-----------IRNKIDADRVVEKDSLCMASEAY
A0A2J0LAF9      AGLLQIPVLGSVPRV-RV----DGIS-----------IKQETDIDRIVEKDSASLVAEAY
A0A2J0LM30      AGLLQIPVLGSVPRV-RV----DGIS-----------IKQETDIDRIVEKDSASLVAEAY
A0A0F0CSR3      KKFLNIPPLAGIPLP-RD----EEDK-----------LISPEFITSKKPRST---IAEAY
A0A1G1IVX7      EKGLGLDLYGMIPKAGRI----NASS-----------AQGEIFSKWEIVPNP---AAEAI
A0A1J4Z4I0      TNYIGLPFLGYVPSA--------RKE-----------ARTEDEIDLIVYQKPHSVISEAY
A0A2J0LS24      TNYIGLPFLGYVPSA--------RKE-----------ARTEDEIDLIVYQKPHSVISEAY
A0A2H0LEC5      EGTLQIPFLGALPDI--------HVG-----------RAHKGKEKLFLIKQPQSTEAESL
A0A1G1JZ27      EKLGELPLLGVVSHW--------EAA-----------QKQ-----LVVHEDRSSGVAEGF
A0A1G1K375      EKLGELPLLGVVSHW--------EAA-----------QKQ-----LVVHEDRSSGVAEGF
A0A1W9RLH0      QKYLGLPLLGTIPLY--------KQK-----------KDKSTHPALSIFTDSHSPALESY
                         .                                               :  

A0A1G1IP08      RIIRTSLAFGSL-DKTIKVLQVTSAVKGEGKTTTVCNLGISLAQAGIKTLLIDADMRRPS
A0A2J0KU82      RSVKTNINFTLT-TPPPHALLLTSVAPQEGKTSLSSNLSIVMAQGGDRVLLVDADMRHPT
A0A1G1K0W1      TNIRAAVLFSMPADRS-KLLMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPA
A0A1G1K4H2      TNIRAAVLFSMPADRS-KLLMFTSTIPEEGKTTVASLFGMSLAHGGEKVLLIDADMRKPA
A0A1G1LHA8      TNMRAALLFSMPAERS-KRIMCTSAIPEEGKTTVLGLLGISLAQIGERILLIDADMRNPS
A0A1G1KQI3      RYIRVGINFSAP-PEILRCLLVTSSLPQEGKSFTAANLAVSMALDGNKVLLIDADSRRPV
A0A2J0LFS5      RSIRTSILFAFA-GKPSKTILMTSSSPQEGKTSAAINLGITMANTSEKVLFVDADLRCSR
A0A1J4VP59      ANARTHILFSMPYEKS-RRIMLTSAIPDEGKSTVAALLAVSLTTLGRKILLVDGDLRKPS
A0A1G1PGV5      RAVRTTLEFLLP-ERTTQRVLITSSLPQEGKTTVSSNLAVSLQELGRRVVIIDADMRRPT
A0A3C0MWS5      KSIRTQLLLLDTKTHPLKTIVFSSIGPQEGKTLTVCNLAIAIAQSQKRVLLVDADMRRPR
A0A2H0LL91      RYIRVGINFSAPPDM-LRAFAITSSIPQEGKSFCSCNLASSFALDGNKVLLVDADNRRPV
A0A1V5SP48      REIRIGLNFLTIKNTPPKTFLITSSVPKEGKSLLAVYLAFSFAKSGANTLLIDADLRLPK
A0A1G1JR53      RSIRTSILFSSTEERPLRSVVVTSPGPQEGKTTTLCNLGISIAQNGSKALLVDADMRKPR
A0A1G1KL63      KSIRTRLSLSSTEEHPLKSVLITSPGPQEGKTITLCNLSIALAQNQKRVLLIDADMRKPR
A0A351I6G3      RSIRTNLLFSLKDSGYSKSIAITSSVPKEGKTISAVNLAIMMADSGESVLLVDSDMRKPR
A0A2J0LAF9      RSIRTSLLFSLEDSRSAKSIVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSR
A0A2J0LM30      RSIRTSLLFSLEDSRSAKSIVITSSLPREGKTVTSVNLSTMIANSGEKVLLVDADMRKSR
A0A0F0CSR3      RSLRTSILFTAIEHKR-KSLLLTSSCPQEGKTTTAINLAVVMAMAGEKTLLVDADLRQPR
A0A1G1IVX7      RALRTALVFKLRHMKGCHALLVTSPNPEEGKSTVALNLASAFQQNHFRALLIDADLRRPR
A0A1J4Z4I0      RSIRTSILFAFA-GKPSKTILMTSSSPQEGKTSASINLGITMANTSEKVLLVDADLRCSR
A0A2J0LS24      RSIRTSILFAFA-GKPSKTILMTSSSPQEGKTSAAINLGITMANTSEKVLLVDADLRCSR
A0A2H0LEC5      RAIRTTAEFLLPAQQSSHVLIITSAIPEEGKSLVSLSLAISLAELERRVVFIDADMRRPT
A0A1G1JZ27      RAIRTSLLFSSP-DHPLRTLVITSPFAEEGKTIVACNLAATIAQSGARVLLVDADMRRPR
A0A1G1K375      RAIRTSLLFSSP-DHPLRTLVITSPFAEEGKTIVACNLAATIAQSGARVLLVDADMRRPR
A0A1W9RLH0      RTIKANLTLSNP-DLAKKLLLITSSVPNEGKSVFSVGLARIMAQAGEKVLLVDVDFRHPN
                   .    :        . .  :*    ***:     :.  :       :::* * * . 

A0A1G1IP08      LHHILHIDDRNQGLSTILSGDPLL-SAKDFVRPTTI-ANLY-----CMTAGVIPPNPAEL
A0A2J0KU82      VHKIFKTEN-SKGLRDYLSGAADF-DS--VVQKSMV-ENLS-----IVASGRVPPNPVEL
A0A1G1K0W1      LHQIFGLEN-KIGLSHCLVGTAKPQEA--IQKIDKI-PGLS-----IMTAGVTPPNPAAL
A0A1G1K4H2      LHQIFGLEN-KIGLSHCLVGTAKPQEA--IQKIDKI-PGLS-----IMTAGVTPPNPAAL
A0A1G1LHA8      LHQVFGLKN-ECGLSNCLIGSSRARDV--IQVVEGV-PGLH-----LMTAGARTPNPPVL
A0A1G1KQI3      GHRIFQLRN-EVGLINFLTSNISF-ES--VIQPSGVNEHLF-----VMPSGPTSPNPSEL
A0A2J0LFS5      LHKSFGIQK-ENGLSDYLVGNITL-DA--AIKPTRI-ENLS-----LLTAGSTPPNPAEL
A0A1J4VP59      LHNYLGFRN-DKGLTDYLVGAATI-DE--IIQPMRN-NPLQ-----LITAGSVSRNPSEL
A0A1G1PGV5      LFRTFQVPI-EPGLSTYLQGQAALEEI--LQTPAHV-QGVT-----VIASGATPPRPADL
A0A3C0MWS5      LHEVLKVKD-GKGLCSFLSEKAAL-EE--LVRKTDI-ENLY-----FVADPYSCANSTEL
A0A2H0LL91      LHTVFNMDN-DYGLINYLTSDVTL-ES--ITRKTDV-PGLD-----FIASGPESPNPSEL
A0A1V5SP48      LHYSMNVRQ-SPGFADLLRGTMSP-DS--VIVRTGI-PDLS-----ILTAGQSNDNPSEL
A0A1G1JR53      LHEIFNIEN-KNGLSDFLCGRIEF-VS--SVKATDI-EGLS-----ITNGGTHPPNPSEL
A0A1G1KL63      LHKVFKKEN-VSGLSSLLSGQAVF-DN--IIQKTDI-TNLY-----FISGGILPPDPSEL
A0A351I6G3      VHTVFNIDN-VSGFSNYLAGQVDF-DR--IIKYTGI-NNLS-----VIPAGSISHKSAEL
A0A2J0LAF9      LHTIFNMDN-QTGLSQFLMGEKGL-ID--IINPTAV-DNLY-----IVTSGKSTHKPAEL
A0A2J0LM30      LHTIFNMDN-QTGLSQFLMGEKGL-ID--IINPTAV-DNLY-----IVTSGKSTHKPAEL
A0A0F0CSR3      IEKVFNLKD-KLGLSDVLIGNAKW-EQ--MIIETNI-KNLF-----ILPAGSIPPNPSEL
A0A1G1IVX7      LHKALGEGC-ERGLSDVLEGQCD-------IVSAVR-RNVAGFGFDFLPAGSRLDHPTEL
A0A1J4Z4I0      LHKSFGIQK-ENGLSDYLVGNITL-DA--AIKPTRI-ENLS-----LLTAGSTPPNPAEL
A0A2J0LS24      LHKSFGIQK-ENGLSDYLVGNITL-DA--AIKPTRI-ENLS-----LLTAGSTPPNPAEL
A0A2H0LEC5      VHASVNLPL-DPGLSGFLEGKVDPGDL--IQTSSEA-PGLS-----VITAGSQPAQPTDL
A0A1G1JZ27      VNQVFQQNG-VHGLSHALTDSANP-SG--FIQKTKI-ENLS-----VLFCGPLPPTPSEM
A0A1G1K375      VNQVFQQNG-VHGLSHALTDSANP-SG--FIQKTKI-ENLS-----VLFCGPLPPTPSEM
A0A1W9RLH0      LHEVFGVQR-THGLSDLLAEGIQDIHN--YIKKTNV-ENLD-----LLTCGSLPPDPAEL
                    .       *:   *                     :                .  :

A0A1G1IP08      LSSRRIKSMLDALKEEFDMILIDSPPVISVADSPIISSHVEGTILVSRAGFIPRHICLHA
A0A2J0KU82      LDSPRTKLFLKEAKAKFDRIIIDSPPIIAVSDALILAKLVDGVVYIVRGSKTSREAAFEG
A0A1G1K0W1      LGSSMLERLIQELEPHYRRIVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNIAKKM
A0A1G1K4H2      LGSSMLERLIQELEPHYRRIVFDGPPGLHIIDSLLLSAKVHGTILIFGFGKIHRNIAKKM
A0A1G1LHA8      LGSASIDRLIREIELDYHRIIFDVPPSLHIADGLILAGKVDGTVLVFRAGKVHQKIGRRM
A0A1G1KQI3      FASGRMKELVQLARTQYDRVVIDAPPLTGIGDGFVLGGVVGHLILIVMAGKTSRYAVSAI
A0A2J0LFS5      LHSGKMKAFLEDAIKKFDRIIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRT
A0A1J4VP59      LASERFRELLDRCGERFDRIVIDVPPVLYIPDGLIVAKIVHTGILICGADMVNKETIQEV
A0A1G1PGV5      LASPKMGQLLEQLSASFQYILVDTPPVLAVADSTILSRVVDSAILIVRANRTTRENLSST
A0A3C0MWS5      LSAQKISDFLAFARKNFDYILLDSPPVGIVSDATLLSTLADGLVLVVESGKTPRKAIVRQ
A0A2H0LL91      LGSEKMAEFIQKAKSQYDRVIVDAPPLVGIGDGLVLGKLIGHLILIIRSHRISRKVIRQI
A0A1V5SP48      FSRPNVPELFHQLSSQYDKIIIDSPPSLMIPDALLLARIVESTILVIRSGKLSANSIVKL
A0A1G1JR53      LSSQKMKYFIQEAERKFDFLLFDSPPVGMLTDAMIFSSMVDGMIMVIESSKTSKRTLARI
A0A1G1KL63      LASGKTKESIAKAGEKFDFVLIDSPPIGILTDATILSSIVDGIIVVVESGKTSKKVLARV
A0A351I6G3      ISSKNAKLFLEKAGARFSKIIFDAPPVALVTDAAVLSGLCDGVILIAEADRTTKDLLNNS
A0A2J0LAF9      LSSSNMKLFLEQAGGQFSKIIFDTPPVCLVTDAAILSSICTGTVLIAEGSRATRELLKRS
A0A2J0LM30      LSSSNMKLFLEQAGGQFSKIIFDTPPVCLVTDAAILSSICTGTVLIAEGSRTTRELLKRS
A0A0F0CSR3      LGSGKMTTFLEDIDKKYDRIIIDSPPVLAVTDAVILSGKVDGTIIVARASHTHRHAICQA
A0A1G1IVX7      LGTETAAKLFTALRQEYDMIIFDTSPYLAVADVAVLSEHADVGVIVARYHKTDKRHLKDV
A0A1J4Z4I0      LHSGKMKAFLEDAIKKFDRIIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRT
A0A2J0LS24      LHSGKMKAFLEDAIKKFDRIIIDAPPILMVTDAAILANIVDGVIMLVRCGKIHIEIVSRT
A0A2H0LEC5      LISGKMKDLIHQLRDEFQYVILDTPPVLAVADTTALASLTDGIIYVVRAGRTPRDVTLAG
A0A1G1JZ27      IGSQKMHQLIEKLKGQFDYVLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARG
A0A1G1K375      IGSQKMHQLIEKLKGQFDYVLFDSPPFLVVTDPVVLSTFVDGVIIVTRYNKTPKDVIARG
A0A1W9RLH0      LGTKKMEELIQELSKRYDRIIFDAPPVLAVTDALVLSTKVDGVIIIVRFEFTHRKALQRT
                :        .      :  ::.* .*   : *   ..      : :              

A0A1G1IP08      KHAVEA-VNGRIIGGILNCVTSHQHSSYYGYGYYYGKGYGYSYYGSDEKQG--GKKKKKR
A0A2J0KU82      KRRLLD-IDAKILGIALNYIDIRKERYYY-YGYYYG-GQGKRRKTEEDEVGKIGSQTAVS
A0A1G1K0W1      KERILS-AKGTLIGAAINGTDYK-KLDYASYTYYQKYSKYYGVSKAGD------------
A0A1G1K4H2      KERILS-AKGTLIGAAINGTDYK-KLDYASYTYYQKYSKYYGVSKAGD------------
A0A1G1LHA8      KEKIDA-AGGVIIGGVINRADFK-RLDSTYSRYYRQYTKYYHRRDGSKTEELSRLEPVHQ
A0A1G1KQI3      KHRLVD-SNIKIVGVILNSLDVE-RERYGYYRYHYYTYQRYYGKKK--------------
A0A2J0LFS5      KQKLQD-SKANILGVLLNNVDYG-KESY----YHYYYYSDEEKKKNV-------------
A0A1J4VP59      KEKFDS-IGYSFIGAIINRADFE-REGYRYKYYGTYKSYYKPR-----------------
A0A1G1PGV5      QRILTQ-SPLKFVATILNDIRPEYEYQYYRRGYSYYTKRPPSTPVPAQSPG---------
A0A3C0MWS5      RKALDG-AGIKVAGVIINKAVIS-GSEGYYYSKSYHRMK---------------------
A0A2H0LL91      RERLQQ-HQIKVLGVILNHLDME-KDRYGYYRYHYHTYNRYYGKK---AIKRKEKKERRH
A0A1V5SP48      KEKFDA-IGAPLTGFILNGSRLE-KIQH-YSSYYKSYYNKAHATKKKPAFKPKNKKPAIV
A0A1G1JR53      YKLINS-AGVRVVGIVLNKISIH-GDDY-YHRYYRHYYGKP-------------------
A0A1G1KL63      CQIINE-SKTHVIGLLLNKISIT-PVNN-YYSYYYGNSNNPPKSK---SIRDRFSSDMII
A0A351I6G3      KELLHK-AGANIIGVILNNVSLT-RNSYYYPQYYYGKYYKPLNAK---------------
A0A2J0LAF9      KEILGK-VDARMLGVIVNNISMV-RDGYYYPQYYYGRYYVPSRSK---------------
A0A2J0LM30      KEILGK-VDARMLGVIVNNISMV-RDGYYYPHYYYGRYYVPSRSK---------------
A0A0F0CSR3      KELIETVDTAHIVGMILNMVSINIGSGYYYYYYGKYGKYGKTPKKNTTVSAS--------
A0A1G1IVX7      RRIFGE-GNLKTFGIVMNLVEPR-ERHYYYHRYYYYGYGGDTPPK---------------
A0A1J4Z4I0      KQKLQD-SKANILGVLLNNVDYG-KESYYH--YYYYSDEEKKKNV---------------
A0A2J0LS24      KQKLQD-SKANILGVLLNNVDYG-KESYYH--YYYYSDEEKKKNV---------------
A0A2H0LEC5      KTRLTD-VGAKLIGGVLNGTQPE-K---RYVHYYYYQGARKARR----------------
A0A1G1JZ27      KQKFLG-VQAKLVGVILNDVDLE-QERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQD
A0A1G1K375      KQKFLG-VQAKLVGVILNDVDLE-QERYRYPAYSYYHDPLSEKGKADIPSLVAKVASDQD
A0A1W9RLH0      KETLER-VNAKILGAVLNMVNPR-GGSYYY--YYYYH--YGKKG----------------
                   .         .  :*                                          

A0A1G1IP08      SAGAAPGKLEKLMMLK-----------EPVIDMISSTVSNIISILKSGQPRK
A0A2J0KU82      ESEGEAVKAEELTQSKQLTDVEKIAKAEPSVENKSKRPAFLRKLKRKPQSLS
A0A1G1K0W1      ----------------------------------------------------
A0A1G1K4H2      ----------------------------------------------------
A0A1G1LHA8      ----------------------------------------------------
A0A1G1KQI3      ----------------------------------------------------
A0A2J0LFS5      ----------------------------------------------------
A0A1J4VP59      ----------------------------------------------------
A0A1G1PGV5      ----------------------------------------------------
A0A3C0MWS5      ----------------------------------------------------
A0A2H0LL91      HKKAS-----------------------------------------------
A0A1V5SP48      PPAGS-----------------------------------------------
A0A1G1JR53      ----------------------------------------------------
A0A1G1KL63      KRAGKWAKLLANKISSILKKSVSK----------------------------
A0A351I6G3      ----------------------------------------------------
A0A2J0LAF9      ----------------------------------------------------
A0A2J0LM30      ----------------------------------------------------
A0A0F0CSR3      ----------------------------------------------------
A0A1G1IVX7      ----------------------------------------------------
A0A1J4Z4I0      ----------------------------------------------------
A0A2J0LS24      ----------------------------------------------------
A0A2H0LEC5      ----------------------------------------------------
A0A1G1JZ27      SAISSHPPRNFSPK--------------------------------------
A0A1G1K375      SAISSHPPRNFSPK--------------------------------------
A0A1W9RLH0      ----------------------------------------------------
                                                                    

© 1998-2019