BYKdb

Dataset for cluster orphancd of phylum candidatus-raymondbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F7F7S3      MQTPSVDPSRSAGLPEIVRHYAELFRRKKWLLLIMCLIATGLAGYCIIAFDLLKHAQPAT
A0A1F7F7U0      --------MEHAGKTFNLKDYVTIVLRRKWSLLVIVLAVVAPLIFYVRTMPDTYFAQSQL
                           ** .  :. *. :. *.** **:: * ...   : : ::    .**.  

A0A1F7F7S3      VLIGIDRPLVGNGTIGQESMGPKKIELIRSRALLQRVVADLSLCLRLEKGMREEFFDSIA
A0A1F7F7U0      VIEDLR---------NTNPMTPQMLRPSRSFDFYQGIFNSRSFIQAVLQKVGRDTLAKAA
                *: .:          . :.* *: :   **  : * :. . *:   : : :  : : . *

A0A1F7F7S3      LGPTAVYGTYRVRWDPASKQALTVYLSKAPPVYRGEAVFRSDLSKSAILEIPGTFLRLNE
A0A1F7F7U0      --------------GDTVEDKLAAYIASSISLSRGGF-----------------------
                              . : :: *:.*::.: .: **                         

A0A1F7F7S3      RFIRNPGTFTFSIVSTRRATDNILDNMTIEGPTSRKENYFTITLSGRDYALTTKIVNAIA
A0A1F7F7U0      ------------------------------------ESFIVLSARASHAGMAFNLAQSAT
                                                    *.::.::  .   .:: ::.:: :

A0A1F7F7S3      DLFVLQNLSFEKRRVHERIETLGKQLELARKQLATSDYALRDFLTANPASALDKQAERTL
A0A1F7F7U0      EIFKLKCREVVAEEAENTVKETEKQLAIIRDKLEEAEHAYRQYL----------------
                ::* *:  ..    . : ::   *** : *.:*  :::* *::*                

A0A1F7F7S3      GSLVQQESRGLELESFLNDAATLQKEF-----ALAPGEGRIDIVREILILL---------
A0A1F7F7U0      ------DKTGNSFDGATTELKLLQDKYYEIRSEWASKEAIYEANRQSLAMLERKVAPANT
                      :. * .::.  .:   **.::       *. *.  :  *: * :*         

A0A1F7F7S3      SSKNVIRASVLQSELSRLLLEKDALER---TYSKGHPLVQ-------------ANQQKID
A0A1F7F7U0      DPKNAEQYNKAKEELRKKEKEKKRLESLGLVLGPSSPINQDIDQLEKEVMRYGAKEERLD
                ..**. . .  :.** .   **. **    . . . *: *             *:::.:*

A0A1F7F7S3      GLALQASQALNDFYQD-------ISRKVSEKKDNISQLSTRLRSLPQKGMQLAELQRVQQ
A0A1F7F7U0      AKVVGQWQKMRTVVAENEMELDLVNNKMKVYQRKIEQYKKSHPDELDQSLEVSRLERSRK
                . .:   * :. .  :       :..*:.  : :*.* ..   .  ::.:::: *:* .:

A0A1F7F7S3      INSESYSMLMSRFNEAKVEDAVEVSDAFVMD---YAVEPLPMPPMQKLLITLVLSLLAGL
A0A1F7F7U0      VYEDTYNILLEQVEVAKIKKASETGGVTVVDAVYYPTSAVPRKEAIYYVVGIMVALMLGF
                : .::*.:*:...: **::.* *.... *:*   *....:*       :: ::::*: *:

A0A1F7F7S3      ITSIAPIVFFDQYRRTAFSEIDLFKLIDIPILESIPVLRPAPQAQRTARERREAAGKPKP
A0A1F7F7U0      -----GYIFLREFLDTTVKSNDDLEAYNIPIIGTIPHIDIAKSEEIEIR-RRSSSSSSKE
                       :*: ::  *:... * ::  :***: :** :  * . :   * **.::...* 

A0A1F7F7S3      SPLLITEGVLPVYAK-----EVFRSLRTKILLSFLGINQRSILITSLDSGAGKTIVAANH
A0A1F7F7U0      AVTTYPKELINFYKDESIVAESYRSLRTNLFFTSPDNPLHTLIVTSSGPHEGKSLTASNL
                :    .: :: .* .     * :*****:::::  .   .::::** ..  **::.*:* 

A0A1F7F7S3      GITLAQHGLKTLIVDSDLRRGTLHSVFGLKQSPGLSEYLGDNSEGPLPESIQHTAISGLD
A0A1F7F7U0      CLACAQMGKRTLLIDSDLRRPVVHHLFQQPRENGFTDLFIGNS---LKSVVRETGLDNLH
                 :: ** * .**::****** .:* :*   .. *::: : .**   * . :. *.:..* 

A0A1F7F7S3      VMASGQLVSDVSELITPFRMGQFLTTAFLLYDAVVIDTPPLGVVADAAVIHEKFSKCMIV
A0A1F7F7U0      VITAGRFTPNPSELLASKKIEKLIGELKLEYDLIVFDTPPVMAVTDAPLLSTKVDGTLLV
                *:::*.:..: ***::. .: :::    * ** :*:****: .*:**.::  *..  ::*

A0A1F7F7S3      VKAGVTDINDLNEKLKEYPPIRNKIVGIVLNQARRDQRFKYYRSSPYIS--------
A0A1F7F7U0      VKSYSTDRVILERAINTIQNVNANILGFVLNDIDLSHRYASYGYYKYYYHYYRSKKD
                **:  **   *:  ::    :. :*:*:***:   .:*:  *    *          

© 1998-2019