BYKdb

Dataset for cluster orphancd of phylum candidatus-rokubacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

53 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      MPRVFGHYVPARLLTLAAGEAAIVFGSVFLGLALPLVGFHVIRPAWGDGFAPSMVLTTLV
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      LSMAHIAALYDTRQDYGRAELLLRLTIAFVAAYLVIAMLGYFILHLTLARKAFLLSFVTA
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      FPASFLLRLVHGRLTAQSRARRKVLLLGSGEVSQMIAATVRASRHTYEVVGRLDANGRGG
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      DGSDGVWSLGTLEDLDWVSKVTRPDVIVVALEERRGTLPVSEIVESKLQGTEIEDWPNFY
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      EKLTGKIPVGNLRPSWLVFADGFKPARITVLTKRTIDLLGSLCVVMLSLPVMLLIAVAIR
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------------------------------------------------------------
A0A2V7A3P7      LDSPGPVFFRQERLGRFGRVFLMFKFRSMLQGEGAALPSPTGGQAGHHGLGPGQEPVRCD
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      -------------------------------------------MDQPKSSEYVRLLRRVA
A0A2V7A3P7      RREHLGQIGIRPLLHQEHVDLSRHADPAPHRPDRAFHEGIRRMEAKTSSVDYVRLLRRVA
A0A1Q7G9Y1      --------------------MVRGRTRGGGTSLGYRLPPGGETPPGEEWRGYFGSIKR--
A0A1Q7TX95      --------------------MVEELSGPH--------------------VGYLGLLRRIA
A0A2V7B9E3      --------------------MVEELSGPH--------------------VGYLGLLRRIA
A0A2V7AVY2      ---------------------MDAKTTGS--------------------IDYLRLVRRVV
A0A2V7C3J3      ---------------------MDAKTTGS--------------------IDYLRLVRRVV
A0A2V6VAA8      ---------------------MDAKTTGS--------------------IDYLRLVRRVV
A0A2V7CNK3      ---------------------METQKQGS--------------------VDYLRLLRRVA
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      TNRWRLVLAGFLAVALPTIVWAVFLTPDT--YEATATLFLL-PEKSDPGFLREFATLE--
A0A2V7A3P7      IQRWRLILAGFLAVVLPTMVIVILSTENL--YEASATLFIL-PETSDAGFLRDFTSSE--
A0A1Q7G9Y1      --RKRLVILVTLAGTALGVVATKLVAPYLPFYSATANIWIDGSGHRPD---RDQATAGPI
A0A1Q7TX95      SH-WRLSLIVCVGVAAPVAVWALLFLPKS--YEAVAAIFIEDPRRGSVSTLRDWMPAG--
A0A2V7B9E3      SH-WRLSLIVCVGVAAPVAVWALLFLPKS--YEAVAAIFIEDPRRGSVSTLRDWMPAG--
A0A2V7AVY2      VHRWRIIVAGFLVVVVPTVALVTLSTENL--YEASVTLFLL-PEKNDPPFLREFTSPE--
A0A2V7C3J3      VHRWRIIVAGFLVVVVPTVALVTLSTENL--YEASVTLFLL-PEKNDPPFLREFTSPE--
A0A2V6VAA8      VHRWRIIVAGFLAVVVPTVAVVSLSTENL--YEASATLFLL-PEKSDPPFLREFTSPE--
A0A2V7CNK3      LQRWRVIVVGFLAVVVPVAILVSFSTENL--YEASATLFLM-PEKNDPPFLREFTTPE--
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------MAPEDADMYLNFYALT--
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      -------------------------------------------------MYLTFYGLK--
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ------VNTLYQVILRSRSLAQGVVETL----------PKESRDELSRRIGFQ--DHALI
A0A2V7A3P7      ------ASSLYLVLLRSRSLAQAIMEAL----------PNESRDELSRRVIFR--DYLLT
A0A1Q7G9Y1      HSGQLLGASGWVNLARSYVVLDSVARGLRLYVGWEAEQDSAALWSLGLKTQFRSGEYRLE
A0A1Q7TX95      ------DASYQQAVLRSRSLAAAVVDNL----------PQDSMNELIRHAMHR--DYVLA
A0A2V7B9E3      ------DASYQQAVLRSRSLAAAVVDNL----------PQDSMNELIRHAMHR--DYVLA
A0A2V7AVY2      ------ATAVYIVLLKSRSLAQAIIEAL----------PKESREELTKRVLFR--DYLLT
A0A2V7C3J3      ------ATAVYIVLLKSRSLAQAIIEAL----------PKESREELTKRVLFR--DYLLT
A0A2V6VAA8      ------ATAVYVVLLRSRSLAQAIIEAL----------PKESREELTKRVLFR--DYLLT
A0A2V7CNK3      ------ATAIYIVLLRSRSLAQAITEAL----------PKESRDELTKRVLFR--DYLLT
A0A2V6T785      -------------------------------------MVSKFFKALEQAERDRVEREGQG
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------EKPFNPTPDPKFLYMSPAHREALAQLSYGVQERRGFMLLTGKVGTGKTTLLHAL
A0A2V6SIE8      ------------------------------------------------------AYYGTQ
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------EKPFNATPDPRFLYLTPGHREALAQLLYSVQESRGFLVLTGEVGTGKTTLLQAF
A0A2V7BAF4      --------------------------------------MSEFFRALEQAGRDRDERLAK-
A0A2V7E6Z5      --------------------------------------MSEFFRALEQAGRDRQEQLAK-
A0A1Q6YM61      --------------------------------------MSEFFRALEQAGRDRDERLAK-
A0A1Q7IM35      --------------------------------------MSEFFRALEQAGRDRDERLAK-
A0A1Q7UA97      --------------------------------------MSEFFRALEQAGRDRDERLAK-
A0A2V7DAK1      --------------------------------------MSEFFRALEQAGRDRDERLAK-
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      VMNQIRRWQ-------------------GQEVVVYSPTELATRELRESRMNFNIAKDGTV
A0A2V7A3P7      VMNSIRRYT-------------------GGAVVVYSPSEVAIRELQEARMSFVLGKDGTV
A0A1Q7G9Y1      VDSSGRRFRLLTAKGAELQRGMVGDSIGGAVGFVWVPPASALTPRRTIRFTVSSPYDAAT
A0A1Q7TX95      GQNLIRRLL-------------------GHEPVVFSPQQRAVRELLTARVRFESLPSGEV
A0A2V7B9E3      GQNLIRRLL-------------------GHEPVVFSPQQRAVRELLTARVRFESLPSGEV
A0A2V7AVY2      ATNSLRRLT-------------------GGEVVVYSPSELAIRELQEARMNFNIARDGTV
A0A2V7C3J3      ATNSLRRLT-------------------GGEVVVYSPSELAIRELQEARMNFNIARDGTV
A0A2V6VAA8      ATNSLRRLT-------------------GGEVVVYSPTELALRELQEARMNFTIARDGTV
A0A2V7CNK3      FMNSIRRFT-------------------GGEVVVYSPSEIAIRELQEARMSFNVARDGTV
A0A2V6T785      TKSPLAEPPAA-------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      -MTELQSARVT----------------------FTPLPSGEVEIRAVAYA----------
A0A2V7A9S9      RKRLTSQTAISFVFNTTLPFDGILEYILEDLGIAKGLESRAQRLIALQHFLVDRERAGEN
A0A2V6SIE8      FELLSSRPVLG----------------------RVEAALGLPKHPAFAAGGWFGR-AGQS
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      --------------------------------MPPPPAPEETEDLALASPLTSAV-----
A0A2V7F4L5      LQRLNGRAAVAYVFDSTLPFDGLLEYVLEELGVPTPERSPAQRLLALQRFMLDRRRAGQN
A0A2V7BAF4      -QRNNRKLPVA----------------------AEPPAQPEPEVPVVAKASKPRK-----
A0A2V7E6Z5      -QRNERKP--A----------------------AEPPAQPEPEVPVVAKASKPRK-----
A0A1Q6YM61      -QRNNRKLPVA----------------------AEPPAQPEPEVPVVAKASKPRK-----
A0A1Q7IM35      -QRNNRKLPVA----------------------AEPPAQPEPEVPVVAKASKPRK-----
A0A1Q7UA97      -QRNNRKLPVA----------------------AEPPAQPEPEVPVVAKASKPRK-----
A0A2V7DAK1      -QRNNRKPPVA----------------------AEPPAQPEPEVPVVAKASTPRK-----
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      TL---------------------TATAFSPRVAADLANTYVEVLLSRSSSFARQQARGTR
A0A2V7A3P7      TI---------------------TAVAFSPRVAMDLANTYVEVLLSKSSSFARQQARGTR
A0A1Q7G9Y1      NLAQRLQVELDPDGNFMQVSLRGSDPAYIAATVNAVATRFVDV----ATDLKRKRLGELT
A0A1Q7TX95      EI---------------------RAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATR
A0A2V7B9E3      EI---------------------RAIAYHPQVAKDLANTYIEVLQSRSRSHIRDEARATR
A0A2V7AVY2      TI---------------------TAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTR
A0A2V7C3J3      TI---------------------TAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTR
A0A2V6VAA8      TI---------------------TAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTR
A0A2V7CNK3      TI---------------------TAVAFSPRVAVDLANTYVDVLLSRSSSFARQQARGTR
A0A2V6T785      -----------------------------PDASSARPSDTPHPVVAPETAASVAIPGPPV
A0A2V6RB03      -----------------------MGTTVKPDVVETTVLAAAPQDATSRAGQDA-------
A0A2V6RAF2      -----------------------------PRVAMDLANTYVEVLQTRSRSNIRDEARTSR
A0A2V7A9S9      TVLIFDEAQNLDAATLEQIRLLSNFETPTDKLLQILLVGQP---------------ELRA
A0A2V6SIE8      SSFEGLDRYIEVTPVKRSRLVRITARVPDADLAAAIPNRVATEYIGMLSQERREASDAAA
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      -----------------------------------------DAFIAQQMDRMVEATRYAT
A0A2V6U1W4      ------LSRLSIEPVRSSRLVRISFESHFPDLAARVPNALADAFIAQQLDQKVEATRYAT
A0A2V7F4L5      TVLVLDEAQNLDAPTLERIRMLSNYETPTVKLLQILLVGQPELGCGRTRPRALQSPGSDP
A0A2V7BAF4      ------ESQPAAAPKAT--------PTPAPEVVATAPASTP-----RKESQPAAAPKATP
A0A2V7E6Z5      ------ESRPVVAAKPS--------PRPEPEAAAVVPTSTP-----RNEPGPSAAVEP--
A0A1Q6YM61      ------ESQPAAAPKAT--------PTPAPEVVATAPASTP-----RKESQPAAAPKATP
A0A1Q7IM35      ------ESQPAAAPKAT--------PTPAPEVVATAPASTP-----RKESQPAAAPKATP
A0A1Q7UA97      ------ESQPAAAPKAT--------PTPAPEVVATAPASTP-----RKESQPAAAPKATP
A0A2V7DAK1      ------ESQPAAAPKAT--------PTPAPEVVATAPVSTP-----RKESRPAAAPTPTP
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      ELLESLFTQARTGQVDAQDALRKFQSQTG----AAVKLPDEARVD---------------
A0A2V7A3P7      DLLENLWSQAKANQTEAEDALRKYQAKNG----GTLKLPEEAKVE---------------
A0A1Q7G9Y1      KILAAQLEHAQANLRSAETALRSFQVRTATVLPGSAIIPPEALAPGANAPPPRRPPVSDL
A0A1Q7TX95      QFIENLLAQTKANLQEAEESLAKHQR--G----GTLKLPERSSVE---------------
A0A2V7B9E3      QFIENLLAQTKANLQEAEESLAKHQR--G----GTLKLPERSSVE---------------
A0A2V7AVY2      ELLENLMAQARSSQGEAEDAMRRFQAKAG----GRFTLPDESKGE---------------
A0A2V7C3J3      ELLENLMTQARSSQGEAEEAMRRFQAKAG----GRFKLPDESKGE---------------
A0A2V6VAA8      ELLESLMTQAKMSQGEAEDAMRRFQAKTG----GRIKLPEESKSD---------------
A0A2V7CNK3      ELLENLLAQAKSHQGDAEEAMRRYQQRTS----GSLKLPDESRGT---------------
A0A2V6T785      DVGDI----------------------------------GRSPTV---------------
A0A2V6RB03      ---------------------------------------ARRGGI---------------
A0A2V6RAF2      EFIETLLNQTKTSLQQSEEQLAKVARGRSLRMPERNA--IEAAQL---------------
A0A2V7A9S9      KLSLPELQQLKQRIGLRCQIPPLAP--------------EEVRQY---------------
A0A2V6SIE8      KWLESQLGGLRSGSEATGGAVQRFVEQNDMVPS------QDGKEF---------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      QFLAKQLEEARGKLGESETQLSNFLNANGIIFVTADRN-GNPQDI---------------
A0A2V6U1W4      QFLATQLDETRDRLGEAEGKLNRFLKANNILFIAGGDKTSQAQDL---------------
A0A2V7F4L5      DCRLLGRDPAPREHSVRPL--PR----------------RRLRRP---------------
A0A2V7BAF4      -------TPAPEVVAVAPTITPR----------------NETRPP---------------
A0A2V7E6Z5      --------------PVPPHVEPA----------------IYVEPE---------------
A0A1Q6YM61      -------TPAPEVVAVAPTITPR----------------NETRPP---------------
A0A1Q7IM35      -------TPAPEVVAVAPTITPR----------------NETRPP---------------
A0A1Q7UA97      -------TPAPEVVAVAPTITPR----------------NETRPP---------------
A0A2V7DAK1      -------TPEPEVVAVAPTITPR----------------HETRAP---------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      --------LQRLTQLETSLSDVQVSREIAENRLN-----YLKGDRKSGPPTG-----DAS
A0A2V7A3P7      --------LTSLANLESQLNDLQINREIAENKLA-----YLKGDKKK--PGGMTLAADPS
A0A1Q7G9Y1      VGQSRDPVFANFLDIRVALDQLKHDRAAIERVLAQSADSGLAVDALE--LVGSVERSSEL
A0A1Q7TX95      --------MAQLAQLESNLADIQASEEIAKRRLA-----GLKGGKDS--AGMP---GRAA
A0A2V7B9E3      --------MAQLAQLESNLADIQASEEIAKRRLA-----GLKGGKDS--AGMP---GRAA
A0A2V7AVY2      --------LTALAQIESQIGDLQVTREIAENKLG-----YLKGEKVR--PISAPASSDPS
A0A2V7C3J3      --------LTALAQIESQIGDLQVTREIAENKLG-----YLKGEKVR--PISAPASSDPS
A0A2V6VAA8      --------LTALAQLESQLGDLQVTREVAENKLT-----YLKGEKSR--PGSPTASADSS
A0A2V7CNK3      --------VTALAQLEGQIADLQVSREIAENKLA-----YLKGDKPR--AGGAFPGSDPA
A0A2V6T785      --------EHARVPAPRAADAPAARPSVRASRVG------------R--EAGAPTA----
A0A2V6RB03      --------VLPRAPGSVDPQVERSRGRRPRTTIA------------H--RLQDERPSN--
A0A2V6RAF2      --------SQLENSLAEIQGSKEIAKVRLAQLKG------------K--DASGRPVPQAA
A0A2V7A9S9      --------IRRRLRIAGSHDLGLFSDAAVDRLTE------------Y--SGGIPRVIN--
A0A2V6SIE8      --------ALTQLEDLNRAYTEAENDRLQKEARA------------R--MLTSADPATAG
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      --------ITQQLSIMSEAFLRARSDRMAKESLL------------T--QASVQDAFTLP
A0A2V6U1W4      --------ITQQLTLLSDGWLKARSERIAKESLL------------A--QGNTQDVGTLP
A0A2V7F4L5      --------AATDRRRYCRPGHRGARGCGAASGAL------------A--RFAGPGSVG--
A0A2V7BAF4      --------VAVETPAPVEPELATVEAAVATEV--------------E--PEPEPEIAT--
A0A2V7E6Z5      --------VLVATA-----------------------------------------VAT--
A0A1Q6YM61      --------VAVETPAPVEPELATVEAAVATEV--------------E--PEPEPEIAT--
A0A1Q7IM35      --------VAVETPAPVEPELATVEAAVATEV--------------E--PEPEPEIAT--
A0A1Q7UA97      --------VAVETPAPVEPELATVEAAVATEV--------------E--PEPEPEIAT--
A0A2V7DAK1      --------VAVEIRAPEPEMVATIEAAVATEVEP------------E--PEPEPEIAT--
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      VQPVRERVAQLEARLDGLKEKYTEQHPLVQVARADLQEAQERLKSTVQGQQTPRPGGV-V
A0A2V7A3P7      VQALRDRLAQLETKLAALTEKYTDQHPSVQNAQADIQETQQRLAAALQPQQSPRPGGAQV
A0A1Q7G9Y1      TDALKE-LVGKRADLRALRYRYTETNPEVRRVAGTIG-----------------------
A0A1Q7TX95      RQALSERLAALEAKLATLEEKYASEHPLVKSTQAEINE----LKTALAAPPSISPGGRSA
A0A2V7B9E3      RQALSERLAALEAKLATLEEKYASEHPLVKSTQAEINE----LKTALAAPPSISPGGRSA
A0A2V7AVY2      TQSLQERLTQLEAKLAALSEKYTDQHPSVQTTRAEIQETQERLASTLQPRQTPRPGGTAT
A0A2V7C3J3      TQSLQERLTQLETKLAALSEKYTDQHPSVQTTRAEIQETQERLASTLQPRQTPRPGGTAT
A0A2V6VAA8      TQGLQERLTQLEAKLAALAEKYTDQHPSVQTARAEIQETQERLASALRPRQAPKPGGASA
A0A2V7CNK3      TQSLQDRLTQLEAKLSALNEKYTDEHPSVQTTRAEIQEAQERLASALRPRQAPKPGGAPA
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      QQQVTRRLLQLQEKLAGLRERYTDGHPLVKATQAEIKDAQDMLTAGPQGLPERVAAP---
A0A2V7A9S9      ----------MVCDHSLVFGYADQKRRIDRPIVNQAIEYLEEGASPSSQPKAVK------
A0A2V6SIE8      AALGSDLVRGLQAEEARLEREVARAGTTYGPQHPKMVELQADLANAKKRVETEI------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      AVLQSPLIAQLKTDGAAQEGEYRRLSQTFKPDYPKMLALKEKIEENRRQLRTET------
A0A2V6U1W4      AVLQNSLVSKLREDLAALESEYEKLSQVFKPGYPHMRQLAEKIAESRRQLRTEI------
A0A2V7F4L5      ---------------TLALG----------------------------------------
A0A2V7BAF4      ---------------DIQHAIYTELYPIFHPDGVEIHAAIEPELHEDIEPDIHM------
A0A2V7E6Z5      ---------------ELEPGIDTEVVPEHHAE-------VEP------------------
A0A1Q6YM61      ---------------DIQHAIYTELYPIFHPE-------VEVEIDAEVEPEMPV------
A0A1Q7IM35      ---------------DIQHAIYTELYPIFHPE-------VEVEIDAEVEPEMPV------
A0A1Q7UA97      ---------------DIQHAIYTELYPIFHPE-------VEVEIDAEVEPEMPV------
A0A2V7DAK1      ---------------DIQRAIYTELHPIFHPE-------VEAEIDAEVESEMPV------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      -----------------------------------------------MGAEEWETSKVLR
A0A2V6YHI8      ---ALKPLEAAQLSKQMADLEVEIISLQSRENGLQARIARLKKSMATMGAREQEYAGLAR
A0A2V7A3P7      ---PLRPVENAQLSKQMAALDVEIVSLQAKEDTLQQRANRLRRSLSAMSGREQEYSGLLR
A0A1Q7G9Y1      ---TLERQTIPALSRQLVE------ELRTREAELARQVESASADLRHLPSLAIDELRLQR
A0A1Q7TX95      IRLTLGPADQAAVAKQVADAEVELASLQNREDVLKQSIARLSSRLSALGAEEWETSKVLR
A0A2V7B9E3      IRLTLGPADQAAVAKQVADAEVELASLQNREDVLKQRIARLSSRLSALGAEEWETSKVLR
A0A2V7AVY2      ---QLKPIEAAQLSKQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMR
A0A2V7C3J3      ---QLKPIEAAQLSKQMAALQVEVVSLQAREEVLQQRAARLRRSLSAMTAREQEYSGFMR
A0A2V6VAA8      ---SLKPIEAAQLSKQMAALQVEIVSLQAREEVLQQRAARLRRSLSAMGAREQEYSGFMR
A0A2V7CNK3      ---PLKPLEAANLVKQMAALQVEGVSLQAREEILEQRANRLRRSLSAMSAREQEYSGFLR
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------EVFCHLSRE---------------------GSPVSKFLKALE
A0A2V6RAF2      ---QFGAAERAASAKQIADLEQEVSALETREEVLKQRLARTSQGLSNLGAEELEVAKLRQ
A0A2V7A9S9      ------LNGSRVRLLSRWSFGTLAVALADERAGP-------CPVSAPPPAPMSKFFEALE
A0A2V6SIE8      ------GKGRS-------AVQEEARAAARRAEEVGRRLDAQRQRAITQHVRQMQLTLLKK
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------DRTLA-------SLKVDFEASVRAEKSLEASLTRQSTLARGLAENMAQYNLLRR
A0A2V6U1W4      ------DRAAQ-------ALQADYQAALRNEQELEGALAQQRLQAGGLADNMAKYNLLRR
A0A2V7F4L5      ------------------------------------RGRRRGARRARPGPAMSKFFEALE
A0A2V7BAF4      ------DIETEIHADVEPEVHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEI
A0A2V7E6Z5      ------------------EIYTELVPEHHAEVEPEIYTELVPEHHAEVEPEIYAELVPEH
A0A1Q6YM61      ------DVESEIHDGV--EIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEI
A0A1Q7IM35      ------DVESEIHDGV--EIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEI
A0A1Q7UA97      ------DVESEIHDGV--EIHAAIEPELHEDIEPDIHMDIETEIHADVEPEVHAVIEPEI
A0A2V7DAK1      ------DVESEIHADV--EIHAAIAPELHE--------DIETEIHEEVEPEVYAVIEPEI
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ---------------------------------------------------MSRFFKALE
A0A2V6ZW34      ---------------------------------------------------MSKFFKALE
A0A2V6SIM1      ---------------------------------------------------MSQFWEALE
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ---------------------------------------------------MSKFFEALE
A0A2V6XML6      ---------------------------------------------------MSKFFEALE
A0A2V7CEX0      ---------------------------------------------------MSKFHEALE
A0A2V6W355      ---------------------------------------------------MSKFFEALQ
A0A2V6YDI1      ---------------------------------------------------MSKFFKALE
A0A2V7GJE5      ---------------------------------------------------MSKFFKALE
A0A2V6X2Y0      ---------------------------------------------------MSRFFKALE
A0A2V7AFT7      ---------------------------------------------------MSRFFKALE
A0A2V7BA71      ---------------------------------------------------MSKFFEALE
A0A2V7BRT3      ---------------------------------------------------MSTFFEALE
A0A2V7FF08      ---------------------------------------------------MSKFFEALE
A0A2V6YDI2      ---------------------------------------------------MSKFFEALE
A0A2V6YK84      ---------------------------------------------------MSKFFKALE
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ----------------------------------MGLSLRSRARGARSAGPMSKFVEALE
                                                                            

A0A2V6VPM0      RVETHRSLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGLG
A0A2V6YHI8      MAETQAKLTGLLADKVTAARISEQAQVRGIHVIDLAEQPRQPSSKRPLKFLLFGLLGGLG
A0A2V7A3P7      AVMTQTKLTDMLSDKLTAARITERSQIRSIHVIDLANLPRQPSPRQPLKLILFGLVGGLG
A0A1Q7G9Y1      DVVDAEQLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDAAPFLFLLSVVGSLG
A0A1Q7TX95      RVETHRSLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFG
A0A2V7B9E3      RVETHRSLYATLSEKLGTARVQEQGEDRGLRVIDRATLPLGPNNAPAKKIILLGILLGFG
A0A2V7AVY2      TVLTQAKLTDLISDKLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLA
A0A2V7C3J3      TVLTQAKLTDLISDKLTAARISEQSPIRSIHVIDLASLPRQPSPKQPLTLMVMGLLGGLA
A0A2V6VAA8      TVLTQAKLTDMISDKLTAARISEQSQIRSIHVIDLASLPRQPSPKQPLTLLFMGVLGGLA
A0A2V7CNK3      PVLTQTKLADMISDKLTAARISEQSQIRSIHVIDLANLPRQPSPRQPVKLLVFGLLGGLG
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      RAEQQRALG---------------------------------------------------
A0A2V6RAF2      SVESQRNLVTTLSEKLGTVRIQEQGEDRGLRLIDLAALPQRPSSVPAMRVILLGMVGGLG
A0A2V7A9S9      QAQQ----------------------EKAARRRTVPAAPAEPVAERAPVVTKPPAPAEPV
A0A2V6SIE8      EADVGATVYADLMKRLKEVQLAAQMRMANVKVVDPAEKPRGRSSPNHPRDLLMGLVGGLL
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      EVDTSRDLYSSLLGRLRETQVSAALLTSNISVVDPAEIPAGPSRPRKGLNLLIACVAGLA
A0A2V6U1W4      EVDTSRDLYSSLLGRLRETQISAALFTSNISIVDRAEISGIPSRPKRTTNLLVGCIAGLL
A0A2V7F4L5      RAEREQALRTPA--------------SS-------PSTTADL-----SGAQAPPAPSGAV
A0A2V7BAF4      HADVEPEIHADV--------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGR
A0A2V7E6Z5      HAEVEPEIYTEL--------------EPGIDTEVVPELHAEVEAEEETELETEVATENAV
A0A1Q6YM61      HADVEPEIHADV--------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGR
A0A1Q7IM35      HADVEPEIHADV--------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGR
A0A1Q7UA97      HADVEPEIHADV--------------EPEIRMHEEPEIQAEV--EDETEAEAAFATEGGR
A0A2V7DAK1      HADVEPEIYADV--------------EPEIRMHEEPEIQAEV--EDETEAEAACATEGGR
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      RAEQERALRVV--------------ASPPPAPPSETSPTV--------------------
A0A2V6ZW34      QAERDNVEQVS------QAPVEVVSHRPSVMTPPVVTPPP--------------------
A0A2V6SIM1      QAKRDRALQAP-------------------------------------------------
A0A2V6SBN9      --------------------------------------ME--------------------
A0A2V6TVU3      RSETEVALRTR--------------ASSPRSTEDLAASPA--------------------
A0A2V6XML6      RAETEQVLETP--------------APSPPPTVDPSASAA--------------------
A0A2V7CEX0      RADTEEALGTT--------------ASAPRRTVDVSASPA--------------------
A0A2V6W355      RAERSATPSVP--------------APA--------------------------------
A0A2V6YDI1      QAERERAVRRQ--------------T-A--------------------------------
A0A2V7GJE5      QAEHDRAVREQARRPEGKPAAAPPPTPGASREVSSATVAA--------------------
A0A2V6X2Y0      QAEHEQALRRQ---------------------------TA--------------------
A0A2V7AFT7      QAEHEQALRRQ---------------------------TA--------------------
A0A2V7BA71      RAEQERAVRFQ---------------------------AA--------------------
A0A2V7BRT3      RAEQERAVRFQ---------------------------AA--------------------
A0A2V7FF08      RAEREQATQA--------------------------------------------------
A0A2V6YDI2      RAEREADRPTP--------------ASSPRPEAGPSGSPP--------------------
A0A2V6YK84      QAERDHAQREP--------------VIPAEASSERASVVP--------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      HAERERVLGQR--------------LDGSSLT----------------------------
                                                                            

A0A2V6VPM0      LGVGVAGVIEYF-NQPIETEDDVFDATGLPVLGWLPTIAGHQ---------PTTGVEREP
A0A2V6YHI8      LGVATAVLREYA-SRVIETEQEVVAASGLPVLGSIPIARPLTGA-------PAGTK-TTP
A0A2V7A3P7      FGIGAATLREYM-TQIVETEQEVIHATGLPVLGSIPIAEHIEPL-------VKGPREQQP
A0A1Q7G9Y1      AGVLAAVLRDRV-DPKLRYPAHVTQEMGLPILGAVPHLPAANGKGGR----KLSG-----
A0A1Q7TX95      LGVGVAGVIEYF-NQPIETEDDVFDATGLPVLGWLPTIAGHQPTTG---------VEREP
A0A2V7B9E3      LGVGVAGVIEYF-NQPIETEDDVFDATGLPVLGWLPTIAGHQPTTG---------VEREP
A0A2V7AVY2      LGVSAATVREYA-VQVVETEQDVAHATGLPVLGSIPVAERSESASGR----EVAPVDDLP
A0A2V7C3J3      LGVSAATVREYV-VQVVETEQDVAHATGLPVLGSIPVAERSESASGR----EVAPGDDLP
A0A2V6VAA8      LGVGAATAREWV-LQVVETEREVTRATGLPVLGSIPVADRPGS-SEK----GAAPADDLP
A0A2V7CNK3      LGIGAAMLREHM-TQVIETENDVIRATGLPVLGSIPVAEAAES-SGK----DGAQSELMP
A0A2V6T785      -------------AAPNIVDA------------------------------AARAHASVD
A0A2V6RB03      -------------RHPAPSEAASERGLAVPET-------APPRPPRASHELAREVPNGLE
A0A2V6RAF2      LGIGLAGLLEYF-KQPMETEEDITAATGLPVLGWLPTIQGSGR--------PDKGPEREP
A0A2V7A9S9      AERAPVFSKP---DAPTFPQP-------VPRR-----VRRSSLEPSRGGSNETEEHLQME
A0A2V6SIE8      GGVALAFVREVA-DKTLRTPRDVDLLVRLPSIGAVPTIPGYRRRTLP----PVAELPGVS
A0A2V6V7G3      --------MRAA-DAPAFTES-------VPTV-------------------KDDDAESVD
A0A2V7CME2      GGIGLAFLFEYL-DTNIKDTKEVESVLRVPALGVVPSRAAFERMLARRKALEAGPGASTP
A0A2V6U1W4      GGVVLALVFEYL-DTNINIKD-------AKDVESVLRVPILGMVPSWALRRRREPADGLP
A0A2V7F4L5      EPAGPPLFERPVFESPATATE-------LAVD-------------------RSDRAEA--
A0A2V7BAF4      AATPMPFAMRAA-DAPAFTES-------VPTV-------------------KDDDAESVD
A0A2V7E6Z5      APTPMPFSMRSS-DAPAFTES-------VPTV-------------------KDDDAESVN
A0A1Q6YM61      AATPMPFAMRAA-DAPAFTES-------VPTV-------------------KDDDAESVD
A0A1Q7IM35      AATPMPFAMRAA-DAPAFTES-------VPTV-------------------KDDDAESVD
A0A1Q7UA97      AATPMPFAMRAA-DAPAFTES-------VPTV-------------------KDDDAESVD
A0A2V7DAK1      AATPMPFAMRAA-DAPAFTES-------VPTV-------------------KDDDAESVD
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ----------------------------------------------------------ML
A0A1F7NSZ2      -----------------------------------------------MAKRGKAAAPSTA
A0A1F7PJN6      -----------------------------------------------MAKRGKAAAPSTA
A0A1F7NCG6      ----------------------------------------------MARRAKPAGTVTAV
A0A1F7Q5I6      ----------------------------------------------MARRAKPAGTVTAV
A0A2V6SK79      ----------------------------------------------MRRPRQPQAGSGTP
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      --------------------------------------------------MSRHRVATLD
A0A2V6ZH60      -------------PETVPPRPSPAAPKTTPP---RAQETFFRPPRAAATAGRAERIIGVE
A0A2V6ZW34      -------------PRAPSPVDEPPAPPAESPRPVFEAPRPVFKAPRPVVRSPRVASALLD
A0A2V6SIM1      ---------------------QSLPVPAPPE-------PKGDSALRLVAEAPVEPLHRVD
A0A2V6SBN9      -------------PAAPRHLGRPVIEPPAPV-----------------TKPRVDRPNRAE
A0A2V6TVU3      -------------PEAPSVEVLPAAPRGFPR-------PVFEAPSTAINRVV-GRSNRVE
A0A2V6XML6      -------------PAAPSAEVPPTPSVRFPP-------PVREARAPTTERAV-DRSHRVG
A0A2V7CEX0      -------------PEAPSVEVPPAAPPHFPR-------PVFEAPPRATKREV-DRADRIE
A0A2V6W355      -----------------SAEPPPMMEPRLPP-------PALAPRPAVAASLR---SASVE
A0A2V6YDI1      -----------------TSEPANGQGPAVAE-------PIAYQAPRVSRGLAKGVSNGFE
A0A2V7GJE5      -------------PAAPPAARPAEPARDPADRRSVGRVWTAEAPRPKDRAEGPW--GEID
A0A2V6X2Y0      -------------PVEPAPAPRVERAPVPSS---AGTWPPPQRPVSAARASAPAFSSELD
A0A2V7AFT7      -------------PVEPALAAPVLPARTPFP---AGTWPAPRGPVSAARKSAPAFSSDLD
A0A2V7BA71      -------------PSEPTNARGPAVPETALD---PALRSAPELPRGVA--------NGLD
A0A2V7BRT3      -------------PGASTSAPDPPVPESAPD---PGLRSLPELPRGAA--------NGLE
A0A2V7FF08      ---------------SSPGTTDGP--SASPR-----IEPPVVQATAPANELAVDGSHRVE
A0A2V6YDI2      -------------PAAPPAASPPP--AAPEP-----VAPSVFKAPATATRPPVDRASRIG
A0A2V6YK84      -------------HWPEPAAEQPPVFTPPPP-----RAPRAVIESRVPVDSPRIAPALLD
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      --------------------------APAAA-----PVAEVSAALEPVRDAELPVGSPLD
                                                                            

A0A2V6VPM0      LNFVNGSIPDTLPVEGCRSIRTSLESLN--GSRKLQSIMLASAGPKEGKSTIALNLAWVF
A0A2V6YHI8      MIFVSTHDPHSLQADSCRAIRTAIDCHSLGLEHPIKTLLVTSPTAHDGKSTVLLNLALAF
A0A2V7A3P7      VLFGSGDVFYSLPADACRAIRTGLDCQS--LNRPLKTLLITSPGAHEGKSTVLLNLGRAF
A0A1Q7G9Y1      ----NGVGTAAPVIEALRGIRLSLVHAH--GTAGPLLVTITSPGSGEGKSFVAANMALAF
A0A1Q7TX95      LNLVNGSIPDTLPVEGCRSIRTSLESLN--GSRKLQSIMLASAGPKEGKSTIVLNLAWVF
A0A2V7B9E3      LNLVNGSIPDTLPVEGCRSIRTSLESLN--GSRKLQSIMLASAGPKEGKSTIVLNLAWVF
A0A2V7AVY2      MLFVAGNDLHSLPADACRAIRTVLDGPS--LDKPLKTLLVTSPGAHEGKSTVLLNLGRAF
A0A2V7C3J3      MLFVAGNDLHSLPADACRAIRTALDCQS--LDKPLKTLLVTSPGAHEGKSTVLLNLGRAF
A0A2V6VAA8      VLFVAGNDLHSLPADACRAIRTALDCQG--LDRPLKTLLVTSPGAHEGKSTVLLNLGRAF
A0A2V7CNK3      VLFVAGNDLHSLPADACRAIRTALDCQS--LERPLKTLLVTSPGAHEGKSTVLLNLSRAY
A0A2V6T785      EHLVSLLLPATFEAEQYRALRHVIEHQR--AATGLTVVAVTSPAVGDGKTTTAINLAGAL
A0A2V6RB03      EHLVSLLAPRSFEAEQYRTLRHLIEQLH--KSTGLSVVAISSPGVADGKTTTAINLAGAL
A0A2V6RAF2      MSFIDVFAPNTLPIEACRSIRVSLLSMY--RAEDVRTIMLASAGPGEGKSTVALNLSYVF
A0A2V7A9S9      EHLVSLLAPTSFEAEQYRTLRHLIEQLH--KAAELQVFAVSSPTASDGKTTTAINLAGAL
A0A2V6SIE8      LPGEAPAWPEQMAEEAFRSIRTLVFHRQ--APGTPRTMLVTSAEPGEGKSFVAVNLAVAL
A0A2V6V7G3      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A2V7CME2      FALVSHSELPSVFAEAFRNLRTSILYST--PERPPKTLMMTSLQPEDGKTSLVTNLAITL
A0A2V6U1W4      FALAAQSETASDFAEAFRNLRTSLLYSS--PDHPPKTILVTSLQPEDGKTSLATNLAISL
A0A2V7F4L5      -HLVTLLNPASFEAEQYGVLRHVMETLR--KSANLKVVAITSAGVGDGKTTTAINLAGAL
A0A2V7BAF4      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A2V7E6Z5      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TDTGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A1Q6YM61      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A1Q7IM35      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A1Q7UA97      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A2V7DAK1      DRLVTLLTPNSFAGEQYRTLRHLVEKMH--TETGVSVVGVSSPSIGDGKTTTAINLAGAL
A0A2V6U3P1      -----------------------MQFAG--LDRPCKTIVITSATPGEGKTTTAANF-AAV
A0A2V7I866      DGLIQRLTSKPELLHEYAALRSGLNLGS--SSGGCKSVLVTSAQPLDGKTTIVLDL-GLT
A0A1F7NSZ2      APLVAHADPKSPAAEAYRSLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVV
A0A1F7PJN6      APLVAHADPKSPAAEAYRSLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVV
A0A1F7NCG6      SALVAHADPKSPAAEAYRTLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVV
A0A1F7Q5I6      SALVAHADPKSPAAEAYRTLRTSIQFAG--LDHKCRTVVVTSSSPGEGKSTTVANF-GVV
A0A2V6SK79      TALVTETAPKSAAAEAYRTLRTNIQFAG--LDRPCKTIVITSATPGEGKTTTAANF-AAV
A0A2V6PDA4      ---MSLLDPISFAAEQYRTLRHIVEQPH--RAEPLSVLAVSAPTIGDGKTTTAINLAGAF
A0A2V6Q732      ECLVSLVAPHSYEAEQYRGLRHLVEQAH--RTSALSVLAVSSASVGDGKTTTAINLAGAL
A0A2V6ZH60      EHLVSLLAPTSFEAEQYRALRHKIEQLH--RSTDLTTIAVSSPDAGDGKTTTTLNLAGAL
A0A2V6ZW34      EHLVSLQAPSTAAAEQYRVLRHLVETLR--KRTNLQVLAVTSPGVGDGKSVTAINLAGAL
A0A2V6SIM1      DHLVSLLAPASFAAEQYRALRFVIEQTH--RESAVSVVGVSSPSVGDGKTTTAINLAGAL
A0A2V6SBN9      DHLVSLFDSESWEAEQYRVLRHAVETLR--KGVNLQIVAVTSAAVGDGKTTTAINLAGAL
A0A2V6TVU3      THLVSLLDPRSYEAEQYRVLRYVVETLR--KGNNLQVVAVTSPGVGDGKTTTAINLAGAL
A0A2V6XML6      AHLVSLLDPRSFEAEQYRMLRHVVETLR--KGAILHVVAVTSPGAGDGKTTTAINLAGAL
A0A2V7CEX0      ACLVSLLDPRSFEAEQYRVLRHVVETLR--KGANLQVLAVTSPGVGDGKTTIAINLAGAL
A0A2V6W355      LHLVSLLEPASFEAEEYRVLRHAVETLH--KDAHLQIVSVTSPGMGDGKTTTAINLAGAL
A0A2V6YDI1      EPLVSLLAPTSFEAEQYRVLRHVVETLR--KDANLQVVAVSSPGVGDGKTTTSINLAGSL
A0A2V7GJE5      EHLVSLLNPTSPDAEQYRALRHAVEQLH--RSAGLTALAVSSPTVGDGKTTTAINLAGAL
A0A2V6X2Y0      EHLVSVLAPTSFEAEQYRALRHRIEQLH--KTTDLAIVAVSSPSVADGKTTTAINLAGAL
A0A2V7AFT7      EHLVSMLAPNSFEAEQYRALRHQIEQLH--KTTNLAIVAVSSPSVADGKTTTAINLAGAL
A0A2V7BA71      EHLVSLLAPTSFEAEQYRALRHLIEQRG--KSTALSVVAVSSPGVADGKTTTAINLAGAL
A0A2V7BRT3      EHLVSLLAPTSFEAEQYRALRHLIEQLH--KSTGLVVVAVSSPTVADGKTTTSINLAGAL
A0A2V7FF08      ALLVSLLDPASFEAEQYRVLRHVVETLR--KGANLQVVAVTSPGIGDGKTTTAINLAGAL
A0A2V6YDI2      EHLVSLLNPASFEAEQYRVLRHLVETLR--KGANLQVVAVTSPGVGDGKTTTAINLAGSL
A0A2V6YK84      EHLVSLQAPATPAAEQYRVLRHLVETLR--KRANLQVIAVTSGGVGDGKTVTSINLAGAL
A0A1Q7NS62      ---MSLIEPASFEAEQYRALRQLVERLH--KSTALSIVAVSSPTVADGKTTTSINLAGAL
A0A2V7D2F0      EHLVSLLKPTSFEAEQYRALRHLIEHLH--RTAELSVVAVSSPVADDGKTTTAINLAGAL
                                       :             . :::    :**:    ::    

A0A2V6VPM0      WELGR-RLILIDADLRRPSLHRGLRCPPQ-----PGLA-DMLT-GNVPWPRAGQGIR-E-
A0A2V6YHI8      VESGR-RVLVIDADLRRSSLHRAVGVPNE-----RGLV-DMLQ-KGVAWPEGFRGVA-T-
A0A2V7A3P7      LEADR-QLLIMDADLRRPALHKALEVPNE-----VGLA-DVLR-EGTVWPEAFRSLG-P-
A0A1Q7G9Y1      ADAGH-STLLIDGDIRRGQLHRVLNAART-----PGLT-NWLT-AGPAPEAIVQATPYP-
A0A1Q7TX95      WELGR-RLILIDADLRRPSLHRGLRCPPQ-----PGLA-DMLT-GNVPWPRAGQGIR-E-
A0A2V7B9E3      WELGR-RLILIDADLRRPSLHRGLRCPPQ-----PGLA-DMLT-GNVPWPRAGQGIR-E-
A0A2V7AVY2      LETDR-HLLMIDADLRRPSLHRALRTPNE-----VGLA-DVLR-DGTVWPEAFRALA-P-
A0A2V7C3J3      LETDR-HLLMIDADLRRPSLHRALRTPNE-----VGLA-DVLR-DGTVWPEAFRALA-P-
A0A2V6VAA8      LETDR-RLLLIDADLRRPSLHRALRTPNE-----IGLA-DVLR-AGTVWPEAFRPLA-P-
A0A2V7CNK3      LETDR-QLLVIDADLRRPSLHRTLRIPNE-----VGLA-DMLR-AGTVWPEAFRSLA-P-
A0A2V6T785      AQAQGGRVLLVDADLRRPSIAEHLGLAGPHRPDLPGLVDALVG-GPVRFEEIGQTYEEF-
A0A2V6RB03      AQASDARVLLVDVDLRGGALAARLGIDERAG---RGLVDAILN-AELTLEAVVEVRPDL-
A0A2V6RAF2      SQAGR-RLLMVDGDLRRPSLNRPLRLP--VK---PGLV-DVLA-SHLPLAAALQPIKD--
A0A2V7A9S9      AQSHDARVLLIDADLRVPTVGTNLGLDERPG---PGLADTILN-SSLTLDAVVQVRPQL-
A0A2V6SIE8      AGTGE-PVLLIDADFRRPSCHQVFDLN-LPK---VGLS-SILY-RDQPWDGSIVATSVP-
A0A2V6V7G3      AQARETKVLLIDMDLRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A2V7CME2      SQLGGSPVLLVDADMRRPMVHRVLSVE--QT---PGLS-TYLT-GQADLDQVIVPSGIP-
A0A2V6U1W4      VQVGAVEVLMIDADMRRPNLHNVLSVP--QA---PGLS-TFLT-GQAELADVIVPTSVR-
A0A2V7F4L5      AQSVDARVLLVDIDVRRPAVARQLKLAGSKR---SLVD-ALMD-SSLKVEDTVEHLAHF-
A0A2V7BAF4      AQARETKVLLIDMDLRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A2V7E6Z5      AQARDTKVLLIDMDLRRPALNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A1Q6YM61      AQARETKVLLIDMDLRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A1Q7IM35      AQARETKVLLIDMDLRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A1Q7UA97      AQARETKVLLIDMDLRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A2V7DAK1      AQARETKVLLIDMDLRRPAVNGQLGLRGFNP---KGVV-AVLG-AGASLDDVIVELPMF-
A0A2V6U3P1      CAQSGSRVLLVDGDLRKPTLHRIFGL--DNQ---RGLTTTMIE--GKSLADVAIPTRVP-
A0A2V7I866      AMLSGRKVIIVDADLRKPRIHEALEL--PNT---LGLSDILGA--RTHAREVIQTVKAMG
A0A1F7NSZ2      SAQAGSRVLVVDSDLRRPTLHRIFGL--GNA---RGLSTALLE--EQPFADVAQATAIP-
A0A1F7PJN6      SAQAGSRVLVVDSDLRRPTLHRIFGL--GNA---RGLSTALLE--EQPFADVAQATAIP-
A0A1F7NCG6      SAQAGSRVLVVDSDLRRPTLHRIFGL--GNA---RGLSTALLE--GLPFADVAQATAIP-
A0A1F7Q5I6      SAQAGSRVLVVDSDLRRPTLHRIFGL--GNA---RGLSTALLE--GLPFADVAQATAIP-
A0A2V6SK79      CAQSGSRVLLVDGDLRKPTLHRIFGL--DNQ---RGLTTTMIE--GKSLADVAIPTRVP-
A0A2V6PDA4      AQAADVRVLLVDADLRRPTVSSRLAL-DDSG---PGLVDAILD-PALGLGDVVRPRPPF-
A0A2V6Q732      AQASDARVLLMDVDLRRPAIAERLGV-EEGR---HGLVDAILS-HDLKLADVARPCGPL-
A0A2V6ZH60      AQAPDARILLIDADLRGANVAMYLGLDEHTA---PGLVDAILN-PSLTLGSVVQTHPYL-
A0A2V6ZW34      AQSEEARVLLVDMDLRRPAIARYLAL-GESR---PTLADALGT-PGLALKDAVVQVPSF-
A0A2V6SIM1      SQASDARVLLLDLDVRRPQIGRRLGL-DPNQ---PGLVDAIVD-PRLDLADIARAVRPF-
A0A2V6SBN9      AQSADARVLLVDVDLRRPAVARHLGL-GGSK---GSLVGALLD-SGLTLEAAVERLANS-
A0A2V6TVU3      AQSVDARVLLVDIDIRRPAVARQLGL-A-TK---RSLVATLLD-ARLTLKDTVEHVAHF-
A0A2V6XML6      AQSADARVLLVDLDIRRPAVARQLRL-SGAR---RSLVDALRD-PGLTLEDTVEHLAHF-
A0A2V7CEX0      AQAVDARVLLVDIDIRRPAVARQLGL-AGSK---RSLVTTLLD-ASFTLENSVERLAHF-
A0A2V6W355      AQSTDARVLLVDIDLRRPAVARHLGL-AHSK---RCLLDALLD-PGVKLEDTVEHIARF-
A0A2V6YDI1      AQAADARVLLVDLDIRRPAVARQLGL-AGSK---RSLVDALLD-SSLTLEDVVEHLAQV-
A0A2V7GJE5      AQDPEARILLVDADLRRPSVGNRLGLRNSRD---RGLVDLVLA-PDLTLDDVVRRRPSY-
A0A2V6X2Y0      AQAPDARVLLIDADLREGSLARRLGLDVNMR---PGLVEAILD-PNLTLDAVAHADHNL-
A0A2V7AFT7      AQAPDARVLLIDADLREGSLARRLGFDVDRG---PGLVEAILD-AHLTLDAVAHADRSL-
A0A2V7BA71      AQAPDARVLLIDADLRGAAVAARLGWDARVG---PGLADAILD-ASLTLETAAHACPHL-
A0A2V7BRT3      AQAPDARVLLIDADLRGAALGPRLGLEEGGG---PGFVEAILD-ANLPLAAVVQARPQL-
A0A2V7FF08      AQSASARVLLVDMDLRRPAVARRLGLAG-SK---RALVDALLD-SGLTLGDTVEPLAYF-
A0A2V6YDI2      AQAADARVLLVDMDLRRPAVAGQLGLSG-GK---RGLAEALLADSGLSLEDTVETLAHF-
A0A2V6YK84      AQSEDARVLLIDMDLRRPSIARYLALGA-TR---PTLADALEA-SGPELKDAVVRIPRF-
A0A1Q7NS62      AQAPDARVLLVDADLRGAALAPRLGFDEYVG---PGLVDAIVD-VNLTLPAVVHALPSL-
A0A2V7D2F0      AQDPQARVLLLDADLRRGALAHRLGLREPSP---RGFVDVILD-GKLTLEAVVKRCPPF-
                        :::* *.*       .            .                       

A0A2V6VPM0      -------GFVFLPAGSTGTAKPGVLLTVAKLRGVLELLTSHADLVLFDSAPVLAVADNLI
A0A2V6YHI8      -------GFDFLPSGIKA-ANPGALLSSRHMAELLDQARERADLVLIDSPPVLAVSDCLP
A0A2V7A3P7      -------GLYFMPAGTRR-PNPSSLLSSRHMGTVLQEARDRADIVLIDAPPVLAVADCLP
A0A1Q7G9Y1      -------RLSFIGCGARTPFGPE-LLGSAEMARLFAALRPRYEVILVDSPPLSVGVDPYI
A0A1Q7TX95      -------GFVFLPAGSTGTAKPGVLLTVAKLRGALELLTSHADLVLFDSAPVLAVADNLI
A0A2V7B9E3      -------GFVFLPAGSTGTAKPGVLLTVAKLRGALELLTSHADLVLFDSAPVLAVADNLI
A0A2V7AVY2      -------GMDFMPSG-IRPANPSSLIASKHMVRVLELARERADVVLIDAPPVLAVADCLP
A0A2V7C3J3      -------GMDFMPSG-IRPANPSSLIASKHMVRVLELARERANVVLIDAPPVLAVADCLP
A0A2V6VAA8      -------GMDFMPSG-IKPANPSSLIASKHMLRVLELARERADVVLIDAPPVLAVADCLP
A0A2V7CNK3      -------GMSFVPSG-IRPTNPSSLISSKHMTHVLELARERADVVLIDAPPVLAVADCLP
A0A2V6T785      -------NLTVVTAGGVP-HAPYEVLQSPRFAAILEDARQRYDYVILDTPPLVAVPDSRV
A0A2V6RB03      -------NLTILPAGRLP-RAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLVSFPDCRV
A0A2V6RAF2      -------GLQLLAAGTTDGADPGVLLSADNISRLFDLAKGHADLVVFDSAPVLAVADNLA
A0A2V7A9S9      -------NLSILPAGRLP-SAPYEVLKSPRVGELLAEARKRYDYIVLDTPPLVSVPDCRV
A0A2V6SIE8      -------NLAFLPAGPMP-PDPAALLSSERARELLAALRERYAWIIVDSPPVLAASDACA
A0A2V6V7G3      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRV
A0A2V7CME2      -------NLFVIPAGRIP-VNPAELLASARLREAIETLGQRFAYIVFDTGPMFGVSDAMI
A0A2V6U1W4      -------NLSIIPSGRIP-LNPAELLTSTRLPQALEGLGGRFAHIVVDTGPIFGVSDAMI
A0A2V7F4L5      -------NLSVLRAGGPT-LAPYELLKSSRLEALLDQARQRYDYIVLDTPPFVPVPDCRL
A0A2V7BAF4      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRV
A0A2V7E6Z5      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMIDEARRRFDYVIIDTPPVIAVPDCRV
A0A1Q6YM61      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRV
A0A1Q7IM35      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRV
A0A1Q7UA97      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRV
A0A2V7DAK1      -------NLSIIPSGPRQ-SAPYELLKSSRLHQMMDEARRRFDYVIVDTPPVIAVPDCRV
A0A2V6U3P1      -------NLSVVVSGPLP-PNHAELAASRRMHDLMEAATRVFDLIVIDTPPVLSVSDAVA
A0A2V7I866      GNPLDDRSVSVITAGLGG-APLTETLGGPTLKDAIGELTRAYDVVLVDSPPVLAADDALL
A0A1F7NSZ2      -------NLSVLTSGPLP-PNPAELVGSLRMRECLEAAAGDFALVLLDSPPIVSVADALA
A0A1F7PJN6      -------NLSVLTSGPLP-PNPAELVGSLRMRECLEAAAGDFALVLLDSPPIVSVADALA
A0A1F7NCG6      -------NLFVLTSGPLP-PNPAELVGAMRMRECLEAATTDFDLVLLDSPPIVSVSDALA
A0A1F7Q5I6      -------NLFVLTSGPLP-PNPAELVGAMRMRECLEAATTDFDLVLLDSPPIVSVSDALA
A0A2V6SK79      -------NLSVVVSGPLP-PNHAELAASRRMHDLMEAATRVFDLIVIDTPPVLSVSDAVA
A0A2V6PDA4      -------NLWVLPAGPRT-DSPYELLKSPRLAALLHEARQQYDYVILDTPPLVPVPDCRI
A0A2V6Q732      -------NLAVVTAGVFS-DIPYELLRSPRLGDLLEQARRDYDYVVLDTPPLVPIPDARV
A0A2V6ZH60      -------NLTVITAGRQP-TSPYEVLKSPRLGELLAEAREKYDYVIVDTPPLVSVPDSQV
A0A2V6ZW34      -------NLSVLRAPVSA-AAPYELLRSPKLEALLAEARQEYDYVVIDTPPFVPVPDCRV
A0A2V6SIM1      -------NFAVVLGGQSA-KATYELFKAARLRTLLEEARESYDYVVIDAPPLLPMPDCQL
A0A2V6SBN9      -------NLSVLPAGRAT-VAPYELLKSPRLEALFEEMRQHYDYVVLDTPPFLPVPDCRL
A0A2V6TVU3      -------NLWVAPAGGPA-GAPYEVLKSPRLEALLGEARECYDYIVLDTPPCVPVPDCRV
A0A2V6XML6      -------NLSVLPASRPA-VEPYELLKSPRLEALLDEARRRYEYVVLDTPPFVPVPDGRI
A0A2V7CEX0      -------NLSVLPAGEPA-VAPYEVLKSPRLEALLDEARQCYDYIVLDTPPFLPVPDCRV
A0A2V6W355      -------NLSVLPAGGPE-AVPYEILTSPRLEELLNEARRRYDFVVLDAPPFVPVPDCRL
A0A2V6YDI1      -------NLSVVPAGGPA-RAPYELLQSPRLDALVDEARQRYDYVVLDTPPITPVPDCRL
A0A2V7GJE5      -------NLSVLAAGRAA-AAPYEVLKSPRLGNLLDQARQQYDFIVLDTPPIVLTQDCRV
A0A2V6X2Y0      -------NLSVLTGGRLP-SAPYEVLKAPRVGELLGEARRRYDYIVLDTPPLVSVPDCRV
A0A2V7AFT7      -------NLSVLTGGRLP-SAPYEVLKSPRVGELLGEARRRYDYIVLDTPPLVLVPDCRV
A0A2V7BA71      -------NLSVLPAGRRP-SATYEVLKSPRVGELLAEARKRYDYVILDTPPLVLVPDCRV
A0A2V7BRT3      -------NLSVLPAGRFP-SAPYEVLMSPRVGELLAEARRQYDYVILDTPPLVSVPDCRV
A0A2V7FF08      -------NLSVLPAGKPA-VAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRV
A0A2V6YDI2      -------NLSVLPAGRAT-VAPYELLKSPRLEALLDEARQRYDYIVLDTPPFVPVPDCRV
A0A2V6YK84      -------NLSVLRAPVST-AAPYEVLRSPKLEALLAEARRQYDYVVIDTPPFVPFPDCRL
A0A1Q7NS62      -------NLSVVPAGRFP-SAPYEVLKSPRFGELLAEARKRYDYIILDTPPLVSVPDCRV
A0A2V7D2F0      -------NLSIVPAGLLP-SAPYEVLKASRVGELLAAARHEYDFIVLDTSPLVSVPDCRV
                        . .                       .         ::.*: *     *   

A0A2V6VPM0      LASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVS---PRQTRRY-----
A0A2V6YHI8      LCTKVDGVLLVTRFGTTQRRSLIRAKAMLEKVGAHIVGVVVNGLS---PRETRRY-----
A0A2V7A3P7      LCRQVDGVILVIRFGSTRRRSLQRAKDQLQKVGANVVGVVINGLS---RRETRHY-----
A0A1Q7G9Y1      LGTLTGNLVLVLRSGVTNRELAGAKLDAVDRLPIRLLGAVLNDIR---PDGAYRH-----
A0A1Q7TX95      LASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVS---PRETRRY-----
A0A2V7B9E3      LASLVDGVILVVRAGETQRHDLVRAKDLLEKAGASLLGVVLNQVS---PRETRRY-----
A0A2V7AVY2      LCRYVDGVILVARFGITRRRSLIRAKAQLGRVGARVVGVVINGLS---RHETRHY-----
A0A2V7C3J3      LCRYVDGVILVARFGITRRRSLIRAKEQLGRVGARVVGVVINGLS---RHETRHY-----
A0A2V6VAA8      LCRYVDGVILVARFGATRRRSLIRAKEQLERVGAHVVGVVINGLS---RHETRHY-----
A0A2V7CNK3      LCRRVDGVILVVRFGVTRRRSLQRAKDQLERVGARIVGVVINGLS---RHETRLR-----
A0A2V6T785      IMKVVDGVLLVVSAHQTPRRLLEEALGLVDP--AKLLGLVFNQDD---RPLSGYYRGYRG
A0A2V6RB03      IEKCVDGFLIAVAAHKTSRKLLEEALNVTER--AKIVGFVFNGDD---RHLSRDS-----
A0A2V6RAF2      LASMVDAVILVVRAGVTQRRDLVRAKAMLDKVRAPVVGAVLNRVS---SRETRRY-----
A0A2V7A9S9      IGRWVDGFLIVVAAHKTPRKLLEEAIRVAEP--AKVVGLVFNGDD---RHLSRDS-----
A0A2V6SIE8      LARQVEGVLLVVRANATPIEAAQLVRDRLERLGANVVGVVLNDVR---PTRDRYF-----
A0A2V6V7G3      ISSGVDGFLIIVNAHKTPTRLLSETVNVLGQ--SKVLGLIFNRDD---QPIAEHL-----
A0A2V7CME2      LAGQLEGTVLVLRHGRASRDAAQRAIRSLIAVRARLLGVILNDVDLQANSYG--Y-----
A0A2V6U1W4      VAAQVEGVVLVLRHGRASRDAAQRAIRNLMSVGAKLLGVILNDVDVRAEGYYGY------
A0A2V7F4L5      IAKCVDGFLIVVAAHRTPRSALAETLDLLEP--AKVVGLVFNGDSVRRSSYSGYY-----
A0A2V7BAF4      ISSGVDGFLVIVNAHKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----
A0A2V7E6Z5      ISSGVDGFLIIVNAHKTPTRMLGETVSVLGQ--SKVLGLVFNRDD---QPMAEHL-----
A0A1Q6YM61      ISSGVDGFLVIVNAHKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----
A0A1Q7IM35      ISSGVDGFLVIVNAHKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----
A0A1Q7UA97      ISSGVDGFLVIVNAHKTATRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----
A0A2V7DAK1      ISSGVDGFLIIVNAHRTPTRLLSETVSVLGQ--SKVLGLIFNRDD---QPIAEHL-----
A0A2V6U3P1      LAAQMDGVILVVRGGKTSAEAARRAAEQIDAVKGRILGGLLNRVD---ARNSGYY-----
A0A2V7I866      LAPLVDGVIVVVHTGIVTERDLKLTKARLEGVGGRVLGVVMNRFD---PRVHGPG-----
A0A1F7NSZ2      LSAVADGVVLVVRAGKIPHEVVRRAVVQIESVKGRILGVLMNSVN---LKRDGYY-----
A0A1F7PJN6      LSAVADGVVLVVRAGKIPHEVVRRAVVQIESVKGRILGVLMNSVN---LKRDGYY-----
A0A1F7NCG6      LSAITDGVVLVIRVGKIPHDVVRRAVVQIESVKGRILGVLMNSVN---MKREGYY-----
A0A1F7Q5I6      LSAITDGVVLVIRVGKIPHDVVRRAVVQIESVKGRILGVLMNSVN---MKREGYY-----
A0A2V6SK79      LAAQMDGVILVVRGGKTSAEAARRAAEQIDAVKGRILGVLLNRVD---ARNSGYY-----
A0A2V6PDA4      IGKYVDGFLLVVAAHKTRAKLLDEALGVLGS--SKILGLVFNGGD---VTDSGYY-----
A0A2V6Q732      ISKWVDSFLLVVRANTTPRSLLEESLNLMDP--PKVLGLVFNNDE---RPRTT-Y-----
A0A2V6ZH60      LARLVDGFVLVVGAHRTPRRLLLEALNLLEP--TRVVGLVFNGDD---RHLSRDS-----
A0A2V6ZW34      IAKSVDGFVVVVASNRTQRGLLAETLKAMDP--DKAVGFVFNAHP---TLPTS-Y-----
A0A2V6SIM1      IGGFVDKFIVVLACDKTPRRALAEALNVLAA--DKVLGLVFNRSD---QLLSDYR-----
A0A2V6SBN9      IEKCIDGFLLVVAAHRTPRGAVAETLNLMDP--AKVVGAVFNGDD---ARRSN-Y-----
A0A2V6TVU3      IAKYVDGFFLVVKAHQTPRGELARALDLMDP--QKVAGLVFNDDR---VRRSS-Y-----
A0A2V6XML6      IAKYVDGFLIVVKAHRTPRGALAQTLDLVDP--AKVTGLVFNGDN---TRRSG-Y-----
A0A2V7CEX0      IAKCVDGFLTVVKAHRTLRGELAQTLDLMDP--AKVVGLVFNGDH---ARRSS-Y-----
A0A2V6W355      LTKCVDGFVVVVATHRTPRGMLAETLNLIDP--AKLAGLVFNGDV---APRSS-Y-----
A0A2V6YDI1      IAKCVDGFLVVVAAHRTPRGGLAESLAMMDP--AKVVGLVFNGDT---RRRRG-Y-----
A0A2V7GJE5      ISKWVDGFLLVVGADRTPAKLVEEALNRMEA--DKIVGFVFNDDA---RSLSR-Y-----
A0A2V6X2Y0      IGRWVDGFLIVVTAHKTSRKLLEEALHVTEP--AKILGLVFNGDD---RHVSR-G-----
A0A2V7AFT7      IGRWVDGFLIVVTAHQTPRKLLEEALNVTEP--AKILGLVFNGDD---RHVSR-G-----
A0A2V7BA71      IEKWVDGFLIVVTAHRTGRKFLGEALNLAER--TKVVGLVFNGDD---RHLSRNS-----
A0A2V7BRT3      IEKWVDGLLIVVTAHRTARKLVEEALNVTDR--AKVVGLVFNGDD---RHLSRDS-----
A0A2V7FF08      IAKYVDGFLTVVAAHRTPRSALAQALDLMDP--GKVAGLVFNGDD---ARRSSY------
A0A2V6YDI2      ITKSVDGFLVVVTVHRTPWGVLTEALDLIDP--AKVVGLVVNGDD---TRRSSY------
A0A2V6YK84      IAKSVDGFVLVVASNRTPRGVLAEALKAMDS--EKAVGYVFNAHP---WTPTSY------
A0A1Q7NS62      IEKWVDGFLIVVTAHRTARKLLEEALNVTER--ARIVGLVFNGDD---RHLSRDS-----
A0A2V7D2F0      LEKWVDGFLVVVAAHKTPRKLLEEALNVTDP--AKIVGLVFNGDE---RPLAGYS-----
                :       .                            * :.*                  

A0A2V6VPM0      YGRYGDYYGSRDGTIEPWWQRCRFWANKRTGVLR--------------------------
A0A2V6YHI8      YAEYNHYVG---------SGKSRRTRRRKSMKSFFSGLLIVLSVLGSGITARAAEDEYRI
A0A2V7A3P7      YAEYTHYVG---------IQKHRRRGHKPK------------------------------
A0A1Q7G9Y1      YSYFPEGYE---------LREEEPAGQRKRILMAAG------------------------
A0A1Q7TX95      YGRYGDYYGSRDGNIEPWWQRCRFWANKRTGVLR--------------------------
A0A2V7B9E3      YGRYGDYYGSRDGNIEPWWQRCRFWANKRTGVLR--------------------------
A0A2V7AVY2      YAEYTHYVG---------IQKR--KGKRRQ------------------------------
A0A2V7C3J3      YAEYTHYVG---------IQKR--KGKRRQ------------------------------
A0A2V6VAA8      YSEYTHYVG---------IQKRKRKGKRRK------------------------------
A0A2V7CNK3      YAEYTHYVG---------LQKRRKKGKRRK------------------------------
A0A2V6T785      YRTYGAAP------TNGHEASRWNRLVRRGRRIENGG-----------------------
A0A2V6RB03      YGTYASTR-SVDLGGGGWRRLVSSSSRTHRRQTASDH-----------------------
A0A2V6RAF2      YRSYSGYY------GVGEGTSVRRRFRSAQSWWPIRRSEKVG------------------
A0A2V7A9S9      YASYAARQFSDGHGGGWWRGPFGTRDRRHRKHTASDD-----------------------
A0A2V6SIE8      YANYG-------------------------------------------------------
A0A2V6V7G3      YNSYGPDP------SGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLSGNGITH-------
A0A2V7CME2      YDSYYLRP------DDSRLAERV-------------------------------------
A0A2V6U1W4      YSNYGYEA------EKETA-----------------------------------------
A0A2V7F4L5      HAHVGSSR------GARW----RRAWRKP-------------------------------
A0A2V7BAF4      YNSYGPDP------SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH-------
A0A2V7E6Z5      YNSYGPDP------NAGWTATMRRRWRRSGHRYGNGHSHEN----------SH-------
A0A1Q6YM61      YNSYGPDP------SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH-------
A0A1Q7IM35      YNSYGPDP------SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH-------
A0A1Q7UA97      YNSYGPDP------SGGWTGSIRRRLRRNGH--GNGNASGNGTGYLSGNGITH-------
A0A2V7DAK1      YNSYGPDP------SGGWTGSIRRRLRRNGHGNGNGNASGNGTGYLSGNGITH-------
A0A2V6U3P1      ADH------------------------GRYYDAYYGSDHKG-------------------
A0A2V7I866      AHPYAARYYERG------------------------------------------------
A0A1F7NSZ2      YDY------------------------YRYYHSYYSPTESRRR-----------------
A0A1F7PJN6      YDY------------------------YRYYHSYYSPTESRRR-----------------
A0A1F7NCG6      YDY------------------------YRYYHAYYSPADGRRR-----------------
A0A1F7Q5I6      YDY------------------------YRYYHAYYSPADGRRR-----------------
A0A2V6SK79      ADH------------------------GRYYDAYYGSDHKG-------------------
A0A2V6PDA4      YAGRYGARRG-------------GDDPEDAFRPWYRGGQPLDRLLRR-------------
A0A2V6Q732      HDYYAGSGRH-----------------NKGGAPWWRPFAKIRSVFDPDAAGRRRAERRRE
A0A2V6ZH60      YA-----SKRVYEMTVDGTRRHRFSSRSRGRQTSSDE-----------------------
A0A2V6ZW34      YDYGNGHSHG---------------KTRSGRRKGERS-----------------------
A0A2V6SIM1      REDYGEKVRG-----------------ARWRWAAKRIQPFNGAKTRSSDIR---------
A0A2V6SBN9      YDVYARPSA------------------ARWRRAWSKP-----------------------
A0A2V6TVU3      YDVYAGPPRS-----------------PRRRL-WRRP-----------------------
A0A2V6XML6      YDGYVASPRG-----------------ARWRLPWSKP-----------------------
A0A2V7CEX0      YDVYTAPPRR-----------------RRL---WRSP-----------------------
A0A2V6W355      YRVAEPTPV------------------ARWRRPWRSP-----------------------
A0A2V6YDI1      YDVYAGAPER-----------------AGWRRAWRRP-----------------------
A0A2V7GJE5      YSYGYTAKRHEEEGAGWRRAMTRIAGSFRQRHSF--------------------------
A0A2V6X2Y0      YSYGGGRRSQ-------------TYGRARRRQTASDD-----------------------
A0A2V7AFT7      YSYGGGRGSH-------------TYGRARRRQTAPDD-----------------------
A0A2V7BA71      YGSYATRLSK------------------RNRK----------------------------
A0A2V7BRT3      YGSYGSRRSSSRNGGGRRRRVFWSLDRIRRRRTASDD-----------------------
A0A2V7FF08      YSAYVGSPRG-----------------ARWRRPWRKP-----------------------
A0A2V6YDI2      YDVYAGSSRG-----------------ARGRGAWSRA-----------------------
A0A2V6YK84      YEDGNGHGR---------------------TRSWHRKGENS-------------------
A0A1Q7NS62      YGAYDSRQSA-----------------RRNGGGWRRRVFGNRDRIRRSVTAGRRRAPGFI
A0A2V7D2F0      HG---YGHST-----------------NGSTAGWK-----------------------FF
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      GADDVLHIIVWDNKELEQTVVVRPDGKISYPLAGEIQAQDLTVPQLTEELTKRLSTAVKN
A0A2V7A3P7      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      IR----------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      GRAAEKIHWSRTRERDGDQRGRSLARDRHGVGDAALARPLDPQQLRAARL----------
A0A2V7D2F0      G------------------RGRSAARA---------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      PNVSVMVQEIKSYRVHFVGKVVKPGVYPIKAGTPLLQALTLAGGTSENADLTAAYIIRGN
A0A2V7A3P7      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      KTLPVDLRKLVQQADLSKNVRLERDDTIVVPEIALGSSLQEMQDRRIYVLGKVTKPGVYN
A0A2V7A3P7      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      LKEDVPILHALFLAGGVVEGGDLASAFIIRGKEKIPVDLWKLIQKGDVSQNVMVKHEDTI
A0A2V7A3P7      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------------------------------
A0A2V6YHI8      VIPAGGELQNAVYIMGEVLKPGVYSQPEALSLLKLVSLAGGFTKYAAPGRATLVRRDGDK
A0A2V7A3P7      ------------------------------------------------------------
A0A1Q7G9Y1      ------------------------------------------------------------
A0A1Q7TX95      ------------------------------------------------------------
A0A2V7B9E3      ------------------------------------------------------------
A0A2V7AVY2      ------------------------------------------------------------
A0A2V7C3J3      ------------------------------------------------------------
A0A2V6VAA8      ------------------------------------------------------------
A0A2V7CNK3      ------------------------------------------------------------
A0A2V6T785      ------------------------------------------------------------
A0A2V6RB03      ------------------------------------------------------------
A0A2V6RAF2      ------------------------------------------------------------
A0A2V7A9S9      ------------------------------------------------------------
A0A2V6SIE8      ------------------------------------------------------------
A0A2V6V7G3      ------------------------------------------------------------
A0A2V7CME2      ------------------------------------------------------------
A0A2V6U1W4      ------------------------------------------------------------
A0A2V7F4L5      ------------------------------------------------------------
A0A2V7BAF4      ------------------------------------------------------------
A0A2V7E6Z5      ------------------------------------------------------------
A0A1Q6YM61      ------------------------------------------------------------
A0A1Q7IM35      ------------------------------------------------------------
A0A1Q7UA97      ------------------------------------------------------------
A0A2V7DAK1      ------------------------------------------------------------
A0A2V6U3P1      ------------------------------------------------------------
A0A2V7I866      ------------------------------------------------------------
A0A1F7NSZ2      ------------------------------------------------------------
A0A1F7PJN6      ------------------------------------------------------------
A0A1F7NCG6      ------------------------------------------------------------
A0A1F7Q5I6      ------------------------------------------------------------
A0A2V6SK79      ------------------------------------------------------------
A0A2V6PDA4      ------------------------------------------------------------
A0A2V6Q732      ------------------------------------------------------------
A0A2V6ZH60      ------------------------------------------------------------
A0A2V6ZW34      ------------------------------------------------------------
A0A2V6SIM1      ------------------------------------------------------------
A0A2V6SBN9      ------------------------------------------------------------
A0A2V6TVU3      ------------------------------------------------------------
A0A2V6XML6      ------------------------------------------------------------
A0A2V7CEX0      ------------------------------------------------------------
A0A2V6W355      ------------------------------------------------------------
A0A2V6YDI1      ------------------------------------------------------------
A0A2V7GJE5      ------------------------------------------------------------
A0A2V6X2Y0      ------------------------------------------------------------
A0A2V7AFT7      ------------------------------------------------------------
A0A2V7BA71      ------------------------------------------------------------
A0A2V7BRT3      ------------------------------------------------------------
A0A2V7FF08      ------------------------------------------------------------
A0A2V6YDI2      ------------------------------------------------------------
A0A2V6YK84      ------------------------------------------------------------
A0A1Q7NS62      ------------------------------------------------------------
A0A2V7D2F0      ------------------------------------------------------------
                                                                            

A0A2V6VPM0      ------------------------------------
A0A2V6YHI8      KVLLKVDLKDIMNDPKKYEDLALRPGDVLIVPERLF
A0A2V7A3P7      ------------------------------------
A0A1Q7G9Y1      ------------------------------------
A0A1Q7TX95      ------------------------------------
A0A2V7B9E3      ------------------------------------
A0A2V7AVY2      ------------------------------------
A0A2V7C3J3      ------------------------------------
A0A2V6VAA8      ------------------------------------
A0A2V7CNK3      ------------------------------------
A0A2V6T785      ------------------------------------
A0A2V6RB03      ------------------------------------
A0A2V6RAF2      ------------------------------------
A0A2V7A9S9      ------------------------------------
A0A2V6SIE8      ------------------------------------
A0A2V6V7G3      ------------------------------------
A0A2V7CME2      ------------------------------------
A0A2V6U1W4      ------------------------------------
A0A2V7F4L5      ------------------------------------
A0A2V7BAF4      ------------------------------------
A0A2V7E6Z5      ------------------------------------
A0A1Q6YM61      ------------------------------------
A0A1Q7IM35      ------------------------------------
A0A1Q7UA97      ------------------------------------
A0A2V7DAK1      ------------------------------------
A0A2V6U3P1      ------------------------------------
A0A2V7I866      ------------------------------------
A0A1F7NSZ2      ------------------------------------
A0A1F7PJN6      ------------------------------------
A0A1F7NCG6      ------------------------------------
A0A1F7Q5I6      ------------------------------------
A0A2V6SK79      ------------------------------------
A0A2V6PDA4      ------------------------------------
A0A2V6Q732      ------------------------------------
A0A2V6ZH60      ------------------------------------
A0A2V6ZW34      ------------------------------------
A0A2V6SIM1      ------------------------------------
A0A2V6SBN9      ------------------------------------
A0A2V6TVU3      ------------------------------------
A0A2V6XML6      ------------------------------------
A0A2V7CEX0      ------------------------------------
A0A2V6W355      ------------------------------------
A0A2V6YDI1      ------------------------------------
A0A2V7GJE5      ------------------------------------
A0A2V6X2Y0      ------------------------------------
A0A2V7AFT7      ------------------------------------
A0A2V7BA71      ------------------------------------
A0A2V7BRT3      ------------------------------------
A0A2V7FF08      ------------------------------------
A0A2V6YDI2      ------------------------------------
A0A2V6YK84      ------------------------------------
A0A1Q7NS62      ------------------------------------
A0A2V7D2F0      ------------------------------------
                                                    

© 1998-2019