BYKdb

Dataset for cluster tadcd of phylum candidatus-rokubacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V6UHF5      MVEESTTSPDVD------------------------------------------------
A0A1Q7GC33      MTISNLPTPLAPSPAVAPVTPYPGIAELDSPD---------------------AEGGVDW
A0A2V6RFZ8      --MSGPQEFAEDARPPSPGAPTVELVPSEPPR---PAATARARL----YTYPGEEEGVHF
A0A1Q7U8C0      --MSEQLRSEPPAPSRRLAD--------------------RADPEAFVHTVGLEE-----
A0A2V6WUL2      --MSDV-DPRHDPRPLPSGDEGHELVPGPASATLAPLEPVRA------YPYGVDEDAPHF
A0A2V6UWS7      --MSALWRPERETRMLPAGD---------------PVEITRAEHVAYGYP---AEETSHF
A0A2V7HN10      --MSALWRPERETRMLPAGD---------------PVEITRAEHVAYGYP---AEETSHF
A0A1Q7D2L3      --MNTFNDPTRDPRALPPARAGLELVQGRVPML---PEPQTL------YGVPVEKET-HF
A0A2V6R309      --MSDDVDPRRDLRSLPSGEDGPQLVQSHAPTIIAPVEPARA------YPYVVDDAAPHF
A0A1F7MHS2      ------------------------------------------------------------
A0A1F7LDJ8      --------------------------------------------MSQGRAGGATHRFSSF
A0A353V8C8      --------------------------------------------MSQGRAGGATHRFSSF
                                                                            

A0A2V6UHF5      --YLRLLRRIANRWRLIALISLAIVLPVTAYAVVFVPKMYEAVAKIFFE---------DP
A0A1Q7GC33      RRISSALLR--FKWLIAAVTFVGTV--AGVGATRFLKPEYAAQAKIWIDVAGRRGPDRGP
A0A2V6RFZ8      WDFWHVLNC--RRWTVISSCVVTVI--AVTIWTFTTPPVYTGTATLRIE-------KEDP
A0A1Q7U8C0      --LLSTLRR--HVWLVLGVAAVAVA--ATGFVAYTTGPVYRAVAVIRL--------SDPR
A0A2V6WUL2      WDYWRVLAR--HRWTVISFFLVTVI--AVMIWTFTTKPVYTGTATLRIE-------NEEP
A0A2V6UWS7      WDYWRVIRR--RRWTIITCFLVTVT--AVTVLSFTARPVYRASATLRIE-------KDQP
A0A2V7HN10      WDYWRVIRR--RRWTIITCFLVTVT--AVTVLSFTARPVYRASATLRIE-------KDQP
A0A1Q7D2L3      WDYWQVVSR--RRWTILCVFLGTLL--AATLYTFTIRPVFTGTVSLRIE-------KEPP
A0A2V6R309      WDYWRVLAR--HRWTVVSFFLVTVT--VAMIWTFTTKPIYTGTATLRIE-------SEEP
A0A1F7MHS2      -----MLRK--RRRLVLAVTLLVVA--VVAIATAMQEPVYLASARVLVD---------RY
A0A1F7LDJ8      ADYLDVLRK--RRRLVLAVTLLVVA--VVAIATAMQEPVYLASARVLVD---------RY
A0A353V8C8      ADYLDVLRK--RRRLVLAVTLLVVA--VVAIATAMQEPVYLASARVLVD---------RY
                      :      . :           .           : . . : .            

A0A2V6UHF5      RRLQAGMMRDWMPASDASFQ------LAILKSRSLAEAVV--ENLPRETT----------
A0A1Q7GC33      TPIRPGQLLDPE------------SWVDLLESYVVLDQVVRDERLFLSPSSLADALALET
A0A2V6RFZ8      HVVKFDEVVKDADSQQDYYQ----TQYKLLQSRTLANRVI--GLLQLDQ-----------
A0A1Q7U8C0      RALTGGVVEDPAPSADERFADPLLSQVELLTSGTVAGAVV--DSVPMLRVLTRKFSPSLL
A0A2V6WUL2      KVLKFEEVVKGADSQQDYYQ----TQYKILQSRTLANRVI--GLLQLDQ-----------
A0A2V6UWS7      RIVKFEEVVK-EDSQQDYYQ----TQYRILQSRSLANRVI--GLPQLDQ-----------
A0A2V7HN10      RIVKFEEVVK-EDSQQDYYQ----TQYRILQSRSLANRVI--GLLQLDQ-----------
A0A1Q7D2L3      RVVKFEEVVKEADNQQDYYQ----TQYKILQSRSLANRVI--GLLQLDQ-----------
A0A2V6R309      RVLKFEEVVKDADSRQDYYQ----TQYKILQSRTLADRVI--GLLQLDQ-----------
A0A1F7MHS2      RIDPLQQIEIDRPDMTNFYE----TQFELIRSRPVIQRAI--DGLQLATR----------
A0A1F7LDJ8      RIDPLQQIEIDRPDMTNFYE----TQFELIRSRPVIQRAI--DGLQLATR----------
A0A353V8C8      RIDPLQQIEIDRPDMTNFYE----TQFELIRSRPVIQRAI--DGLQLATR----------
                       :                    :: *  :   .:                    

A0A2V6UHF5      -------------------EELLARAMHRDYLLEGRNLFRRAMGQDSIIYSPQQR-----
A0A1Q7GC33      FRVADQYRPGAYRFSVGRSGQDYALATMDGIEIERGTLGDSVARRLGFQWAPAPGTVAPG
A0A2V6RFZ8      -------------------HPDFQRPERERGWLTQAEIRFRQ---WLVRWAPVPPPPAPQ
A0A1Q7U8C0      GGVAVAPDSAAHSFQLTFGRDDFVVE--GPAGQQRRAAYGRVVDLGVIRFAVLHRPSAKQ
A0A2V6WUL2      -------------------HPEFSQL--ER--DGGLAAWVRR---QLVSWIPVPPPPAPE
A0A2V6UWS7      -------------------HPEFAAA--PKSLNERTEDTVRE---WLVRWIPVPPPPAPE
A0A2V7HN10      -------------------HPEFAAA--PKSLNERTEATVRE---WLVRWIPVPPPPAPE
A0A1Q7D2L3      -------------------HQEFEQD--QDGWVARGESWLRE---QLVRWIPVPPPAAPE
A0A2V6R309      -------------------HAEFAQP--EGGLVASLEAWGKR---ELVRWIPVPPPPAPE
A0A1F7MHS2      -------------------RPGLAGAP---------------------------------
A0A1F7LDJ8      -------------------RPGLAGAP---------------------------------
A0A353V8C8      -------------------RPGLAGAP---------------------------------
                                                                            

A0A2V6UHF5      -----------AVTELQSARVTFTPLPSGE-VEIRAVAYAPRVAMDLANTYVEVLQTRSR
A0A1Q7GC33      RTVEFTLTTLRDAATRLSEGLDARMDPDGNFLRVELRGPNPERITAIVNAVAQRYVQVEA
A0A2V6RFZ8      ETEDLALAS--PLTSAVLSRLSIEPVRSSRLVRISFESHFPDLAARVPNALADAFIAQQL
A0A1Q7U8C0      GFLQVLDQE--SAISYLIAKVRVRPRLRTDIVDVAYSAPDPARAQEVVNRVVDVFRAASA
A0A2V6WUL2      GAEDLVLES--PLAETFLEHLSVEPVRNSRLVKVSFDSHYPDLAARVANTTADAFIAQQL
A0A2V6UWS7      AVEDLVVTS--PLTSAFLGRLTVEPIRSSRLVKVAFDSGHPDLAARAANTVAEAFMAQQL
A0A2V7HN10      AVEDLVVTS--PLTSAFLGRLTVEPIRSSRLVKVAFDSGHPDLAARAANTVAEAFMAQQL
A0A1Q7D2L3      ATDDLMVAS--PLTDTFLKRVTIEPVRNARLVYVSFDSHYPDLAARVANTLADAFIAQQM
A0A2V6R309      GAEDLVLES--PLAEAFQEHLSVEPVRNSRLVKVSFDSHYPDLAARVANTIADAFIAQQL
A0A1F7MHS2      -----------DPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVS
A0A1F7LDJ8      -----------DPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVS
A0A353V8C8      -----------DPAKAVLGGVKVEVVRGTRLVDIRVEDGDPVFAADLANAIANGFVRHVS
                                    :          : :      *       *  .:       

A0A2V6UHF5      SNIRDEARTSREFIETLLNQTKTSLQQSEEQLAKV-------------------------
A0A1Q7GC33      DLKRKKLTELTKILGDQVQHSQENLRRAEDALQRYREETITLPSERPTVGAAVTGPPGSA
A0A2V6RFZ8      DQKVEATRYASQFLAKQLDETRDRLGEAEGKLNRF-------------------------
A0A1Q7U8C0      DAAQRQSKLRREFLEAQLKVNDSLLADARQALTEF-------------------------
A0A2V6WUL2      DQKVEGTRSATQFLAKQLDETRDKLREAEEKLNAF-------------------------
A0A2V6UWS7      DQKIEATRYATQFLAKQLEEARGKLEESEGKLTKF-------------------------
A0A2V7HN10      DQKIEATRYATQFLAKQLEEARGKLEESEGKLTKF-------------------------
A0A1Q7D2L3      DRMVEATRYATQFLAKQLEEARGKLGESETHLSNY-------------------------
A0A2V6R309      DQKVEGTRYATQFLANQLDETRDKLREAEEQLNKF-------------------------
A0A1F7MHS2      DLRLEGSRNAYEYLTNEVKNMKDSLNRAEMALGRY-------------------------
A0A1F7LDJ8      DLRLEGSRNAYEYLTNEVKNMKDSLNRAEMALGRY-------------------------
A0A353V8C8      DLRLEGSRNAYEYLTNEVKNMKDSLNRAEMALGRY-------------------------
                .          : :   :.     *  :   *                            

A0A2V6UHF5      ----ARGR-------SLRMPERNAIEAAQLS---QLENSLAEIQGSKEIAKVRLAQLKGK
A0A1Q7GC33      PVAGLGGTGGVGAA-GAVGGAGRDPVLGGFF---EMQMSREEARRDRSALGRLLAQAGDS
A0A2V6RFZ8      ----LKANNILFITGGDKTSQAQDLITQQLT---LLSDGWLKARSERIAKESLLAQG---
A0A1Q7U8C0      ----QRRARPYGSG-GSSAREQSELPGLELERQQLMAERRTDEALLAALRDSSTSRK---
A0A2V6WUL2      ----LTANNILFVN-VDKNGQPQDLLTQQLS---LVSEAFLKARADRIAKESLLAQA---
A0A2V6UWS7      ----LNGHDILFVT-ADRGGQQQDLISQQLA---LLSDALLKVRGERIAKESLMTLA---
A0A2V7HN10      ----LNGHDILFVT-ADRGGQQQDLISQQLA---LLSDALLKVRGERIAKESLMTLA---
A0A1Q7D2L3      ----LNSHGILFVT-ADRLGQPQDIITQQLT---LMSEAFLRARADRMAKESLLTQA---
A0A2V6R309      ----LAANDILLVS-ADKNGQPQDLLTQQLS---LVSEAYLKARADRIAKGSLLAPA---
A0A1F7MHS2      ----KEEHQLILLP------QRANAAASKMS---DFHAAYVDAQTRRLELEAQLRTV---
A0A1F7LDJ8      ----KEEHQLILLP------QRANAAASKMS---DFHAAYVDAQTRRLELEAQLRTV---
A0A353V8C8      ----KEEHQLILLP------QRANAAASKMS---DFHAAYVDAQTRRLELEAQLRTV---
                                             :     .                        

A0A2V6UHF5      DASGRPVPQAAQQQVTRRLLQLQEKLAGLR---------ERYTDSHPLVKATQAEIKDAQ
A0A1Q7GC33      GLSGDALSVVGSVQENPELSEALKELTTKQAELRGLR--YKYQDDYPPVQRLVGEIATLE
A0A2V6RFZ8      --NTQDVGTLPAVLQNPLVSKLREDLAALESEYEKLS--QVFKPGYPHMRQLAEKIAESR
A0A1Q7U8C0      --AIQTALAAPGMGASPALSQLSAQLFQYEMARDSLASRSARHPDLPRLNLLVSSTEA--
A0A2V6WUL2      --NGQDNGSLPVVLQSRLIVQLKQDLTTQEADYQRLG--QIFKPQYPRMQQLAQKIAEGR
A0A2V6UWS7      --STRDVDSLPAVLQSSMIAGRKQELAGLESEYRKLA--QTFKTDYPRMQQLAEKIAETR
A0A2V7HN10      --STRDVDSLPAVLQSSMIAGRKQELAGLESEYRKLA--QTFKTDYPRMQQLAEKIAETR
A0A1Q7D2L3      --SVQDAFTLPAVLQSPLIAQLKTDGAALEGEYRRFS--QTFKPDYPRMLALKEKIDENR
A0A2V6R309      --SGPDLDSLPVVLQSRLIVQLKQDLATQEAEYKKLG--QVFKPHYPRMQQLAQKIAEGR
A0A1F7MHS2      --REGGPNSAALEAKSEALAGLRAQEAAAQTELNNLL--KTYKDKHPAVVRARAQLDDIR
A0A1F7LDJ8      --REGGPNSAALEAKSEALAGLRAQEAAAQTELNNLL--KTYKDKHPAVVRARAQLDDIR
A0A353V8C8      --REGGPNSAALEAKSEALAGLRAQEAAAQTELNNLL--KTYKDKHPAVVRARAQLDDIR
                               .  :     .                     * :     .     

A0A2V6UHF5      DMLTAGPQGLPERVAAPQFGAAERAASAKQIADLEQEVSALETREEILKQRLARTSQGLS
A0A1Q7GC33      RQT--------------------IPALARALAGQLAAREG------ELSRRLDADSRSLR
A0A2V6RFZ8      RQL--------------------RTEIDRAAQAVQADYQAALRTEQELEGALAQQRLQAG
A0A1Q7U8C0      ----------------------------KLLRAVQAGVQGSIASLDGRIAAIDDLRAHWA
A0A2V6WUL2      RQL--------------------QAELRRAVESLRADYQAAARTEQEMEASLVQYRGMAR
A0A2V6UWS7      HQL--------------------RVEIDRAVAALQADYQAAVRTEREIEVALTQQRKLAR
A0A2V7HN10      HQL--------------------RVEIDRAVAALQADYQAAVRTEREIEVALTQQRKLAR
A0A1Q7D2L3      RQL--------------------RTEIDRTLASLKSDFESSVRSEKALEASLAKQSTLAR
A0A2V6R309      RQL--------------------QAELGRTVASLQADYQAAARTEQEMESALVRHRGLAR
A0A1F7MHS2      ARL--------------------KTEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQ
A0A1F7LDJ8      ARL--------------------KTEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQ
A0A353V8C8      ARL--------------------KTEHGRVFQALEGQYKIQKAREAAMLQAFERYKKETQ
                                            .         .            :        

A0A2V6UHF5      NLGAEELEVAKLRQSVESQRNLVTTLSEKLGTVRIQEQGEDRGLRLIDLAALPQRPSSVP
A0A1Q7GC33      RIPERAITEARLRRDATLSENLYASLQQQYDEARLAEVSTVSDVRVLDSAVVPRRPVKNT
A0A2V6RFZ8      GLADNMAKYNLLRREVDTSRDLYSSLLARLRETQISAALFTSNISIVDRAEISGMPSRPK
A0A1Q7U8C0      GGLQQDAEEARLKERVDNARKVADELRVEYQKAGIAEAITVGQVEIVDHAALPAKPAGIG
A0A2V6WUL2      RLSDRMAEYNLLRREVDTSRELYTSLLGRLRETQISSALLTSNIYVVDRAEIPSRPSRPK
A0A2V6UWS7      GLSDSMAEYSLLRREVDTSRELYASLLGRLRETQISAALFTSNISVVDRAEVPSTPYKPN
A0A2V7HN10      GLSDSMAEYSLLRREVDTSRELYASLLGRLRETQISAALFTSNISVVDRAEVPSTPYKPN
A0A1Q7D2L3      GLAENMAEYNLLRREVDTSRDLYASLLGRLRETQVSAALLTSNISVVDPAEIPIGPSRPR
A0A2V6R309      RLSARTAEYNLLRREVDTSRDLYTALLARLRETQISSALLTSNIYVVDRAEVPNHPSKPK
A0A1F7MHS2      DLARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPR
A0A1F7LDJ8      DLARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPR
A0A353V8C8      DLARKEVQFNVLQREATVGRDMLDFLIKRLRETGLSSELNTNTVRVAEAATVPTFPIRPR
                           *.  .    .:   *      . :        : : : * :.  *    

A0A2V6UHF5      AMRVILLGMVGGLGLGIGLAGLLEYFKQPMETEEDITAATGLPVLGWLPTIQGSGRPDKG
A0A1Q7GC33      APRLILLAFLGSFGLAVMGAILIDRADPRVRYPEQVSREMGLTILGAVPYVR---VRPQA
A0A2V6RFZ8      RSTNLLVGCIAGLLGGVVLALVFEYLDTNIKDAKDVESVLRVPILGMVPSWA-----LRR
A0A1Q7U8C0      LPEQIALGLLVGLMLGSAGAFLAERLGSTIAQRVQVER-LGMSVFGVITHWD--------
A0A2V6WUL2      RALNFVLACVVGLVGGVGVAFFFEYLDTSIKDAKEVEALLRVPTLGLVPSRRALERRGRR
A0A2V6UWS7      KAQNLLLACLVGLVGGVGLAFLFEYLDTNIKDTKEVESVLRVPALGLVPSRH-LGQGRRA
A0A2V7HN10      KAQNLLLACLVGLVGGVGLAFLFEYLDTNIKDTKEVESVLRVPALGLVPSRH-LGQGRRA
A0A1Q7D2L3      KMLNLLIACVAGIAGGIGLAFLFEYLDTNIKDTKEVESLLRVPALGVVPSRAAFERMLAR
A0A2V6R309      KALNLLLACVVGLLGGVGAAFFFEYLDTSIKDAKEVEAVLRVPTLGLVPSRRALERRARR
A0A1F7MHS2      RLQNLLMGLLAGLVGGLVIAFVLEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALK
A0A1F7LDJ8      RLQNLLMGLLAGLVGGLVIAFVLEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALK
A0A353V8C8      RLQNLLMGLLAGLVGGLVIAFVLEFAEDSVQNPDDVAQLLGAPLLGTVPVLQAVSPSALK
                    : :. : .:  .   * . :     :    ::      . :* :.           

A0A2V6UHF5      PER---------EPMSFIDVFAPNTLPIEACRSIRVSLLSMYRAEDVRTIMLASAGPGEG
A0A1Q7GC33      RPGHNGGPRQP----------EDAAMVVEALRGVCLNLSYAQRAAAPLLVTITSPGAGDG
A0A2V6RFZ8      RREPADG-----RPFALAAQSTTASDFAEAFRNLRTSLLYSSPDHPPKTILVTSLQPEDG
A0A1Q7U8C0      RDAREKGVKNP-------------DAVVEAFRGLRLTLVNEYGAPGPIVVTVTSPGSGDG
A0A2V6WUL2      RRELVQG--DRLGPFALVSHADMSSVFSEAFRNLRTSLLYSAPDHPPKTLLVTSLYPEDG
A0A2V6UWS7      RRALAAG--DS-APFALLAHSQMGSVFSEAFRNLRTSLLYSTPDHPPKTILVTSPHPEDG
A0A2V7HN10      RRALAAG--DS-APFALLAHSQMGSVFSEAFRNLRTSLLYSTPDHPPKTILVTSPHPEDG
A0A1Q7D2L3      RKAVESGPTAE-TPFALVSHSELPSVFAEAFRNLRTSILYSTPERPPKTLMMTSLQPEDG
A0A2V6R309      RREFVHG--DD-LPFALVCHADMSSVFSEAFRNLRTSLLYSAPDHPPRTLLVTSLHPEDG
A0A1F7MHS2      DA-------PDKARHRLVETDGADTRAVESLNLIGVALRSDSNGSLPRRILVTSATPQEG
A0A1F7LDJ8      DA-------PDKARHRLVETDGADTRAVESLNLIGVALRSDSNGSLPRRILVTSATPQEG
A0A353V8C8      DA-------PDKARHRLVETDGADTRAVESLNLIGVALRSDSNGSLPRRILVTSATPQEG
                                            *: . :   :           : ::*  . :*

A0A2V6UHF5      KSTVALNLSYVFSQAGR-RLLMVDGDLRRPSLNRPLRLPVKPGLVDVLASHLPLAAALQP
A0A1Q7GC33      KSFLVANLGHTFAEAGH-RTLLIDGDIRRGVLHRRLSARRRPGLTDFLRGEVPVEAIVQA
A0A2V6RFZ8      KTSLATNLAISLVQLGRVEVLMIDADMRRPNLHNVLSVRQAPGLSTFLTGQAELADVIVP
A0A1Q7U8C0      KSFVSSNLALAFA-YAKQRTLLVDADLRRGALHRLLNLRRQPGLTDFLIGDVSRAPALQT
A0A2V6WUL2      KTSLVSNLAITLAQLGAGEVLLIDADMRRPSLHEVLRLAQAPGLSTFLTGQAELNDVIKP
A0A2V6UWS7      KTSLVTNLAITLAQLGSGEILVIDADMRRPNLHEILELPKAPGLSTYLTGQAELADVVVA
A0A2V7HN10      KTSLVTNLAITLAQLGSGEILVIDADMRRPNLHEILELPKAPGLSTYLTGQAELADVVVA
A0A1Q7D2L3      KTSLVTNLAITLSQLGGSPVILVDADMRRPMVHRVLNIEQTPGLSTYLTGQADLEQVIVP
A0A2V6R309      KTSLVTNLAITLAQLGAGEVLLIDADMRRPSLHEILGVAQAPGLSTFLTGQAALTDVIKP
A0A1F7MHS2      KSTIAANLAVTLARLGT-RVLLVDTDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRP
A0A1F7LDJ8      KSTIAANLAVTLARLGT-RVLLVDTDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRP
A0A353V8C8      KSTIAANLAVTLARLGT-RVLLVDTDLRHPTLDRFFGVRTPSDIGEAARRGTPLGEAVRP
                *: :  **.  :   .    :::* *:*.  :   :     ..:             : .

A0A2V6UHF5      IKDGFQLLAAGTTDGADPGVLLSADNISRLFDLAKGHADLVVFDSAPVLAVADNLALASM
A0A1Q7GC33      TPYPSLSLIGCGTRASNAPELLGSQVMAQLVTTLRPSYDVILVDSPPLGAGVDPLILGTL
A0A2V6RFZ8      TSVRNLSIIPSGRIPLNPAELLTSTRLPQALEGLGGRFAHIVVDTGPIFGVSDAMIVAAQ
A0A1Q7U8C0      TAYPFLDFLPSGTRRRDAPELMGSAAMVDLVTSLRSTYDVIVLDTAPLGAGVDALALAKL
A0A2V6WUL2      TRIPNLSAIPSGRIPLNPAELLASSRLRQALTALEARYAYVVFDTGPLFGISDAMVLAAQ
A0A2V6UWS7      SAIPNLSVIPAGLVPLNPSELLASARFKQALDTLGQRFAYIIVDTGPLFGVSDGMILAGQ
A0A2V7HN10      SAIPNLSVIPAGLVPLNPSELLASARFKQALDTLGQRFAYIIVDTGPLFGVSDGMILAGQ
A0A1Q7D2L3      SGIPNLFVIPAGRIPVNPAELLASARLREMIEALGQRFAYIVFDIGPMFGVSDAMILAGQ
A0A2V6R309      TGIPHLSSIPSGRIPLNPAELLASTRLRQALTTLEVGFAYVVFDTGPLFGISDAMVLAAQ
A0A1F7MHS2      TAVPGLSLLPVGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPL
A0A1F7LDJ8      TAVPGLSLLPVGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPL
A0A353V8C8      TAVPGLSLLPVGRVTGSPLALIKSAYFSAQLDALAEEFDLILFDSPPITLVADSMALAPL
                                ..  *: :  :   .         ::.*  *:    * : :.  

A0A2V6UHF5      VDAVILVVRAGVTQRRDLVRAKAMLDKVRAPVVGAVLNRVSSRETRRYYRSY-SGYY---
A0A1Q7GC33      AGHLAVVLRTGYSHRDMAAAKLDVVQRLPVRLLGAILNAVPAGAAYGYYSYY--SYYLS-
A0A2V6RFZ8      VEGVVLVLRHGRASRDAAQRAIRNLMSVGAKLLGVILNDVDVRAEG-YYGYY--SNY---
A0A1Q7U8C0      AGNLLMVLRLGRTDRELAEAKLEILRRLPLRLLGAVLNDVRDESEYRAYAYYMDGYALTN
A0A2V6WUL2      VEGVVLVLRHGRATRDASQRAIRSLLSVRARLLGVVLNDVDVSGQG-SYGYY--GYY---
A0A2V6UWS7      VEGVVLVLRQGRASRDAAQRAIRSLLAVRARLLGVILNDVEVGGTR-YYGYY--DYY---
A0A2V7HN10      VEGVVLVLRQGRASRDAAQRAIRSLLAVRARLLGVILNDVEVGGTR-YYGYY--DYY---
A0A1Q7D2L3      LEGTVLVLRHGRASRDAAQRAVRSLTAVRARLLGVILNDVDIHANGYGYGYY--GYY---
A0A2V6R309      VEGVVLVLRHGRATRDAAQRAVRSLLSVRARLLGVVLNDVDLSGQG-SYGYY--GYY---
A0A1F7MHS2      TEGIVLVVRHGHGSQWRLRKMVGQLDRIRVPVLGFVYDGYTPRDDK-HYSYY----Y---
A0A1F7LDJ8      TEGIVLVVRHGHGSQWRLRKMVGQLDRIRVPVLGFVYDGYTPRDDK-HYSYY----Y---
A0A353V8C8      TEGIVLVVRHGHGSQWRLRKMVGQLDRIRVPVLGFVYDGYTPRDDK-HYSYY----Y---
                     :*:* *   .         :  :   ::* : :          *  *        

A0A2V6UHF5      ----------GVGEGTSVRRRFRSAQSWWPIRRSEKVG-
A0A1Q7GC33      --------GYEAVDEENERSNGSKGQPLVT---------
A0A2V6RFZ8      --------GYEAEKETA----------------------
A0A1Q7U8C0      EPPFRPLGGKQGASSHAAG--------------------
A0A2V6WUL2      --------GYDARAAEGAAKEVRSHGSST----------
A0A2V6UWS7      --------GNGGSNGHAAGEGHRNGTAHEPVADDSRRAS
A0A2V7HN10      --------GNGGSNGHAAGEGHRNGTAHEPVADDSRRAS
A0A1Q7D2L3      --------GYSSNESTVARRN------------------
A0A2V6R309      --------GYGARSAEGAAKEVSSQGSRA----------
A0A1F7MHS2      --------GAPRKRTSRGRAGNQTVGRGS----------
A0A1F7LDJ8      --------GAPRKRTSRGRAGNQTVGRGS----------
A0A353V8C8      --------GAPRKRTSRGRAGNQTVGRGS----------
                                                       

© 1998-2019