BYKdb

Dataset for cluster orphancd of phylum candidatus-schekmanbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1F7RIE5      -----MNQLVVKPGGRSLISEAYRSLRTNIQFANPIYFSKEILFTSVGPNEGKSTTVANL
A0A1F7SPN8      ----------MFLDPRSPVIEQYRSLRTHLLAESGNKSINTFLVTSSIRGEGKSITSCNL
A0A1F7RIF5      MSEECNECLVTLLDPRSPVAEQYRSLKTHLMGEAETRLISTFLVTSTIRGEGKTTTACNL
A0A1F7S3V5      MSEECNECLVTLLDPRSPAAEQYRSLKAHLMGEAETRLINTFLVTSTIRGEGKTTTACNI
                             . **   * ****.:::         . :*.**   .***: * .*:

A0A1F7RIE5      SATLALM-GNQVVMVDCDLRKPVLHKIFGCSQSSGITNILADSHSIDENFLKTCIQETRI
A0A1F7SPN8      GIILAHNRQNSVLLVDGDMRIPSIHKIFGIRGNRGLVDYLKGESELD-----SLIVPTKI
A0A1F7RIF5      GVTLANNPQHSVLIIDGDMRIPSVHKMFGIKYEKGLIEYLRGEADLD-----SLLVPTHL
A0A1F7S3V5      GVTLANNPQHSVLIIDGDMRIPSVHKMFGIKYEKGLIEYLRGEADLD-----SLLVPTHL
                .  **    :.*:::* *:* * :**:**   . *: : * .. .:*     : :  *.:

A0A1F7RIE5      PNLHLLASGSIPPNPSELLGIKRFDQIM--EILRNLYDYVIVDTTPVIGITDSCVLASRI
A0A1F7SPN8      DNLFILPAGEPQTSPSELLATSKMTDFLRMEESKGKNHYVIIDSPPIISTTDPRIIATYV
A0A1F7RIF5      DNLFVLPAGEPCSNPSELLASPRMRDLIKNEEAKGKGHYLIIDSPPIISTTDSRILSGYV
A0A1F7S3V5      DNLFILPAGEPCSNPSELLASPRMRDLIKNEEAKGKGHYLIIDSPPIISTTDSRILSGYA
                 **.:*.:*.  ..*****.  .: :::  *  ..   *:*:*:.*:*. **. :::   

A0A1F7RIE5      HRVMLIIDLKSTSKDMVLRSKKLLENVGAKINGVVVTKLKRNNFNSGYYNYYKYYYHEKG
A0A1F7SPN8      GGVLLVVQAGRTPRDVISHGLSLLKN--VNILGIILNNISGISPYYPYRYSYAYGYVEYS
A0A1F7RIF5      GGVILVVQSRKTPIDIINHGLSLLKN--AQILGVVLNNISGISPYYSYIYSYAYGYAEYS
A0A1F7S3V5      GGVILVVQSGKTPIDIINHGLSLLKN--AQILGVVLNNISGISPYYPYNYSYAYGYAEYS
                  *:*:::   *. *:: .. .**:*  .:* *:::.::.  .    *   * * * * .

A0A1F7RIE5      NGKPKTPNRLENKHAM
A0A1F7SPN8      K---------------
A0A1F7RIF5      K---------------
A0A1F7S3V5      K---------------
                :               

© 1998-2019