BYKdb

Dataset for cluster tadcd of phylum candidatus-schekmanbacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1RMR4      MDVAKKIETKLSLKDYFYIVKKRVWTVVLIAMFILVSVSIATFKQKKLYMAKSRILIEYS
A0A1F7RAT1      --MEKKIEIKPHLRDYIYILKKRAWTVFLVFTFLLLTVTIATFKQVKIYVAVAQIMIEYS
A0A1F7SHX0      --MEKKVEVKIHLKDYLYILKKRMWTVVLVFIFLLLTVTIATFKQVKIYRAVCQIMIEFS
                  : **:* *  *.**:**:*** ***.*:  *:*::*:****** *:* * ..*:**:*

A0A3M1RMR4      ASNIVSFQDINKFSGYNEYFETQYEIIKSRMVALEVVDRLFPNENLTEDERIARADAIRA
A0A1F7RAT1      PTQIVAFPDISQVSGYREYFETQFKIITSRSVALEVINRLYPGKNFTEDERLSLADFIRE
A0A1F7SHX0      ADRIVSFPDISQVSGYREYFETQFKIIKSRSAALEVINILFPGKNFTEDEKLSLADEIRE
                . .**:* **.:.***.******::**.** .****:: *:*.:*:****.:: ** ** 

A0A3M1RMR4      KIIVNPVKGTNLVDLAMMGPDPKEVARLVNLVTDVYIEKSLEDKVNSYKTASSWLDDQIT
A0A1F7RAT1      RITVDPIKKTNLADLRVKGPDPVESTNLVNTIAEIYIEKSLESKVNDYKTASGWLDDQIT
A0A1F7SHX0      RIKVNPIKGTNLVNLEVEGSDPNEITSLVNTISEVYMEKSLESKVNDYKTASGWLDDQIT
                .* *:*:* ***.:* : *.** * : *** ::::*:*****.***.*****.*******

A0A3M1RMR4      SVIVKMKKAEFDLQKYREQKQIISPKIEERQSNVIAELNQVTRELQGLRSRKLELEIALK
A0A1F7RAT1      SVILKMKKAEFDLQKYREDKKIISPKIEDRQGSVIEELTRVNGELIQLKLKKVELEIALS
A0A1F7SHX0      SVILKMKKAEFDLQKYRENKKIISPKIEDRQGSVMDELTLVNVERNQLKSKKVELEISLS
                ***:**************:*:*******:**..*: **. *. *   *. .*:****:*.

A0A3M1RMR4      QIKELRDKGIDIDETTLPEVLQGTGIQAMRGQIYALTQTLYKLKTEFGEKHPEVLKVKAQ
A0A1F7RAT1      QIKTMGDKGIDINETSLPGTFNESGIQAMRQKIYNLKEELAKLEKTYMPKHPRMIRLKEE
A0A1F7SHX0      QIKSMTEKGIDIDETTLPGFMKQTNLPGMRQKTYAIKEEIAKLEKTYMPKHPRVVRAKEE
                *** : :*****:**:**  :: :.: .** : * :.: : **:. :  *** ::. * :

A0A3M1RMR4      IDAINKNIQTEIDKVINRINNQYELLKAKEKLYNERKKELNNTAIGLLERSIQYNILNRE
A0A1F7RAT1      LLAIQNNIKDEIQSVIDKVQNEHELLVSKEKILIERKDELNEEAISLLDKSIQYNILDRE
A0A1F7SHX0      LTALQENIKNEIRTIIESIQNDYELTKSKEGILNERRDELNEEAISLLERSIQYNILDRE
                : *:::**: ** .:*: ::*::**  :** :  **..***: **.**:.*******:**

A0A3M1RMR4      VEINRNLYDYLLKRAGEINVTGSMRFNNISLVDKATVPKKPISPNVPRNLILGAVVGLIF
A0A1F7RAT1      VQINRNLYDYLLKRAGEINVTGSMRFSNISLVDKATIPKEPVAPNKPKNIILGALVGLIL
A0A1F7SHX0      VEINRNLYDYLLKRAGEINVTGSMRFSNITLVDKATVPKVPVAPNKPRNILLGTLVGLIL
                *:************************.**:******:** *::** *.*::**::****:

A0A3M1RMR4      GLGFAFFLEYLDETIRSLEDVEHYLNLPILGFVPNIHSYMKKRSQRVSPELITYTHPKST
A0A1F7RAT1      GTGLAFFLEYLDTTIRSIEDVEHYFSIPLFGFVPSFGAYIKKQDKKADVELVSFTYPKST
A0A1F7SHX0      GCGLAFFLEYLDTTIRSIEDIEHYINIPLLGFVPSFSAYIKRREKRSNPELVSFTHPKST
                * *:******** ****:**:***:.:*::****.: :*:*...:. . **:::*:****

A0A3M1RMR4      VSECYRAVRTNILFSTEVPPKVIMVTSSTPGEGKTVSAVNIAIAMAQSEKKVLLMDGDLR
A0A1F7RAT1      IAECYRAIRTNLLFSSEHPPKVLMVTSSTPEEGKTMTSVNLSISMANSEKRVLLIDADLR
A0A1F7SHX0      VAECYRAIRTNLLFSSDHPPKVMMVTSSTPEEGKTITSVNLAITMAHSEKRVLLIDADLR
                ::*****:***:***:: ****:******* ****:::**::*:**:***.***:*.***

A0A3M1RMR4      RSRIHDIFRLENKYGLSTLLTDENIDAFSLIVKSSITNLNILPSGPVPKNPAELLMKERM
A0A1F7RAT1      KSRIHKIFKVENKFGLSTILTD-NIDPLSIVVKTKIPYLSILTSGPLPKNPAELLMSVRM
A0A1F7SHX0      KSRIHEIFKIENRFGFSTILTD-SIDPLSVIIKTKIPYLSVLTSGPLPKNPSELLMSLRM
                .****.**.:**.:*:**:*** .**.:*:::*:.*. *.:*.***:****:****. **

A0A3M1RMR4      KSLIKIYKDNFDIIIIDAPPVVPVTDPSIISKYSDVVCLVVRSGVTAKNIVEKNAKRFLD
A0A1F7RAT1      REVLNIFRNNYDFIFIDSPPILPVTDPSIIAKYVDVVCLVVRSGVTSKDVAIKNAKKFQE
A0A1F7SHX0      RELINIFRNNYDFILLDSPPILPVTDPSIIARYSDVVCFVIRSGVTGKDVVIKNAKKFQE
                ..:::*:.:*:*:*::*:**::********:.* ****:*:*****.*::. ****.* :

A0A3M1RMR4      LDVKRLNVLLNDVRKQDSDYYYSEYYYSYYKKEEELHQV
A0A1F7RAT1      IDVKRLGVILNDVSRQNSDYYYTEYYYSYYHRAEDLENL
A0A1F7SHX0      LEVKRLGVILNDVSKQDSNYYYTEYYYSYYNRAEDLESQ
                ::****.*:**** .*:*:***:*******:. *:* . 

© 1998-2019