BYKdb

Dataset for cluster orphancd of phylum candidatus-sumerlaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V5FRG6      -----------------MAKVLDALEQARRE-----------------------------
A0A353GLB1      SKSERPLNAAPVAPVQPIAALIPEITSARKKTPPDEGPQQPDNLNVEIKDLMAEIFAQPT
                                 :* ::  : .**.:                             

A0A1V5FRG6      ----------------RLRKLRA-------------------------------------
A0A353GLB1      IDIAPTAVREKPEENSQVPDLQAEIEVNIQSVVQDETSFFSQVKEEIETFVPDDPEPTVS
                                .: .*.*                                     

A0A1V5FRG6      ------------------------------------------------------------
A0A353GLB1      LPNVKQNASDVSARFQADDTLPPFDVTPPIVQAQEEVSSAADLYPTLDFEVPKVTATVNS
                                                                            

A0A1V5FRG6      ----AGARVEAPLNPTEPGDDLELELVEAP-------------------QRESALRPGQR
A0A353GLB1      APIPSGTVSEAPDPPSESEKVVAAAPMTIPEASVPKVPTPVTPPVTAARQAEPVFVLDPE
                    :*:  ***  *:*. . :    :  *                   * *..:  .  

A0A1V5FRG6      PVVAPA------------------------------------------------------
A0A353GLB1      PVIPPAKPEPLPTQPLFPNQLETNASVPVAPTIPPPESPLFPNSEKRDALSGGRERHRLT
                **:.**                                                      

A0A1V5FRG6      -------------------------AHPHIAPEIVALHASDSPVAEQVRQIRTNLETVLA
A0A353GLB1      PKRTKGEIPVPGPDPDPLSIQRITVVHPRPDKRVLSFYEPKHHICEEYRLLGKNLLHTFA
                                         .**.    ::::: ..  :.*: * : .**  .:*

A0A1V5FRG6      KL-----TARTIVITSPVSGDGKTLVAANLATILADDPRTRVMLVDADLRKPDQHRLFGV
A0A353GLB1      NTGEITRRGKVVTLTSSIRGEGKTLTSINLSLNMADDLKNRILLIDGDLRHPKVHKYLGL
                :       ...:.:**.: *:****.: **:  :*** ..*::*:*.***:*. *. :*:

A0A1V5FRG6      KGSPGLAEYLRG--RHELADVAVGTSIPNLDFIPAGFPPDKPTVLLSGERMGELLKTLEE
A0A353GLB1      PGQTGLNDLINSADPKSILEDCIVRTESGLHCLFSQATRENPAPMLDTPRMSEILELLRD
                 *..** : :..   :.: : .:  : ..*  : :  . ::*: :*.  **.*:*: * :

A0A1V5FRG6      TYQWVLFDTPPMLPVTDASLLARHVTGLILVVRVGSTTRGAIERTQEMLAETHLPILGCI
A0A353GLB1      RYSVIIIDTPPVLLATDSLVLGSRSDGVLFILRARKTKREQIQEARQRIARLEIRMLGYV
                 *. :::****:* .**: :*. .  *:::::*. .*.*  *: :.: :*   : :** :

A0A1V5FRG6      LNDFNDHAAP--GGYYHKAYGRAEAVAADEQG
A0A353GLB1      INNVKTFLPKIWSRYYYGNY------------
                :*:.: . .   . **:  *            

© 1998-2019